The Diversity of Culturable Yeasts in the Phylloplane of Rice in Thailand

Total Page：16

File Type：pdf, Size：1020Kb

The diversity of culturable yeasts in the phylloplane of rice in Thailand Savitree Limtong & Rungluk Kaewwichian One hundred and fifty-six yeast strains were obtained by the enrichment technique from the phylloplanes of 85 rice leaf samples collected from seven provinces in Thailand. On the basis of the D1/D2 domain of the large subunit rRNA gene sequence analysis, 156 strains were identified as 34 known species in 18 genera consisting of 25 species in 13 genera of the phylum Ascomycota and nine species in five genera of the phylum Basidiomycota. The species in the phylum Ascomycota comprised 24 species in 12 genera of the order Saccharomycetales and one species viz. Yarrowia lipolytica in Saccharomycetales incertae sedis. The 24 species viz. Candida glabrata in the Nakaseomyces clade of Saccharomycetaceae, Candida jaroonii, Candida membrani- faciens and Candida terebra in the Yamadazyma clade of Debaryomycetaceae, Candida pseudolambica in the Pichia clade of Pichiaceae, Candida ruelliae in the Metschnikowia clade of Metschnikowiaceae, and three unaffiliated clade Candida species (Candida catenulata, Candida rugosa and Candida tropicalis); Clavispora lusitaniae, Kodamaea ohmeri, Metschnikowia koreensis and Metschnikowia lopburiensis in Metschnikowiaceae; Cyberlindnera fabianii, Cyberlindnera rhodanensis and Wickerhamomyces ciferrii in Wickerhamomycetaceae; Debaryomyces nepalensis, Meyerozyma caribbica, Meyerozyma guilliermondii, Millerozyma koratensis, and Yamadazyma mexicanum in Debaryomycetaceae; Pichia kudriavzevii in Pichiaceae; and Lachancea thermotolerans in Saccharomycetaceae. The species in Basidiomycota viz. Cryptococcus flavescens, Cryptococcus laurentii, Cryptococcus aff. laurentii and Cryptococcus rajasthanensis in the Tremellales lineage, Bulleromyces clade, Tremellales, Tremellomycetes, Agaricomycotina; Pseudozyma antarctica and Pseudozyma aphidis in Ustilaginales, Ustilaginomycetes, Ustilaginomycotina; Rhodotorula taiwanensis and Sporobolomyces blumeae in Sporidiobolales, Microbotryomycetes, Pucciniomycotina; and Trichosporonasahii in Trichosporonales, Tremellomycetes, Agaricomycotina. The most prevalent species was R. taiwanensis with a 23% frequency of occurrence followed by Candida tropicalis (16%) and Cryptococcus fabianii (12%). _______________________________________ Abstract of an article in Ann. Microbiol. 65: 667-675 (2015). 108 109.

