DOCSLIB.ORG

ARP33381 T100) Data Sheet

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
ARP33381 T100) Data Sheet ZFP36L1 antibody - N-terminal region (ARP33381_T100) Data Sheet Product Number ARP33381_T100 Product Name ZFP36L1 antibody - N-terminal region (ARP33381_T100) Size 100ug Gene Symbol ZFP36L1 Alias Symbols BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B Nucleotide Accession# NM_004926 Protein Size (# AA) 338 amino acids Molecular Weight 36kDa Product Format Lyophilized powder NCBI Gene Id 677 Host Rabbit Clonality Polyclonal Official Gene Full Name Zinc finger protein 36, C3H type-like 1 Gene Family RNF This is a rabbit polyclonal antibody against ZFP36L1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG Target Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178 ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear Description of Target transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Partner Proteins MAPK14, PAFAH1B2, MAPK14, PAFAH1B2 Reconstitution and Add 100 ul of distilled water. Final anti-ZFP36L1 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-ZFP36L1 antibody is Catalog # AAP33381 Immunogen The immunogen for anti-ZFP36L1 antibody: synthetic peptide directed towards the N terminal of human ZFP36L1 Swissprot Id Q07352 Protein Name Zinc finger protein 36, C3H1 type-like 1 Sample Type Confirmation There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat Protein Accession # NP_004917 Purification Protein A purified Species Reactivity Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rat Application WB Predicted Homology Based on Immunogen Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 76% Sequence Human Jurkat WB Suggested Anti-ZFP36L1 Antibody Titration: 1.25 ug/ml Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell Image 1 There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..
Load more

Recommended publications
  • ZFP36L1 and AUF1 Induction Contribute to the Suppression of Inflammatory Mediators Expression by Globular Adiponectin Via Autophagy Induction in Macrophages
    Original Article Biomol Ther 26(5), 446-457 (2018) ZFP36L1 and AUF1 Induction Contribute to the Suppression of Inflammatory Mediators Expression by Globular Adiponectin via Autophagy Induction in Macrophages Aastha Shrestha†, Nirmala Tilija Pun† and Pil-Hoon Park* College of Pharmacy, Yeungnam University, Gyeongsan 38541, Republic of Korea Abstract Adiponectin, a hormone predominantly originated from adipose tissue, has exhibited potent anti-inflammatory properties. Accumu- lating evidence suggests that autophagy induction plays a crucial role in anti-inflammatory responses by adiponectin. However, underlying molecular mechanisms are still largely unknown. Association of Bcl-2 with Beclin-1, an autophagy activating protein, prevents autophagy induction. We have previously shown that adiponectin-induced autophagy activation is mediated through inhibition of interaction between Bcl-2 and Beclin-1. In the present study, we examined the molecular mechanisms by which adi- ponectin modulates association of Bcl-2 and Beclin-1 in macrophages. Herein, we demonstrated that globular adiponectin (gAcrp) induced increase in the expression of AUF1 and ZFP36L1, which act as mRNA destabilizing proteins, both in RAW 264.7 macro- phages and primary peritoneal macrophages. In addition, gene silencing of AUF1 and ZFP36L1 caused restoration of decrease in Bcl-2 expression and Bcl-2 mRNA half-life by gAcrp, indicating crucial roles of AUF1 and ZFP36L1 induction in Bcl-2 mRNA destabilization by gAcrp. Moreover, knock-down of AUF1 and ZFP36L1 enhanced interaction of Bcl-2 with Beclin-1, and subse- quently prevented gAcrp-induced autophagy activation, suggesting that AUF1 and ZFP36L1 induction mediates gAcrp-induced autophagy activation via Bcl-2 mRNA destabilization. Furthermore, suppressive effects of gAcrp on LPS-stimulated inflammatory mediators expression were prevented by gene silencing of AUF1 and ZFP36L1 in macrophages.
