UBE2V1 (Human) Recombinant ubiquitin-conjugating enzymes but lack the conserved Protein (P01) cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the Catalog Number: H00007335-P01 nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved Regulation Status: For research use only (RUO) in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts Product Description: Human UBE2V1 full-length ORF ( encoding different isoforms have been described for this AAH00468, 1 a.a. - 147 a.a.) recombinant protein with gene. A pseudogene has been identified which is also GST-tag at N-terminal. located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare Sequence: transcript (Kua-UEV), which encodes a fusion protein MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWG comprised of sequence sharing identity with each LEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKY individual gene product. [provided by RefSeq] PEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQ NSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Host: Wheat Germ (in vitro)
Theoretical MW (kDa): 41.91
Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Preparation Method: in vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 7335
Gene Symbol: UBE2V1
Gene Alias: CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A
Gene Summary: Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other
Page 1/1
Powered by TCPDF (www.tcpdf.org)