Atlas of Genetics and Cytogenetics in Oncology and Haematology
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
XPO1E571K Mutation Modifies Exportin 1 Localisation And
cancers Article XPO1E571K Mutation Modifies Exportin 1 Localisation and Interactome in B-Cell Lymphoma Hadjer Miloudi 1, Élodie Bohers 1,2, François Guillonneau 3 , Antoine Taly 4,5 , Vincent Cabaud Gibouin 6,7 , Pierre-Julien Viailly 1,2 , Gaëtan Jego 6,7 , Luca Grumolato 8 , Fabrice Jardin 1,2 and Brigitte Sola 1,* 1 INSERM U1245, Unicaen, Normandie University, F-14000 Caen, France; [email protected] (H.M.); [email protected] (E.B.); [email protected] (P.-J.V.); [email protected] (F.J.) 2 Centre de lutte contre le Cancer Henri Becquerel, F-76000 Rouen, France 3 Plateforme Protéomique 3P5, Université de Paris, Institut Cochin, INSERM, CNRS, F-75014 Paris, France; [email protected] 4 Laboratoire de Biochimie Théorique, CNRS UPR 9030, Université de Paris, F-75005 Paris, France; [email protected] 5 Institut de Biologie Physico-Chimique, Fondation Edmond de Rothschild, PSL Research University, F-75005 Paris, France 6 INSERM, LNC UMR1231, F-21000 Dijon, France; [email protected] (V.C.G.); [email protected] (G.J.) 7 Team HSP-Pathies, University of Burgundy and Franche-Comtée, F-21000 Dijon, France 8 INSERM U1239, Unirouen, Normandie University, F-76130 Mont-Saint-Aignan, France; [email protected] * Correspondence: [email protected]; Tel.: +33-2-3156-8210 Received: 11 September 2020; Accepted: 28 September 2020; Published: 30 September 2020 Simple Summary: Almost 25% of patients with either primary mediastinal B-cell lymphoma (PMBL) or classical Hodgkin lymphoma (cHL) possess a recurrent mutation of the XPO1 gene encoding the major nuclear export protein. -
The Nuclear Export Factor CRM1 Controls Juxta-Nuclear Microtubule-Dependent Virus Transport I-Hsuan Wang1,*,‡, Christoph J
© 2017. Published by The Company of Biologists Ltd | Journal of Cell Science (2017) 130, 2185-2195 doi:10.1242/jcs.203794 RESEARCH ARTICLE The nuclear export factor CRM1 controls juxta-nuclear microtubule-dependent virus transport I-Hsuan Wang1,*,‡, Christoph J. Burckhardt1,2,‡, Artur Yakimovich1,‡, Matthias K. Morf1,3 and Urs F. Greber1,§ ABSTRACT directly bind to virions, or move virions in endocytic or secretory Transport of large cargo through the cytoplasm requires motor vesicles (Greber and Way, 2006; Marsh and Helenius, 2006; proteins and polarized filaments. Viruses that replicate in the nucleus Yamauchi and Greber, 2016). While short-range transport of virions of post-mitotic cells use microtubules and the dynein–dynactin motor often depends on actin and myosin motors (Taylor et al., 2011), to traffic to the nuclear membrane and deliver their genome through long-range cytoplasmic transport requires microtubules, and, in the nuclear pore complexes (NPCs) into the nucleus. How virus particles case of incoming virions, the minus-end-directed motor complex – (virions) or cellular cargo are transferred from microtubules to the dynein dynactin (Dodding and Way, 2011; Hsieh et al., 2010). NPC is unknown. Here, we analyzed trafficking of incoming Like cellular cargo, viruses engage in bidirectional motor- cytoplasmic adenoviruses by single-particle tracking and super- dependent motility by recruiting cytoskeletal motors of opposite resolution microscopy. We provide evidence for a regulatory role of directionality (Greber and Way, 2006; Scherer and Vallee, 2011; CRM1 (chromosome-region-maintenance-1; also known as XPO1, Welte, 2004). The net transport balance of a cargo is determined at exportin-1) in juxta-nuclear microtubule-dependent adenovirus the level of motor recruitment, motor coordination and the tug-of- transport. -
Original Article Epithelioid Inflammatory Myofibroblastic Sarcoma of Stomach: Diagnostic Pitfalls and Clinical Characteristics