    [Show full text]
  • Westminsterresearch ZFP36 Proteins and Mrna Targets in B Cell
    WestminsterResearch http://www.westminster.ac.uk/westminsterresearch ZFP36 proteins and mRNA targets in B cell malignancies Alcaraz, A. This is an electronic version of a PhD thesis awarded by the University of Westminster. © Miss Amor Alcaraz, 2015. The WestminsterResearch online digital archive at the University of Westminster aims to make the research output of the University available to a wider audience. Copyright and Moral Rights remain with the authors and/or copyright owners. Whilst further distribution of specific materials from within this archive is forbidden, you may freely distribute the URL of WestminsterResearch: ((http://westminsterresearch.wmin.ac.uk/). In case of abuse or copyright appearing without permission e-mail [email protected] ZFP36 proteins and mRNA targets in B cell malignancies Maria del Amor Alcaraz-Serrano A Thesis submitted in partial fulfilment of the requirements of the University of Westminster for the degree of Doctor of Philosophy September 2015 Abstract The ZFP36 proteins are a family of post-transcriptional regulator proteins that bind to adenine uridine rich elements (AREs) in 3’ untranslated (3’UTR) regions of mRNAs. The members of the human family, ZFP36L1, ZFP36L2 and ZFP36 are able to degrade mRNAs of important cell regulators that include cytokines, cell signalling proteins and transcriptional factors. This project investigated two proposed targets for the protein family that have important roles in B cell biology, BCL2 and CD38 mRNAs. BCL2 is an anti-apoptotic protein with key roles in cell survival and carcinogenesis; CD38 is a membrane protein differentially expressed in B cells and with a prognostic value in B chronic lymphocytic leukaemia (B-CLL), patients positive for CD38 are considered to have a poor prognosis.
    [Show full text]
  • Cooperative Action of Mir-124 and ISX9 in Instructing Direct Reprogramming of Mouse Astrocytes to Induced-Neurons in Vitro and I
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.01.127126; this version posted June 1, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Cooperative action of miR‐124 and ISX9 in instructing direct 2 reprogramming of mouse astrocytes to induced‐neurons in 3 vitro and in vivo 4 Elsa Papadimitriou1, Paraskevi N. Koutsoudaki1,&, Timokratis Karamitros2,*, Dimitra 5 Karagkouni3,*, Dafni Chroni‐Tzartou4, Maria Margariti1, Christos Gkemisis1, 6 Evangelia Xingi5, Irini Thanou1, Socrates J. Tzartos4, Artemis G. Hatzigeorgiou3, 7 Dimitra Thomaidou1,5,# 8 Affiliations 9 1Neural Stem Cells and Neuro‐imaging Group, Department of Neurobiology, Hellenic 10 Pasteur Institute 11 2Bioinformatics and Applied Genomics Unit, Department of Microbiology, Hellenic 12 Pasteur Institute 13 3DIANA‐Lab, Hellenic Pasteur Institute & Dept. of Computer Science and Biomedical 14 Informatics, Univ. of Thessaly 15 4Laboratory of Molecular Neurobiology and Immunology, Department of 16 Neurobiology, Hellenic Pasteur Institute 17 5Light Microscopy Unit, Hellenic Pasteur Institute 18 *equally contributing authors 19 &Present address: Molecular Carcinogenesis Group, Department of Histology and 20 Embryology, Medical School, National and Kapodistrian University of Athens, Athens, 21 Greece 22 #Corresponding author 23 Email: [email protected] 24 25 bioRxiv preprint doi: https://doi.org/10.1101/2020.06.01.127126; this version posted June 1, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Mtor Activity and Autophagy in Senescent Cells, a Complex Partnership
    International Journal of Molecular Sciences Review mTOR Activity and Autophagy in Senescent Cells, a Complex Partnership Angel Cayo 1, Raúl Segovia 1, Whitney Venturini 1,2, Rodrigo Moore-Carrasco 2, Claudio Valenzuela 1 and Nelson Brown 1,* 1 Center for Medical Research, University of Talca School of Medicine, Talca 346000, Chile; [email protected] (A.C.); [email protected] (R.S.); [email protected] (W.V.); [email protected] (C.V.) 2 Department of Clinical Biochemistry and Immunohematology, Faculty of Health Sciences, University of Talca, Talca 346000, Chile; [email protected] * Correspondence: [email protected] Abstract: Cellular senescence is a form of proliferative arrest triggered in response to a wide variety of stimuli and characterized by unique changes in cell morphology and function. Although unable to divide, senescent cells remain metabolically active and acquire the ability to produce and secrete bioactive molecules, some of which have recognized pro-inflammatory and/or pro-tumorigenic actions. As expected, this “senescence-associated secretory phenotype (SASP)” accounts for most of the non-cell-autonomous effects of senescent cells, which can be beneficial or detrimental for tissue homeostasis, depending on the context. It is now evident that many features linked to cellular senescence, including the SASP, reflect complex changes in the activities of mTOR and other metabolic pathways. Indeed, the available evidence indicates that mTOR-dependent signaling is required for the maintenance or implementation of different aspects of cellular senescence. Thus, depending on the cell type and biological context, inhibiting mTOR in cells undergoing senescence can reverse Citation: Cayo, A.; Segovia, R.; senescence, induce quiescence or cell death, or exacerbate some features of senescent cells while Venturini, W.; Moore-Carrasco, R.; inhibiting others.
