Biochemistry Biostatistics and Bioinformatics Protein Sequence Analysis

Total Page:16

File Type:pdf, Size:1020Kb

Biochemistry Biostatistics and Bioinformatics Protein Sequence Analysis 1 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis Description of Module Subject Name Biochemistry Paper Name 13 Biostatistics and Bioinformatics Module Name/Title 05 Protein Sequence Analysis 2 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis 1. Objectives: In this module, the students will: 1. Understand protein sequence analysis for Biochemistry and Molecular biology experiments 2. Learn downloading annotated protein sequences from UniProtKB 3. Compute various Biochemical parameters for a given protein sequence 4. Learn prediction of post-translational modifications 5. Learn prediction of signal peptide and transmembrane helices in a given protein sequence 6. Learn downloading raw protein sequences using genome browser. 7. Conduct analysis of a given protein sequence to find repeats using RADAR and visualize the presence of direct repeats using DotPlot 8. Using InterProScan to finds family, domains, repeats and sites in a given protein sequence. 9. Use PeptideCutter to search peptide bonds cutting enzymes and/ or chemicals for cleaving sites in an input protein sequence 2. Concept Map Protein Sequence Analysis Downloading UniProtKB Sequence Protein Parameter Computation PTM Prediction Signal and TM peptide Prediction Repeat Analysis and Visualization Using IntroProScan Using PeptideCutter 3. Protein Sequence Analysis 3 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis Protein sequence analysis for Biochemistry and Molecular biology experiments begins with obtaining a sequence in the laboratory or from sequence database. This is followed by computing various Biochemical parameters, prediction of signal peptide and transmembrane helices as well as prediction of post- translational modifications. To visualize the presence of repeats, DotPlot analysis is conducted. To gain additional information from known databases, PredictProtein tool for detecting various features and InterPro tool for functional analysis of protein classified into families is used. Finally, for protein identification using Mass Spectroscopy, PeptideCutter tool is used to search peptide bonds cutting enzymes and/ or chemicals for cleaving sites in a protein sequence to be identified. Back to Concept Map 3.1. Downloading an annotated protein sequence Visit http://www.expasy.org/ and search UniProtKB for “Glycophorin A Human” and click search button. In the result page click on In the ensuing page choose GLPA_HUMAN entry at serial number 2 4 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis and click hyperlink to reach Glycophorin A page. The most important in this page is Display side bar, where one could jump to any of the feature listed. The features include, function, names & taxonomy, subcellular location, post-translational medications & processing, interactions with other proteins, 3-D structures, conserved families and domains, sequence & external links to other sequence databases, publications & literature information. The information for Glycophorin A from human is presented for subcellular location and post-translational modifications/ processing. 5 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis In the Format Tab of main page, select FASTA Canonical Download the FASTA sequence and save as GLPA.FA file using NotePad. The mature peptide is from amino acids 20 to 150, with three domains: one N-terminal extracellular with 16 attached oligosachharide units having nearly 100 sugars, rich in sialic acid, which make the RBC anionic and thus hydrophilic. There is a middle region transmembrane helix and finally C-terminal cytoplasmic domain. The sequence of complete protein is shown next with mature protein highlighted with green background. >sp|P02724|GLPA_HUMAN Glycophorin-A OS=Homo sapiens GN=GYPA PE=1 SV=2 MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAH EVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK SPSDVKPLPSPDTDVPLSSVEIENPETSDQ Back to Concept Map 6 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis 3.2. Protein Parameter Computation ProtParam tool allows the computation of various physical and chemical parameters for a given protein. The computed parameters include molecular weight, theoretical pI, amino acid composition, atomic composition which are self explanatory. In addition, extinction coefficient, estimated half-life, instability index, aliphatic index and grand average of hydropathicity (GRAVY) is also calculated. Visit http://web.expasy.org/protparam/ and paste the 131 amino acids mature protein sequence with green background and click button. The results page is shown next 7 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis Extinction Coefficient indicates how much light a protein absorbs (represented by absorbance, A) at a certain wavelength and is useful during protein purification. Lambert-Beer Law, defined A = log (I0/I) = ecl, where, I0 is the intensity of incident light, I is the intensity of transmitted Light, c is concentration of the absorber protein, l is path length through the solution or thickness of cuvette, e is molar extinction coefficient or molar absorbance coefficient at a particular wavelength for a particular absorber protein. Therefore, Molar Extinction coefficient is defined as e= A / cl. For commonly used cuvette of 1 cm path -1 -1 3 -1 -1 length, Unit of molar absorbance coefficient is M cm (dm mol cm ). It has been shown that e280 for amino acids as chromophore is determined by amino acid sequence (Gill, S. C. and von Hippel, P. H., 1989, Calculation of protein extinction coefficients from amino acid sequence data. Analytical Biochemistry, 182, 319–326. Erratum: Analytical Biochemistry, 1990, 189, 283). For each disulphide bond e280 = 125, for TrP (W) e280 = 5500 and for Tyr (Y) e280 = 1490. For the following protein sequence, KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC We find 2 disulphide bonds, two tryptophan residues and two tyrosine residues. Therefore, e280 = 2 x 125 + 2 x 5500 + 2 x 1490 = 14230 M-1 cm-1 (dm3 mol-1 cm-1) can be calculated for this sequence. ProtParam reported two extinction coefficients for this sequence: 8 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis From experimental knowledge, it is established that all pairs of Cys residues are forming disulphide bonds -1 -1 (cystines), therefore, e280 = 14230 M cm can be used during purification of this protein. For Glycophorin A, we find no Cys, no tryptophan but four tyrosine residues. Therefore, e280 = 4 x 1490 = 5960 M-1 cm-1 (dm3 mol-1 cm-1) can be calculated for this sequence. ProtParam tool also reported the same Sometimes molar absorbance coefficients are large, therefore 1% or 0.1% solution is used for expressing absorbance coefficient. For Glycophorin A, ProtParam tool reported: Half-life is the estimated time to reduce the amount of a protein to one half after its synthesis within a given cell. This is estimated by ProtParam in three physiological, i.e. mammalian reticulocytes, yeast and E. coli. The estimated half-life for Glycophorin A, ProtParam tool reported The instability index provides an estimate of the stability of a protein in a test tube. The estimated instability index for Glycophorin A, ProtParam tool reported 9 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis An instability index smaller than 40 indicates a stable protein and a value above 40 indicates the protein to be unstable. The aliphatic index of a protein indicates the thermostability of globular proteins and is calculatedfrom the relative volume occupied by small aliphatic side chains of alanine, valine, isoleucine, and leucine. For Glycophorin A, ProtParam tool reported GRAVY (Grand Average of Hydropathy) is average hydropathicity of a protein sequence as defined by Kyte J. and Doolittle R.F. (1982) J. Mol. Biol. 157:105-132, shown next For Glycophorin A, ProtParam tool reported Back to Concept Map 3.3. Post-translational modification (PTMs) analysis on proteins Computational prediction of post-translational modifications including phosphorylation, acetylation, methylation etc. is very useful for Biochemical experimental design. There are several online servers available for prediction of post-trnaslational modifications. The partial list can be reached at ExPASy server available at http://www.expasy.org/proteomics/post-translational_modification. 10 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis 11 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis Some others are listed next. 1. at www.phosphosite.org 2. at http://www.phosida.com/ 3. at http://phospho.elm.eu.org/index.html 4. at http://gps.biocuckoo.org/. Back to Concept Map 3.4. Signal peptide and transmembrane helices prediction Phobius is a combined signal peptide and transmembrane topology prediction tool and is available online at http://phobius.sbc.su.se/. 12 Biostatistics and Bioinformatics Biochemistry Protein Sequence Analysis Phobius predicted a signal peptide from 1 to 19 amino acids, followed by extracellular (non-cytoplasmic domain (20-91 amino acids) continuing with a transmembrane domain (92-114 amino acids) to end up inside red blood cell with cytoplasmic domain (115-150 amino acids). The same prediction is presented graphically, next TopPred available at http://mobyle.pasteur.fr/cgi-bin/portal.py?#forms::toppred is also used for prediction of membrane proteins based on hydrophobicity values for a given size of amino
Recommended publications
  • Contributions to Biostatistics: Categorical Data Analysis, Data Modeling and Statistical Inference Mathieu Emily