Int J Clin Exp Pathol 2019;12(5):1738-1744 www.ijcep.com /ISSN:1936-2625/IJCEP0092254 Original Article Epithelioid inflammatory myofibroblastic sarcoma of stomach: diagnostic pitfalls and clinical characteristics Pei Xu1, Pingping Shen2, Yangli Jin3, Li Wang4, Weiwei Wu1 1Department of Burns, Ningbo Huamei Hospital, University of Chinese Academy of Science (Ningbo No. 2 Hospital), Ningbo, China; Departments of 2Gastroenterology, 3Ultrasonography, Yinzhou Second Hospital, Ningbo, China; 4Department of Pathology, Clinical Pathological Diagnosis Center, Ningbo, China Received February 3, 2019; Accepted February 26, 2019; Epub May 1, 2019; Published May 15, 2019 Abstract: Inflammatory myofibroblastic tumor (IMT) is a neoplasm composed of spindled neoplastic myofibroblasts admixed with reactive lymphoplasmacytic cells, plasma cells, and/or eosinophils, which has an intermediate bio- logical behavior. An IMT variant with plump round epithelioid or histiocytoid tumor cells, recognized as epithelioid inflammatory myofibroblastic sarcoma (EIMS), has a more clinically aggressive progression. To the best of our knowl- edge, only about 40 cases of EIMS have previously been reported in limited literature. Here, we report here a case of unusual EIMS with a relative indolent clinical behavior. We reviewed the literature for 18 similar cases. The patients present with a highly aggressive inflammatory myofibroblastic tumor characterized by round or epithelioid morphol- ogy, prominent neutrophilic infiltrate, and positive staining of ALK with RANBP2-ALK gene fusion or RANBP1-ALK gene fusion, or EML4-ALK gene fusion. Our case is the first case of primary stomach EIMS. Moreover, the mecha- nisms of the rare entity have not been widely recognized and require further study. Early accurate diagnosis and complete resection of this tumor is necessary. -
T-Cell Receptor (TCR) Signaling Promotes the Assembly of Ranbp2
RESEARCH ARTICLE T-cell receptor (TCR) signaling promotes the assembly of RanBP2/RanGAP1- SUMO1/Ubc9 nuclear pore subcomplex via PKC--mediated phosphorylation of RanGAP1 Yujiao He1, Zhiguo Yang1†, Chen-si Zhao1†, Zhihui Xiao1†, Yu Gong1, Yun-Yi Li1, Yiqi Chen1, Yunting Du1, Dianying Feng1, Amnon Altman2, Yingqiu Li1* 1MOE Key Laboratory of Gene Function and Regulation, Guangdong Province Key Laboratory of Pharmaceutical Functional Genes, State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou, China; 2Center for Cancer Immunotherapy, La Jolla Institute for Immunology, La Jolla, United States Abstract The nuclear pore complex (NPC) is the sole and selective gateway for nuclear transport, and its dysfunction has been associated with many diseases. The metazoan NPC subcomplex RanBP2, which consists of RanBP2 (Nup358), RanGAP1-SUMO1, and Ubc9, regulates the assembly and function of the NPC. The roles of immune signaling in regulation of NPC remain poorly understood. Here, we show that in human and murine T cells, following T-cell receptor (TCR) stimulation, protein kinase C-q (PKC-q) directly phosphorylates RanGAP1 to facilitate RanBP2 subcomplex assembly and nuclear import and, thus, the nuclear translocation of AP-1 transcription *For correspondence: factor. Mechanistically, TCR stimulation induces the translocation of activated PKC-q to the NPC, 504 506 [email protected] where it interacts with and phosphorylates RanGAP1 on Ser and Ser . RanGAP1 phosphorylation increases its binding affinity for Ubc9, thereby promoting sumoylation of RanGAP1 †These authors contributed and, finally, assembly of the RanBP2 subcomplex. Our findings reveal an unexpected role of PKC-q equally to this work as a direct regulator of nuclear import and uncover a phosphorylation-dependent sumoylation of Competing interests: The RanGAP1, delineating a novel link between TCR signaling and assembly of the RanBP2 NPC authors declare that no subcomplex. -