    [Show full text]
  • A Post-Transcriptional Mechanism Pacing Expression of Neural Genes with Precursor Cell Differentiation Status
    ARTICLE Received 24 Sep 2014 | Accepted 21 May 2015 | Published 6 Jul 2015 DOI: 10.1038/ncomms8576 OPEN A post-transcriptional mechanism pacing expression of neural genes with precursor cell differentiation status Weijun Dai1, Wencheng Li2, Mainul Hoque2, Zhuyun Li1, Bin Tian2 & Eugene V. Makeyev1,3 Nervous system (NS) development relies on coherent upregulation of extensive sets of genes in a precise spatiotemporal manner. How such transcriptome-wide effects are orchestrated at the molecular level remains an open question. Here we show that 30-untranslated regions (30 UTRs) of multiple neural transcripts contain AU-rich cis-elements (AREs) recognized by tristetraprolin (TTP/Zfp36), an RNA-binding protein previously implicated in regulation of mRNA stability. We further demonstrate that the efficiency of ARE-dependent mRNA degradation declines in the neural lineage because of a decrease in the TTP protein expression mediated by the NS-enriched microRNA miR-9. Importantly, TTP downregulation in this context is essential for proper neuronal differentiation. On the other hand, inactivation of TTP in non-neuronal cells leads to dramatic upregulation of multiple NS-specific genes. We conclude that the newly identified miR-9/TTP circuitry limits unscheduled accumulation of neuronal mRNAs in non-neuronal cells and ensures coordinated upregulation of these transcripts in neurons. 1 School of Biological Sciences, Nanyang Technological University, Singapore 637551, Singapore. 2 Department of Microbiology, Biochemistry, and Molecular Genetics, Rutgers New Jersey Medical School, Newark, New Jersey 07103, USA. 3 MRC Centre for Developmental Neurobiology, King’s College London, London SE1 1UL, UK. Correspondence and requests for materials should be addressed to E.V.M.
    [Show full text]
  • The RNA-Binding Proteins Zfp36l1 and Zfp36l2 Enforce the Thymic Β
    The RNA-Binding Proteins Zfp36l1 and Zfp36l2 Enforce the Thymic β-Selection Checkpoint by Limiting DNA Damage Response Signaling and Cell Cycle This information is current as Progression of September 25, 2021. Katharina U. Vogel, Lewis S. Bell, Alison Galloway, Helena Ahlfors and Martin Turner J Immunol 2016; 197:2673-2685; Prepublished online 26 August 2016; Downloaded from doi: 10.4049/jimmunol.1600854 http://www.jimmunol.org/content/197/7/2673 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2016/08/26/jimmunol.160085 Material 4.DCSupplemental References This article cites 61 articles, 27 of which you can access for free at: http://www.jimmunol.org/content/197/7/2673.full#ref-list-1 Why The JI? Submit online. by guest on September 25, 2021 • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology The RNA-Binding Proteins Zfp36l1 and Zfp36l2 Enforce the Thymic b-Selection Checkpoint by Limiting DNA Damage Response Signaling and Cell Cycle Progression Katharina U.