    Contributions to biostatistics: categorical data analysis, data modeling and statistical inference Mathieu Emily To cite this version: Mathieu Emily. Contributions to biostatistics: categorical data analysis, data modeling and statistical inference. Mathematics [math]. Université de Rennes 1, 2016. tel-01439264 HAL Id: tel-01439264 https://hal.archives-ouvertes.fr/tel-01439264 Submitted on 18 Jan 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. HABILITATION À DIRIGER DES RECHERCHES Université de Rennes 1 Contributions to biostatistics: categorical data analysis, data modeling and statistical inference Mathieu Emily November 15th, 2016 Jury: Christophe Ambroise Professeur, Université d’Evry Val d’Essonne, France Rapporteur Gérard Biau Professeur, Université Pierre et Marie Curie, France Président David Causeur Professeur, Agrocampus Ouest, France Examinateur Heather Cordell Professor, University of Newcastle upon Tyne, United Kingdom Rapporteur Jean-Michel Marin Professeur, Université de Montpellier, France Rapporteur Valérie Monbet Professeur, Université de Rennes 1, France Examinateur Korbinian Strimmer Professor, Imperial College London, United Kingdom Examinateur Jean-Philippe Vert Directeur de recherche, Mines ParisTech, France Examinateur Pour M.H.A.M. Remerciements En tout premier lieu je tiens à adresser mes remerciements à l’ensemble des membres du jury qui m’ont fait l’honneur d’évaluer mes travaux.
    [Show full text]
  • Sequence Analysis Instructions
    Sequence Analysis Instructions In order to predict your drug metabolizing phenotype from your CYP2D6 gene sequence, you must determine: 1) The assembled sequence from your two opposing sequencing reactions 2) If your PCR product even represents the human CYP2D6 gene, 3) The location of your sequence within the CYP2D6 gene, 4) Whether differences between your alleles and CYP2D6*1 sequence represents sequencing errors or polymorphisms in your sequence, and 5) The effect(s) of any polymorphisms on CYP2D6 protein sequence. As you analyze your gene sequence, copy and paste your analyses and results into a text file for your final lab report. If some factor, like the quality of your sequence, prevents you from carrying out the complete analysis, your grade will not be penalized—just complete as many of the steps below as possible, and include an explanation of why you could not complete the analysis in your final report. Font appearing in bold green italics describes questions to answer and items to include in your final report. Part 1: Assembling your CYP2D6 sequence from both directions The sequencing reaction only produces 700-800 bases of good sequence. To get most of the sequence of the 1.2 Kbp PCR product, sequencing reactions were performed from both directions on the PCR product. These need to be assembled into one sequence using the overlap of the two sequences. In order to assure that it is going in the forward direction, it is best to derive the reverse complement sequence from the reverse sequencing file. Take the text file and paste it into a program like http://www.bioinformatics.org/sms/rev_comp.html.
    [Show full text]
  • Agenda: Gene Prediction by Cross-Species Sequence Comparison Leila Taher1, Oliver Rinner2,3, Saurabh Garg1, Alexander Sczyrba4 and Burkhard Morgenstern5,*
    Nucleic Acids Research, 2004, Vol. 32, Web Server issue W305–W308 DOI: 10.1093/nar/gkh386 AGenDA: gene prediction by cross-species sequence comparison Leila Taher1, Oliver Rinner2,3, Saurabh Garg1, Alexander Sczyrba4 and Burkhard Morgenstern5,* 1International Graduate School for Bioinformatics and Genome Research, University of Bielefeld, Postfach 10 01 31, 33501 Bielefeld, Germany, 2GSF Research Center, MIPS/Institute of Bioinformatics, Ingolsta¨dter Landstrasse 1, 85764 Neuherberg, Germany, 3Brain Research Institute, ETH Zuurich,€ Winterthurerstrasse 190, CH-8057 Zuurich,€ Switzerland, 4Faculty of Technology, Research Group in Practical Computer Science, University of Bielefeld, Postfach 10 01 31, 33501 Bielefeld, Germany and 5Institute of Microbiology and Genetics, University of Go¨ttingen, Goldschmidtstrasse 1, 37077 Go¨ttingen, Germany Received March 5, 2004; Revised and Accepted March 24, 2004 ABSTRACT Thus, with the huge amount of data produced by sequencing projects, the development of high-quality gene-prediction Automatic gene prediction is one of the major tools has become a priority in bioinformatics. For eukaryotic challenges in computational sequence analysis. organisms, gene prediction is particularly challenging, since Traditional approaches to gene finding rely on statis- protein-coding exons are usually separated by introns of vari- tical models derived from previously known genes. By able length. Most traditional methods for gene prediction are contrast, a new class of comparative methods relies intrinsic methods; they use hidden Markov models (HMMs) or on comparing genomic sequences from evolutionary other stochastic approaches describing the statistical composi- related organisms to each other. These methods are tion of introns, exons, etc. Such models are trained with already based on the concept of phylogenetic footprinting: known genes from the same or a closely related species; the they exploit the fact that functionally important most popular of these tools is GenScan (1).