UBC9 (UBE2I) Antibody (N-Term) Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap1064a
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 UBC9 (UBE2I) Antibody (N-term) Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP1064a Specification UBC9 (UBE2I) Antibody (N-term) - Product Information Application WB, IHC-P,E Primary Accession P63279 Other Accession P63282, P63281, P63280, P63283, Q9DDJ0, Q9W6H5 Reactivity Human Predicted Zebrafish, Chicken, Mouse, Rat, Xenopus Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Antigen Region 1-30 Western blot analysis of anti-UBE2I Antibody (N-term) (Cat.#AP1064a) in A2058 cell line UBC9 (UBE2I) Antibody (N-term) - Additional lysates (35ug/lane). UBE2I(arrow) was Information detected using the purified Pab. Gene ID 7329 Other Names SUMO-conjugating enzyme UBC9, 632-, SUMO-protein ligase, Ubiquitin carrier protein 9, Ubiquitin carrier protein I, Ubiquitin-conjugating enzyme E2 I, Ubiquitin-protein ligase I, p18, UBE2I, UBC9, UBCE9 Target/Specificity This UBC9 (UBE2I) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Western blot analysis of UBE2I (arrow) using human UBC9 (UBE2I). rabbit polyclonal UBE2I Antibody (S7) (Cat.#AP1064a). 293 cell lysates (2 ug/lane) Dilution either nontransfected (Lane 1) or transiently WB~~1:1000 transfected (Lane 2) with the UBE2I gene. IHC-P~~1:50~100 Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by dialysis against PBS. Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Storage Maintain refrigerated at 2-8°C for up to 2 weeks. -
Quantitative SUMO Proteomics Reveals the Modulation of Several
www.nature.com/scientificreports OPEN Quantitative SUMO proteomics reveals the modulation of several PML nuclear body associated Received: 10 October 2017 Accepted: 28 March 2018 proteins and an anti-senescence Published: xx xx xxxx function of UBC9 Francis P. McManus1, Véronique Bourdeau2, Mariana Acevedo2, Stéphane Lopes-Paciencia2, Lian Mignacca2, Frédéric Lamoliatte1,3, John W. Rojas Pino2, Gerardo Ferbeyre2 & Pierre Thibault1,3 Several regulators of SUMOylation have been previously linked to senescence but most targets of this modifcation in senescent cells remain unidentifed. Using a two-step purifcation of a modifed SUMO3, we profled the SUMO proteome of senescent cells in a site-specifc manner. We identifed 25 SUMO sites on 23 proteins that were signifcantly regulated during senescence. Of note, most of these proteins were PML nuclear body (PML-NB) associated, which correlates with the increased number and size of PML-NBs observed in senescent cells. Interestingly, the sole SUMO E2 enzyme, UBC9, was more SUMOylated during senescence on its Lys-49. Functional studies of a UBC9 mutant at Lys-49 showed a decreased association to PML-NBs and the loss of UBC9’s ability to delay senescence. We thus propose both pro- and anti-senescence functions of protein SUMOylation. Many cellular mechanisms of defense have evolved to reduce the onset of tumors and potential cancer develop- ment. One such mechanism is cellular senescence where cells undergo cell cycle arrest in response to various stressors1,2. Multiple triggers for the onset of senescence have been documented. While replicative senescence is primarily caused in response to telomere shortening3,4, senescence can also be triggered early by a number of exogenous factors including DNA damage, elevated levels of reactive oxygen species (ROS), high cytokine signa- ling, and constitutively-active oncogenes (such as H-RAS-G12V)5,6. -
Small Gtpase Ran and Ran-Binding Proteins