    [Show full text]
  • Cell Cycle Arrest and Senescence Associated Secretory Phenotype
    fcell-09-645593 March 22, 2021 Time: 13:48 # 1 REVIEW published: 29 March 2021 doi: 10.3389/fcell.2021.645593 Mechanisms of Cellular Senescence: Cell Cycle Arrest and Senescence Associated Secretory Phenotype Ruchi Kumari and Parmjit Jat* MRC Prion Unit at UCL, UCL Institute of Prion Diseases, London, United Kingdom Cellular senescence is a stable cell cycle arrest that can be triggered in normal cells in response to various intrinsic and extrinsic stimuli, as well as developmental signals. Senescence is considered to be a highly dynamic, multi-step process, during which the properties of senescent cells continuously evolve and diversify in a context dependent manner. It is associated with multiple cellular and molecular changes and distinct phenotypic alterations, including a stable proliferation arrest unresponsive to mitogenic stimuli. Senescent cells remain viable, have alterations in metabolic activity and undergo dramatic changes in gene expression and develop a complex senescence- associated secretory phenotype. Cellular senescence can compromise tissue repair Edited by: and regeneration, thereby contributing toward aging. Removal of senescent cells can Elizabeth Lara Ostler, University of Brighton, attenuate age-related tissue dysfunction and extend health span. Senescence can United Kingdom also act as a potent anti-tumor mechanism, by preventing proliferation of potentially Reviewed by: cancerous cells. It is a cellular program which acts as a double-edged sword, with both Joseph William Landry, Virginia Commonwealth University, beneficial and detrimental effects on the health of the organism, and considered to be an United States example of evolutionary antagonistic pleiotropy. Activation of the p53/p21WAF1=CIP1 and Oliver Bischof, p16INK4A/pRB tumor suppressor pathways play a central role in regulating senescence.
    [Show full text]
  • Involvement of XZFP36L1, an RNA-Binding Protein, in Xenopus Neural Development
    Zoological Research 33 (E5−6): E82−E88 doi: 10.3724/SP.J.1141.2012.E05-06E82 Involvement of XZFP36L1, an RNA-binding protein, in Xenopus neural development Yingjie XIA1, 2,#, Shuhua ZHAO3,#, Bingyu MAO1,* 1. State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, the Chinese Academy of Sciences, Kunming 650223, China 2. Graduate University of Chinese Academy of Sciences, Beijing 100049, China 3. Yunnan Key Laboratory of Fertility Regulation and Minority Eugenics, Yunnan Population and Family Planning Research Institute, Kunming 650021, China Abstract: Xenopus ZFP36L1 (zinc finger protein 36, C3H type-like 1) belongs to the ZFP36 family of RNA-binding proteins, which contains two characteristic tandem CCCH-type zinc-finger domains. The ZFP36 proteins can bind AU-rich elements in 3' untranslated regions of target mRNAs and promote their turnover. However, the expression and role of ZFP36 genes during neural development in Xenopus embryos remains largely unknown. The present study showed that Xenopus ZFP36L1 was expressed at the dorsal part of the forebrain, forebrain-midbrain boundary, and midbrain-hindbrain boundary from late neurula stages to tadpole stages of embryonic development. Overexpression of XZFP36L1 in Xenopus embryos inhibited neural induction and differentiation, leading to severe neural tube defects. The function of XZP36L1 requires both its zinc finger and C terminal domains, which also affect its subcellular localization. These results suggest that XZFP36L1 is likely involved in neural development in Xenopus and might play an important role in post-transcriptional regulation. Keywords: ZFP36L1; RNA-binding protein; Neural development; Xenopus; Post-transcriptional regulation mRNA stability is an important mechanism for gene and zebrafish ZFCTH1) contains four ZF domains expression regulation, which is critical for embryogenesis instead of two.
