UBE2V1 (Human) Recombinant -conjugating enzymes but lack the conserved (P01) cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this is located in the Catalog Number: H00007335-P01 nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved Regulation Status: For research use only (RUO) in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts Product Description: Human UBE2V1 full-length ORF ( encoding different isoforms have been described for this AAH00468, 1 a.a. - 147 a.a.) recombinant protein with gene. A pseudogene has been identified which is also GST-tag at N-terminal. located on 20. Co-transcription of this gene and the neighboring upstream gene generates a rare Sequence: transcript (Kua-UEV), which encodes a fusion protein MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWG comprised of sequence sharing identity with each LEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKY individual gene product. [provided by RefSeq] PEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQ NSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 41.91

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 7335

Gene Symbol: UBE2V1

Gene Alias: CIR1, CROC-1, CROC1, UBE2V, UEV-1, UEV1, UEV1A

Gene Summary: Ubiquitin-conjugating E2 enzyme variant constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other

Page 1/1

Powered by TCPDF (www.tcpdf.org)