BioMol Concepts, Vol. 3 (2012), pp. 307–318 • Copyright © by Walter de Gruyter • Berlin • Boston. DOI 10.1515/bmc-2011-0068 Review Small GTPase Ran and Ran-binding proteins Masahiro Nagai 1 and Yoshihiro Yoneda 1 – 3, * highly abundant and strongly conserved GTPase encoding ∼ 1 Biomolecular Dynamics Laboratory , Department a 25 kDa protein primarily located in the nucleus (2) . On of Frontier Biosciences, Graduate School of Frontier the one hand, as revealed by a substantial body of work, Biosciences, Osaka University, 1-3 Yamada-oka, Suita, Ran has been found to have widespread functions since Osaka 565-0871 , Japan its initial discovery. Like other small GTPases, Ran func- 2 Department of Biochemistry , Graduate School of Medicine, tions as a molecular switch by binding to either GTP or Osaka University, 2-2 Yamada-oka, Suita, Osaka 565-0871 , GDP. However, Ran possesses only weak GTPase activ- Japan ity, and several well-known ‘ Ran-binding proteins ’ aid in 3 Japan Science and Technology Agency , Core Research for the regulation of the GTPase cycle. Among such partner Evolutional Science and Technology, Osaka University, 1-3 molecules, RCC1 was originally identifi ed as a regulator of Yamada-oka, Suita, Osaka 565-0871 , Japan mitosis in tsBN2, a temperature-sensitive hamster cell line (3) ; RCC1 mediates the conversion of RanGDP to RanGTP * Corresponding author in the nucleus and is mainly associated with chromatin (4) e-mail: [email protected] through its interactions with histones H2A and H2B (5) . On the other hand, the GTP hydrolysis of Ran is stimulated by the Ran GTPase-activating protein (RanGAP) (6) , in con- Abstract junction with Ran-binding protein 1 (RanBP1) and/or the large nucleoporin Ran-binding protein 2 (RanBP2, also Like many other small GTPases, Ran functions in eukaryotic known as Nup358). -
Near-Complete Response to Low-Dose Ceritinib in Recurrent Infantile Inflammatory Myofibroblastic Tumour
Near-complete response to low-dose ceritinib in recurrent infantile inflammatory myofibroblastic tumour Abhenil Mittal1, Aarushi Gupta2, Sameer Rastogi1, Adarsh Barwad3 and Swati Sharma2 1Department of Medical Oncology, Dr Bhim Rao Ambedkar (BRA) Institute Rotary Cancer Hospital, All India Institute of Medical Sciences, New Delhi 110029, India 2Department of Radiodiagnosis, ABVIMS and Dr RML Hospital, New Delhi 110001, India 3Department of Pathology, All India Institute of Medical Sciences, New Delhi 110029, India Abstract Background: Infantile inflammatory myofibroblastic tumour (IMT) is rare and the major- ity are driven by anaplastic lymphoma kinase (ALK) rearrangements. Previous literature on the use of ALK inhibitors in paediatric IMTs is extremely limited with no published literature on the use in infants. Crizotinib and ceritinib are two ALK inhibitors which are available and have been used in IMTs; however, ceritinib is much more affordable in the low- and middle-income country (LMIC) setting than crizotinib. Case: An 11-month-old child, who had undergone surgery for mesenteric IMT at the age of 3 months, had an unresectable recurrence with soft tissue deposits in the subdia- Case Report phragmatic location abutting the spleen and paravesical location. As surgery would have entailed splenectomy and partial cystectomy, she was treated with low-dose ceritinib (300 mg/m2/day) with which she had a near-complete response without any toxicity. Discussion and conclusion: This is the first report of the use of ceritinib at a lower dose for infantile IMT having immense practical applications for the low- and middle-income setting. Keywords: ceritinib, infant, inflammatory myofibroblastic tumour, low dose Correspondence to: Sameer Rastogi Email: [email protected] ecancer 2021, 15:1215 Introduction https://doi.org/10.3332/ecancer.2021.1215 Published: 01/04/2021 Inflammatory myofibroblastic tumours (IMTs) are considered to be potentially malignant Received: 10/11/2020 tumours with a propensity for local recurrence and rarely metastasis [1, 2]. -