    [Show full text]
  • Epigenomic Profiling of Myelofibrosis Reveals Widespread DNA
    ARTICLE Myeloproliferative Neoplasms Epigenomic profiling of myelofibrosis reveals Ferrata Storti Foundation widespread DNA methylation changes in enhancer elements and ZFP36L1 as a potential tumor suppressor gene that is epigenetically regulated Nicolás Martínez-Calle,1,2# Marien Pascual,1,2# Raquel Ordoñez,1,2# Edurne San Haematologica 2019 José Enériz,1,2 Marta Kulis,3 Estíbaliz Miranda,1,2 Elisabeth Guruceaga,4 Víctor 4 5 6 2,5 Volume 104(8):1572-1579 Segura, María José Larráyoz, Beatriz Bellosillo, María José Calasanz, Carles Besses,7 José Rifón,2,8 José I. Martín-Subero,2,9,10 Xabier Agirre1,2* and Felipe Prosper1,2,8* 1Área de Hemato-Oncología, Centro de Investigación Médica Aplicada, IDISNA, Universidad de Navarra, Pamplona; 2Centro de Investigación Biomédica en Red de Cáncer (CIBERONC), Madrid; 3Fundació Clínic per a la Recerca Biomèdica, Barcelona; 4Unidad de Bioinformática, Centro de Investigación Médica Aplicada, Universidad de Navarra, Pamplona; 5CIMA Laboratory of Diagnostics, Universidad de Navarra, Pamplona; 6Departmento de Patología, Hospital del Mar, Barcelona; 7Departmento de Hematología, Hospital del Mar, Barcelona; 8Departamento de Hematología, Clínica Universidad de Navarra, Universidad de Navarra, Pamplona; 9Institut d’Investigacions Biomèdiques August Pi i Sunyer (IDIBAPS), Barcelona and 10Departament de Fonaments Clinics, Facultat de Medicina, Universitat de Barcelona, Barcelona, Spain. #These authors share first authorship *These authors share senior authorship ABSTRACT n this study we interrogated the DNA methylome of myelofibrosis patients using high-density DNA methylation arrays. We detected Correspondence: I35,215 differentially methylated CpG, corresponding to 10,253 genes, XABIER AGIRRE between myelofibrosis patients and healthy controls. These changes were [email protected] present both in primary and secondary myelofibrosis, which showed no differences between them.
    [Show full text]
  • Figure S1. Targeting of FMR1 Exon 3 Using CRISPR-Cas9 and Verification of Loss of FMRP
    Figure S1. Targeting of FMR1 exon 3 using CRISPR-Cas9 and verification of loss of FMRP. (a) Cas9 nuclease gRNA binding sequences in FMR1 exon 3. (b) Verification of 1 activity of FMR1-targeted CRISPR-Cas9 using the Surveyor assay. (c) Surveyor screening for hESC colonies containing indels in exon 3 of FMR1 using the F1R1 primers. Colonies marked by red asterisks were selected for single cell cloning and further screening. (d) Predicted truncated FMRP peptides in targeted clones. (e) Screening for Cas9 integration in targeted clones by PCR. (+) positive control; (–) negative control. (f) Verification of loss of FMRP by immunoblotting. (g) FMRP peptides detected by MS analysis. Unique peptides in green only detected in control neurons. 2 Figure S2. Characterization of neurons derived from FXS & FMR1KO hESCs. (a) Schematic of neuronal differentiation workflow. (b) Flow cytometry analysis of cellular composition following hPSC neuronal differentiation using cell surface markers of neurons and glia. (c) Immunofluorescence staining of MAP2/TUJ1-positive GABAergic (GABA+) and glutamatergic (TBR1+) neurons differentiated from control, FXS, and FMR1KO1 hESC lines. (d) Quantification of GABAergic and glutamatergic neurons based on anti-GABA and anti- TBR1 immunostaining. 3 Figure S3. Upregulated pathways and validation of select genes from the global transcriptome analysis. (a) Functional annotation (biological processes) of common upregulated genes in FXS and FMR1KO1 neurons. (b) Validation by qRT-PCR of selected downregulated genes identified by RNA-seq. Values shown as mean ± SEM; n = 4 biological replicates per genotype; *p < 0.01, **p < 0.01, and ***p < 0.001 was determined by one-way ANOVA with Tukey’s post-hoc test.