    [Show full text]
  • Software List for Biology, Bioinformatics and Biostatistics CCT
    Software List for biology, bioinformatics and biostatistics v CCT - Delta Software Version Application short read assembler and it works on both small and large (mammalian size) ALLPATHS-LG 52488 genomes provides a fast, flexible C++ API & toolkit for reading, writing, and manipulating BAMtools 2.4.0 BAM files a high level of alignment fidelity and is comparable to other mainstream Barracuda 0.7.107b alignment programs allows one to intersect, merge, count, complement, and shuffle genomic bedtools 2.25.0 intervals from multiple files Bfast 0.7.0a universal DNA sequence aligner tool analysis and comprehension of high-throughput genomic data using the R Bioconductor 3.2 statistical programming BioPython 1.66 tools for biological computation written in Python a fast approach to detecting gene-gene interactions in genome-wide case- Boost 1.54.0 control studies short read aligner geared toward quickly aligning large sets of short DNA Bowtie 1.1.2 sequences to large genomes Bowtie2 2.2.6 Bowtie + fully supports gapped alignment with affine gap penalties BWA 0.7.12 mapping low-divergent sequences against a large reference genome ClustalW 2.1 multiple sequence alignment program to align DNA and protein sequences assembles transcripts, estimates their abundances for differential expression Cufflinks 2.2.1 and regulation in RNA-Seq samples EBSEQ (R) 1.10.0 identifying genes and isoforms differentially expressed EMBOSS 6.5.7 a comprehensive set of sequence analysis programs FASTA 36.3.8b a DNA and protein sequence alignment software package FastQC
    [Show full text]
  • A Comparison of Latent Class and Sequence Analysis
    Classifying life course trajectories: a comparison of latent class and sequence analysis Nicola Barban DONDENA \Carlo F. Dondena" Centre for Research on Social Dynamics, Universit`aBocconi, Milan, Italy [email protected] Francesco C. Billari DONDENA \Carlo F. Dondena" Centre for Research on Social Dynamics, Department of Decision Sciences and IGIER Universit`aBocconi, Milan, Italy Draft version. Abstract In this article we compare two techniques that are widely used in the analysis of life course trajectories, i.e. latent class analysis (LCA) and sequence analysis (SA). In particular, we focus on the use of these techniques as devices to obtain classes of individual life course trajectories. We first compare the consistency of the clas- sification obtained via the two techniques using an actual dataset on the life course trajectories of young adults. Then, we adopt a simulation approach to measure the ability of these two methods to correctly classify groups of life course trajecto- ries when specific forms of \random" variability are introduced within pre-specified classes in an artificial datasets. In order to do so, we introduce simulation opera- tors that have a life course and/or observational meaning. Our results contribute on the one hand to outline the usefulness and robustness of findings based on the classification of life course trajectories through LCA and SA, on the other hand to illuminate on the potential pitfalls of actual applications of these techniques. 1 Introduction In recent years, there has been a significantly growing interest in the holistic study of life course trajectories, i.e. in considering whole trajectories as a unit of analysis, both in a social science setting and in epidemiological and medical studies.