The Nucleoporin Nup153 Maintains Nuclear Envelope Architecture and Is Required for Cell Migration in Tumor Cells
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector FEBS Letters 584 (2010) 3013–3020 journal homepage: www.FEBSLetters.org The nucleoporin Nup153 maintains nuclear envelope architecture and is required for cell migration in tumor cells Lixin Zhou, Nelly Panté * Department of Zoology, University of British Columbia, 6270 University Boulevard, Vancouver, BC, Canada V6T 1Z4 article info abstract Article history: Nucleoporin 153 (Nup153), a component of the nuclear pore complex (NPC), has been implicated in Received 25 March 2010 the interaction of the NPC with the nuclear lamina. Here we show that depletion of Nup153 by RNAi Revised 12 May 2010 results in alteration of the organization of the nuclear lamina and the nuclear lamin-binding pro- Accepted 13 May 2010 tein Sun1. More striking, Nup153 depletion induces a dramatic cytoskeletal rearrangement that Available online 24 May 2010 impairs cell migration in human breast carcinoma cells. Our results point to a very prominent role Edited by Ulrike Kutay of Nup153 in connection to cell motility that could be exploited in order to develop novel anti-can- cer therapy. Keywords: Nucleoporin Structured summary: Nucleoporin 153 MINT-7893777: Lamin-A/C (uniprotkb:P02545) and NUP153 (uniprotkb:P49790) colocalize (MI:0403) by Nuclear pore complex fluorescence microscopy (MI:0416) Cell migration MINT-7893761: sun1 (uniprotkb:Q9D666) and Lamin-A/C (uniprotkb:P02545) colocalize (MI:0403) by Nuclear lamina fluorescence microscopy (MI:0416) Cytoskeleton Ó 2010 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved. 1. Introduction proach to reduce the cellular expression of Nup153. -
The Nucleoporin Ranbp2 Has SUMO1 E3 Ligase Activity
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Cell, Vol. 108, 109–120, January 11, 2002, Copyright 2002 by Cell Press The Nucleoporin RanBP2 Has SUMO1 E3 Ligase Activity Andrea Pichler,1,4 Andreas Gast,1,4 (Aos1/Uba2) and a single E2 conjugating enzyme (Ubc9) Jacob S. Seeler,2 Anne Dejean,2 have been identified in yeast and higher eukaryotes. In and Frauke Melchior1,3 vitro, these are sufficient to modify a number of SUMO1 1 Max-Planck Institute for Biochemistry targets, including IB␣, RanGAP1, and p53, and it was Am Klopferspitz 18a proposed that SUMO1 modification would not require 82152 Martinsried E3 ligases (references in Hay, 2001; Melchior, 2000; Germany Mu¨ ller et al., 2001). However, recently several SUMO 2 Unite´ de Recombinaison et Expression Ge´ ne´ tique E3-like factors were identified in yeast and mammalian INSERM U163 cells (Johnson and Gupta, 2001; Kahyo et al., 2001; Institut Pasteur Sachdev et al., 2001; Takahashi et al., 2001). These pro- 28 rue du Dr. Roux teins are different members of one family, the protein 75724 Paris Cedex 15 inhibitors of activated STAT (PIAS). Saccharomyces ce- France revisiae Siz1 is involved in septin modification, PIAS1 stimulates p53 modification, and PIASy enhances modi- fication of Lef1. Summary Based on immunofluorescence studies, both subunits of the SUMO1 E1 activating enzyme reside predomi- Posttranslational modification with SUMO1 regulates nantly in the nucleus (Azuma et al., 2001; Rodriguez et protein/protein interactions, localization, and stability. al., 2001). In addition, Ubc9 has been found in a complex SUMOylation requires the E1 enzyme Aos1/Uba2 and with SUMO1-modified RanGAP1 and RanBP2 (Lee et the E2 enzyme Ubc9. -
Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration
International Journal of Molecular Sciences Review Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration Baojin Ding * and Masood Sepehrimanesh Department of Biology, University of Louisiana at Lafayette, 410 East Saint Mary Boulevard, Lafayette, LA 70503, USA; [email protected] * Correspondence: [email protected] Abstract: Nucleocytoplasmic transport (NCT) across the nuclear envelope is precisely regulated in eukaryotic cells, and it plays critical roles in maintenance of cellular homeostasis. Accumulating evidence has demonstrated that dysregulations of NCT are implicated in aging and age-related neurodegenerative diseases, including amyotrophic lateral sclerosis (ALS), frontotemporal dementia (FTD), Alzheimer’s disease (AD), and Huntington disease (HD). This is an emerging research field. The molecular mechanisms underlying impaired NCT and the pathogenesis leading to neurodegener- ation are not clear. In this review, we comprehensively described the components of NCT machinery, including nuclear envelope (NE), nuclear pore complex (NPC), importins and exportins, RanGTPase and its regulators, and the regulatory mechanisms of nuclear transport of both protein and transcript cargos. Additionally, we discussed the possible molecular mechanisms of impaired NCT underlying aging and neurodegenerative diseases, such as ALS/FTD, HD, and AD. Keywords: Alzheimer’s disease; amyotrophic lateral sclerosis; Huntington disease; neurodegenera- tive diseases; nuclear pore complex; nucleocytoplasmic transport; Ran GTPase Citation: Ding, B.; Sepehrimanesh, M. Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration. 1. Introduction Int. J. Mol. Sci. 2021, 22, 4165. As a hallmark of eukaryotic cells, the genetic materials are separated from the cyto- https://doi.org/10.3390/ijms plasmic contents by a highly regulated membrane, called nuclear envelope (NE), which 22084165 has two concentric bilayer membranes, the inner nuclear membrane (INM), and outer nuclear membrane (ONM). -
UBE2I (Ubc9) [GST-Tagged] E2 - SUMO Conjugating Enzyme
UBE2I (Ubc9) [GST-tagged] E2 - SUMO Conjugating Enzyme Alternate Names: P18, SUMO-1 protein ligase, UBC9, Ubiquitin conjugating enzyme UbcE2A, Ubiquitin like protein SUMO-1 conjugating enzyme Cat. No. 62-0065-020 Quantity: 20 µg Lot. No. 1426 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the SUMOylation pathway Species: human Protein Sequence: play a pivotal role in a number of cellu- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEH lar processes including nuclear transport, Source: E. coli expression LYERDEGDKWRNKKFELGLEFPNLPYYIDGD signal transduction, stress responses and VKLTQSMAIIRYIADKHNMLGGCPKER cell cycle progression. Covalent modifica- Quantity: 20 µg AEISMLEGAVLDIRYGVSRIAYSKDFETLKVD tion of proteins by small ubiquitin-related FLSKLPEMLKMFEDRLCHKTYLNGDHVTHP modifiers (SUMOs) may modulate their Concentration: 1 mg/ml DFMLYDALDVVLYMDPMCLDAFPKLVCFK stability and subcellular compartmen- KRIEAIPQIDKYLKSSKYIAWPLQGWQAT talisation. Three classes of enzymes are Formulation: 50 mM HEPES pH 7.5, FGGGDHPPKSDLEVLFQGPLGSMSGIALSR involved in the process of SUMOylation; 150 mM sodium chloride, 2 mM LAQERKAWRKDHPFGFVAVPTKNPDGTMN an activating enzyme (E1), conjugating dithiothreitol, 10% glycerol LMNWECAIPGKKGTPWEGGLFKLRMLFKD enzyme (E2) and protein ligases (E3s). DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEED UBE2I is a member of the E2 conjugating Molecular Weight: ~45 kDa KDWRPAITIKQILLGIQELLNEPNIQDPAQAEA enzyme family and cloning of the human YTIYCQNRVEYEKRVRAQAKKFAPS gene was first described by Wang et al. Purity: >98% by InstantBlue™ SDS-PAGE Tag (bold text): N-terminal glutathione-S-transferase (GST) (1996). The human UBE2I cDNA contains Protease cleavage site: PreScission™ (LEVLFQtGP) 7 exons sharing 56% and 100% identity Stability/Storage: 12 months at -70˚C; UBE2I (regular text): Start bold italics (amino acid resi- with the yeast and mouse homologues aliquot as required dues 1-158) Accession number: NP_003336 (Nacerddine et al., 2005; Shi et al., 2000; Wang et al., 1996).