    [Show full text]
  • The Tristetraprolin Family of RNA-Binding Proteins in Cancer: Progress and Future Prospects
    cancers Review The Tristetraprolin Family of RNA-Binding Proteins in Cancer: Progress and Future Prospects Yogesh Saini, Jian Chen and Sonika Patial * Department of Comparative Biomedical Sciences, School of Veterinary Medicine, Louisiana State University, Baton Rouge, LA 70803, USA; [email protected] (Y.S.); [email protected] (J.C.) * Correspondence: [email protected]; Tel.: +1-225-578-9884; Fax: +1-225-578-9895 Received: 19 May 2020; Accepted: 9 June 2020; Published: 11 June 2020 Abstract: Post-transcriptional regulation of gene expression plays a key role in cellular proliferation, differentiation, migration, and apoptosis. Increasing evidence suggests dysregulated post-transcriptional gene expression as an important mechanism in the pathogenesis of cancer. The tristetraprolin family of RNA-binding proteins (RBPs), which include Zinc Finger Protein 36 (ZFP36; commonly referred to as tristetraprolin (TTP)), Zinc Finger Protein 36 like 1 (ZFP36L1), and Zinc Finger Protein 36 like 2 (ZFP36L2), play key roles in the post-transcriptional regulation of gene expression. Mechanistically, these proteins function by binding to the AU-rich elements within the 30-untranslated regions of their target mRNAs and, in turn, increasing mRNA turnover. The TTP family RBPs are emerging as key regulators of multiple biological processes relevant to cancer and are aberrantly expressed in numerous human cancers. The TTP family RBPs have tumor-suppressive properties and are also associated with cancer prognosis, metastasis, and resistance to chemotherapy. Herein, we summarize the various hallmark molecular traits of cancers that are reported to be regulated by the TTP family RBPs. We emphasize the role of the TTP family RBPs in the regulation of trait-associated mRNA targets in relevant cancer types/cell lines.
    [Show full text]
  • RNA-Binding Protein ZFP36L1 Maintains Posttranscriptional Regulation of Bile Acid Metabolism
    The Journal of Clinical Investigation RESEARCH ARTICLE RNA-binding protein ZFP36L1 maintains posttranscriptional regulation of bile acid metabolism Elizabeth J. Tarling,1,2,3 Bethan L. Clifford,1 Joan Cheng,1 Pauline Morand,1 Angela Cheng,1 Ellen Lester,1 Tamer Sallam,1 Martin Turner,4 and Thomas Q. de Aguiar Vallim1,2,3,5 1Department of Medicine, Division of Cardiology, and 2Molecular Biology Institute (MBI), UCLA, Los Angeles, California, USA. 3UCLA Johnson Comprehensive Cancer Center (JCCC), Los Angeles, California, USA. 4Laboratory of Lymphocyte Signalling and Development, The Babraham Institute, Babraham Research Campus, Cambridge, United Kingdom. 5Department of Biological Chemistry, UCLA, Los Angeles, California, USA. Bile acids function not only as detergents that facilitate lipid absorption but also as signaling molecules that activate the nuclear receptor farnesoid X receptor (FXR). FXR agonists are currently being evaluated as therapeutic agents for a number of hepatic diseases due to their lipid-lowering and antiinflammatory properties. FXR is also essential for maintaining bile acid homeostasis and prevents the accumulation of bile acids. Elevated bile acids activate FXR, which in turn switches off bile acid synthesis by reducing the mRNA levels of bile acid synthesis genes, including cholesterol 7α-hydroxylase (Cyp7a1). Here, we show that FXR activation triggers a rapid posttranscriptional mechanism to degrade Cyp7a1 mRNA. We identified the RNA-binding protein Zfp36l1 as an FXR target gene and determined that gain and loss of function of ZFP36L1 reciprocally regulate Cyp7a1 mRNA and bile acid levels in vivo. Moreover, we found that mice lacking hepatic ZFP36L1 were protected from diet-induced obesity and steatosis.
    [Show full text]