    [Show full text]
  • Bioinformatics: a Practical Guide to the Analysis of Genes and Proteins, Second Edition Andreas D
    BIOINFORMATICS A Practical Guide to the Analysis of Genes and Proteins SECOND EDITION Andreas D. Baxevanis Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland USA B. F. Francis Ouellette Centre for Molecular Medicine and Therapeutics Children’s and Women’s Health Centre of British Columbia University of British Columbia Vancouver, British Columbia Canada A JOHN WILEY & SONS, INC., PUBLICATION New York • Chichester • Weinheim • Brisbane • Singapore • Toronto BIOINFORMATICS SECOND EDITION METHODS OF BIOCHEMICAL ANALYSIS Volume 43 BIOINFORMATICS A Practical Guide to the Analysis of Genes and Proteins SECOND EDITION Andreas D. Baxevanis Genome Technology Branch National Human Genome Research Institute National Institutes of Health Bethesda, Maryland USA B. F. Francis Ouellette Centre for Molecular Medicine and Therapeutics Children’s and Women’s Health Centre of British Columbia University of British Columbia Vancouver, British Columbia Canada A JOHN WILEY & SONS, INC., PUBLICATION New York • Chichester • Weinheim • Brisbane • Singapore • Toronto Designations used by companies to distinguish their products are often claimed as trademarks. In all instances where John Wiley & Sons, Inc., is aware of a claim, the product names appear in initial capital or ALL CAPITAL LETTERS. Readers, however, should contact the appropriate companies for more complete information regarding trademarks and registration. Copyright ᭧ 2001 by John Wiley & Sons, Inc. All rights reserved. No part of this publication may be reproduced, stored in a retrieval system or transmitted in any form or by any means, electronic or mechanical, including uploading, downloading, printing, decompiling, recording or otherwise, except as permitted under Sections 107 or 108 of the 1976 United States Copyright Act, without the prior written permission of the Publisher.
    [Show full text]
  • The DNA Sequence and Comparative Analysis of Human Chromosome 20
    articles The DNA sequence and comparative analysis of human chromosome 20 P. Deloukas, L. H. Matthews, J. Ashurst, J. Burton, J. G. R. Gilbert, M. Jones, G. Stavrides, J. P. Almeida, A. K. Babbage, C. L. Bagguley, J. Bailey, K. F. Barlow, K. N. Bates, L. M. Beard, D. M. Beare, O. P. Beasley, C. P. Bird, S. E. Blakey, A. M. Bridgeman, A. J. Brown, D. Buck, W. Burrill, A. P. Butler, C. Carder, N. P. Carter, J. C. Chapman, M. Clamp, G. Clark, L. N. Clark, S. Y. Clark, C. M. Clee, S. Clegg, V. E. Cobley, R. E. Collier, R. Connor, N. R. Corby, A. Coulson, G. J. Coville, R. Deadman, P. Dhami, M. Dunn, A. G. Ellington, J. A. Frankland, A. Fraser, L. French, P. Garner, D. V. Grafham, C. Grif®ths, M. N. D. Grif®ths, R. Gwilliam, R. E. Hall, S. Hammond, J. L. Harley, P. D. Heath, S. Ho, J. L. Holden, P. J. Howden, E. Huckle, A. R. Hunt, S. E. Hunt, K. Jekosch, C. M. Johnson, D. Johnson, M. P. Kay, A. M. Kimberley, A. King, A. Knights, G. K. Laird, S. Lawlor, M. H. Lehvaslaiho, M. Leversha, C. Lloyd, D. M. Lloyd, J. D. Lovell, V. L. Marsh, S. L. Martin, L. J. McConnachie, K. McLay, A. A. McMurray, S. Milne, D. Mistry, M. J. F. Moore, J. C. Mullikin, T. Nickerson, K. Oliver, A. Parker, R. Patel, T. A. V. Pearce, A. I. Peck, B. J. C. T. Phillimore, S. R. Prathalingam, R. W. Plumb, H. Ramsay, C. M.
