ZFP36L1 antibody - N-terminal region (ARP33381_T100) Data Sheet

Product Number ARP33381_T100 Product Name ZFP36L1 antibody - N-terminal region (ARP33381_T100) Size 100ug Symbol ZFP36L1 Alias Symbols BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B Nucleotide Accession# NM_004926 Size (# AA) 338 amino acids Molecular Weight 36kDa Product Format Lyophilized powder NCBI Gene Id 677 Host Rabbit Clonality Polyclonal Official Gene Full Name Zinc finger protein 36, C3H type-like 1 Gene Family RNF This is a rabbit polyclonal antibody against ZFP36L1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG Target Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178 ZFP36L1 is a member of the TIS11 family of early response . Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear Description of Target factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Partner MAPK14, PAFAH1B2, MAPK14, PAFAH1B2 Reconstitution and Add 100 ul of distilled water. Final anti-ZFP36L1 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-ZFP36L1 antibody is Catalog # AAP33381 Immunogen The immunogen for anti-ZFP36L1 antibody: synthetic peptide directed towards the N terminal of human ZFP36L1 Swissprot Id Q07352 Protein Name Zinc finger protein 36, C3H1 type-like 1 Sample Type Confirmation There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat Protein Accession # NP_004917 Purification Protein A purified Species Reactivity Bovine, Dog, Guinea pig, Human, Mouse, Pig, Rat Application WB Predicted Homology Based on Immunogen Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; African clawed frog: 76% Sequence

Human Jurkat

WB Suggested Anti-ZFP36L1 Antibody Titration: 1.25 ug/ml Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell Image 1 There is BioGPS gene expression data showing that ZFP36L1 is expressed in Jurkat

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.