    [Show full text]
  • LESSON 9 Analyzing DNA Sequences and DNA Barcoding
    LESSON 9 Analyzing DNA Sequences 9 and DNA Barcoding Introduction DNA sequencing is performed by scientists in many different fields of biology. Many bioinformatics programs are used during the process of analyzing DNA Class Time sequences. In this lesson, students learn how to analyze DNA sequence data from 3 class periods minimum (approximately chromatograms using the bioinformatics tools FinchTV and BLAST. Using data 50 minutes each); however, up to generated by students in class or data supplied by the Bio-ITEST project, students 6 class periods may be required. If will learn what DNA chromatogram files look like, learn about the significance of additional time is needed, portions of the the four differently-colored peaks, learn about data quality, and learn how data student assignment may be assigned as from multiple samples are used in combination with quality values to identify and homework. correct errors. Students will use their edited data in BLAST searches at the NCBI and the Barcode of Life Databases (BOLD) to identify and confirm the source of Prior Knowledge Needed their original DNA. Students then use the bioinformatics resources at BOLD to • DNA sequence data is needed to place their data in a phylogenetic tree and see how phylogenetic trees can be answer genetic research questions and used to support sample identification. Learning these techniques will provide evaluate hypotheses (Lesson One). students with the basic tools for inquiry-driven research. • COI is the barcoding gene used for animals (Lesson Two). Learning Objectives Prior Skills Needed • How to perform multiple sequence At the end of this lesson, students will know that: alignments (Lessons Three and Four).
    [Show full text]
  • Progress in Gene Prediction: Principles and Challenges Srabanti Maji and Deepak Garg*
    Send Orders of Reprints at [email protected] Current Bioinformatics, 2013, 8, 000-000 1 Progress in Gene Prediction: Principles and Challenges Srabanti Maji and Deepak Garg* Department of Computer Science and Engineering, Thapar University, Patiala-147004, India Abstract: Bioinformatics is a promising and innovative research field in 21st century. Automatic gene prediction has been an actively researched field of bioinformatics. Despite a high number of techniques specifically dedicated to bioinformatics problems as well as many successful applications, we are in the beginning of a process to massively integrate the aspects and experiences in the different core subjects such as biology, medicine, computer science, engineering, chemistry, physics, and mathematics. Presently, a large number of gene identification tools are based on computational intelligence approaches. Here, we have discussed the existing conventional as well as computational methods to identify gene(s) and various gene predictors are compared. The paper includes some drawbacks of the presently available methods and also, the probable guidelines for future directions are discussed. Keywords: Bioinformatics, gene identification, DNA, content sensor, splice site, dynamic programming, neural networks, SVM. 1. INTRODUCTION identification in eukaryotic organisms, their advantages as well as the limitations [14-16]. A large number of gene In the field of bioinformatics, gene identification from identification tools are available publicly in the Web site large DNA sequence is known to be a significant setback. http://www.nslij-genetics.org/gene/. A new algorithm for The human genome project was completed in April 2003, the gene identification, CONTRAST is also studied and reported exact number of genes encoded by the human genome is still [17].
    [Show full text]
  • Sequence Analysis and Genomics 3. Multiple Sequence Alignments
    Sequence analysis and genomics 3. Multiple Sequence Alignments Dr. Katja Nowick Group leader TFome and Transcriptome Evolution Bioinformatics group Paul-Flechsig-Institute for Brain Research www. nowicklab.info [email protected] What is an alignment? • Arranging sequences in a way to identify regions of similarity • DNA, RNA, protein sequences • Gaps are inserted, so that identical characters are in the same column • The more common letters in the sequences the higher their similarity • The number of non-matches is the edit sequence • Goal: find the longest common subsequence or minimize number of necessary edits • In example: 4 matches, edit distance = 3 (delete J, TR, add N) JAEHTE- JAEHTE AEHREN -AEHREN A simple example ATCTCGAG ATCT-CGAG ATCTCCGAG ATCTCCGAG AGCTCGAG AGCT-CGAG ATCCGAG ATC--CGAG Editing: Introducing of substitutions, insertion, deletions Global vs. Local Alignments • treat the two sequences as potentially • Sequences may or not be related equivalent • Attempts to find similar parts (substring) • attempt to align every residue in every in a sequence sequence • more useful for dissimilar sequences that • most useful when the sequences in the are suspected to contain regions of query set are similar and of roughly equal similarity or similar sequence motifs size within their larger sequence context. • Can still have gaps • e.g. looking for conserved domains or • e.g. for homologous genes finding a sequence in the genome With sufficiently similar sequences, there is no difference between local and global alignments
    [Show full text]
  • Isolation, Purification and Initial RNA Sequence Analysis of Seminal Fluid Exosomes Between Pregnant and Non-Pregnant Intrauterine Insemination Pregnancies
    Isolation, Purification and Initial RNA Sequence Analysis of Seminal Fluid Exosomes between Pregnant and Non-Pregnant Intrauterine Insemination Pregnancies Polley, E.1, Pike, J.F.W.1, Huang, S.3, Zimmerman, S.2, Bruce, T.F.3, Marcus, R.K.3, Roudebush, W.E.1, Chosed, R.J.1 1University of South Carolina School of Medicine Greenville, Greenville, South Carolina 2VIOS Fertility Institute, Swansea, Illinois 3Clemson University, Clemson, South Carolina Objective: To compare the RNA content in exosomes purified from seminal fluid associated with intrauterine insemination (IUI) pregnancies with known pregnancy status. Design: Retrospective analysis of exosome RNA from seminal fluid from patients undergoing IUI and pregnancy outcomes. Materials and methods: Seminal fluid was collected following semen washing for IUI. Exosomes were isolated and purified by hydrophobic interaction chromatography using a polyester, capillary-channeled polymer phase. Exosome purification was verified by TEM. Small RNAs were isolated from purified exosomes and libraries prepared. Following Illumina NextSeq500 library sequencing, sequences were aligned to the human genome, RNA copy numbers determined, and profiled based on type (i.e. miRNA, lincRNA, RefSeq, exons). RNA copy numbers were compared by analysis of variance (ANOVA) and Students’ t-test. Results: Exosomes were successfully purified from seminal fluid samples using hydrophobic interaction chromatography and confirmed with TEM. ANOVA revealed a significant difference (P<0.001) in RNA type within each of the pregnant and non-pregnant IUI groups. All pairwise comparisons (e.g. lincRNA vs. protein coding) were found to be significantly different (P<0.05) except for between miRNA and the other RNA groups (e.g.
    [Show full text]
  • Lecture 8: RNA-Sequence Analysis: Expression, Isoforms
    Lecture 8 Understanding Transcription RNA-seq analysis Foundations of Computational Systems Biology David K. Gifford 1 Lecture 8 – RNA-seq Analysis • RNA-seq principles – How can we characterize mRNA isoform expression using high-throughput sequencing? • Differential expression and PCA – What genes are differentially expressed, and how can we characterize expressed genes? • Single cell RNA-seq – What are the benefits and challenges of working with single cells for RNA-seq? 2 RNA-Seq characterizes RNA molecules export to cytoplasm nucleus A B C High-throughput mRNA sequencing of RNAs A C at various stages of processing splicing A B C pre-mRNA or ncRNA transcription A B C Gene in genome cytoplasm Courtesy of Cole Trapnell. Used with permission. Slide courtesy Cole Trapnel 3 Pervasive tissue-specific regulation of alternative mRNA isoforms. ET Wang et al. Nature 000, 1-7 (2008) doi:10.1038/ nature07509 Courtesy of Macmillan Publishers Limited. Used with permission. Source: Wang, Eric T., Rickard Sandberg, et al. "Alternative Isoform Regulation in 4 Human Tissue Transcriptomes." Nature 456, no. 7221 (2008): 470-6. RNA-Seq: millions of short reads from fragmented mRNA Extract RNA from cells/tissue + splice junctions! Courtesy of Macmillan Publishers Limited. Used with permission. Source: Pepke, Shirley, Barbara Wold, et al. "Computation for ChIP-seq and RNA-seq Studies." Nature Methods 6 (2009): S22-32. Pepke et. al. Nature Methods 2009 5 Mapping RNA-seq reads to a reference genome reveals expression Sox2 6 RNA-seq reads map to exons and across exons Reads over exons Smug1 Junction reads (split between exons) 7 Two major approaches to RNA-seq analysis 1.
    [Show full text]