Copy Link

Recommended publications

Expanding the Knowledge on the Skillful Yeast Cyberlindnera Jadinii
Journal of Fungi Review Expanding the Knowledge on the Skillful Yeast Cyberlindnera jadinii Maria Sousa-Silva 1,2 , Daniel Vieira 1,2, Pedro Soares 1,2, Margarida Casal 1,2 and Isabel Soares-Silva 1,2,* 1 Centre of Molecular and Environmental Biology (CBMA), Department of Biology, University of Minho, Campus de Gualtar, 4710-057 Braga, Portugal; [email protected] (M.S.-S.); [email protected] (D.V.); [email protected] (P.S.); [email protected] (M.C.) 2 Institute of Science and Innovation for Bio-Sustainability (IB-S), University of Minho, 4710-057 Braga, Portugal * Correspondence: [email protected]; Tel.: +351-253601519 Abstract: Cyberlindnera jadinii is widely used as a source of single-cell protein and is known for its ability to synthesize a great variety of valuable compounds for the food and pharmaceutical industries. Its capacity to produce compounds such as food additives, supplements, and organic acids, among other ﬁne chemicals, has turned it into an attractive microorganism in the biotechnology ﬁeld. In this review, we performed a robust phylogenetic analysis using the core proteome of C. jadinii and other fungal species, from Asco- to Basidiomycota, to elucidate the evolutionary roots of this species. In addition, we report the evolution of this species nomenclature over-time and the existence of a teleomorph (C. jadinii) and anamorph state (Candida utilis) and summarize the current nomenclature of most common strains. Finally, we highlight relevant traits of its physiology, the solute membrane transporters so far characterized, as well as the molecular tools currently available for its genomic manipulation.
[Show full text]
Supplementary Materials
Supplementary Materials C4Y5P9|C4Y5P9_CLAL4 ------------------MS-EDLTKKTE------ELSLDSEKTVLSSKEEFTAKHPLNS 35 Q9P975|IF4E_CANAL ------------------MS-EELAQKTE------ELSLDS-KTVFDSKEEFNAKHPLNS 34 Q6BXX3|Q6BXX3_DEBHA --MKVF------TNKIAKMS-EELSKQTE------ELSLENKDTVLSNKEEFTAKHPLNN 45 C5DJV3|C5DJV3_LACTC ------------------MSVEEVTQKTG-D-----LNIDEKSTVLSSEKEFQLKHPLNT 36 P07260|IF4E_YEAST ------------------MSVEEVSKKFE-ENVSVDDTTATPKTVLSDSAHFDVKHPLNT 41 I2JS39|I2JS39_DEKBR MQMNLVGRTFPASERTRQSREEKPVE----AEVAKPEEEKKDVTVLENKEEFTVKHPLNS 56 A0A099P1Q5|A0A099P1Q5_PICKU ------------------MSTEELNN----ATKDLSLDEKKDVTALENPAEFNVKHPLNS 38 P78954|IF4E1_SCHPO ------------------MQTEQPPKESQTENTVSEPQEKALRTVFDDKINFNLKHPLAR 42 *. : *.:.. .* **** C4Y5P9|C4Y5P9_CLAL4 KWTLWYTKPQTNKSETWSDLLKPVITFSSVEEFWGIYNSIPVANQLPMKSDYHLFKEGIK 95 Q9P975|IF4E_CANAL RWTLWYTKPQTNKSENWHDLLKPVITFSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIR 94 Q6BXX3|Q6BXX3_DEBHA KWTLWYTKPQVNKSENWHDLLKPVITFSSVEEFWGIYNSIPQANQLPMKSDYHLFKEGIK 105 C5DJV3|C5DJV3_LACTC KWTLWYTKPPVDKSESWSDLLRPVTSFETVEEFWAIHNAIPKPRYLPLKSDYHLFRNDIR 96 P07260|IF4E_YEAST KWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVR 101 I2JS39|I2JS39_DEKBR KWTLWYTKPAVDKNESWADLLKPIVSFDTVEEFWGIYHAVPKAVDLPLKSDYHLFRNDIK 116 A0A099P1Q5|A0A099P1Q5_PICKU TWTLWYTKPAVDNTESWADLLKPVVTFNTVEEFWGIFHAIPKVNELPLKSDYHLFRGDIK 98 P78954|IF4E1_SCHPO PWTLWFLMPPTPG-LEWNELQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVR 101 ****: * . * :* : : :*.:*****.* : : **:**** .*: .:: C4Y5P9|C4Y5P9_CLAL4 PEWEDEQNAKGGRWQYSFNNKRDVAQVINDLWLRGLLAVIGETIEDD---ENEVNGIVLN 152 Q9P975|IF4E_CANAL PEWEDEANSKGGKWQFSFNKKSEVNPIINDLWLRGLLAVIGETIEDE---ENEVNGIVLN
[Show full text]
University of California Santa Cruz Responding to An
UNIVERSITY OF CALIFORNIA SANTA CRUZ RESPONDING TO AN EMERGENT PLANT PEST-PATHOGEN COMPLEX ACROSS SOCIAL-ECOLOGICAL SCALES A dissertation submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in ENVIRONMENTAL STUDIES with an emphasis in ECOLOGY AND EVOLUTIONARY BIOLOGY by Shannon Colleen Lynch December 2020 The Dissertation of Shannon Colleen Lynch is approved: Professor Gregory S. Gilbert, chair Professor Stacy M. Philpott Professor Andrew Szasz Professor Ingrid M. Parker Quentin Williams Acting Vice Provost and Dean of Graduate Studies Copyright © by Shannon Colleen Lynch 2020 TABLE OF CONTENTS List of Tables iv List of Figures vii Abstract x Dedication xiii Acknowledgements xiv Chapter 1 – Introduction 1 References 10 Chapter 2 – Host Evolutionary Relationships Explain 12 Tree Mortality Caused by a Generalist Pest– Pathogen Complex References 38 Chapter 3 – Microbiome Variation Across a 66 Phylogeographic Range of Tree Hosts Affected by an Emergent Pest–Pathogen Complex References 110 Chapter 4 – On Collaborative Governance: Building Consensus on 180 Priorities to Manage Invasive Species Through Collective Action References 243 iii LIST OF TABLES Chapter 2 Table I Insect vectors and corresponding fungal pathogens causing 47 Fusarium dieback on tree hosts in California, Israel, and South Africa. Table II Phylogenetic signal for each host type measured by D statistic. 48 Table SI Native range and infested distribution of tree and shrub FD- 49 ISHB host species. Chapter 3 Table I Study site attributes. 124 Table II Mean and median richness of microbiota in wood samples 128 collected from FD-ISHB host trees. Table III Fungal endophyte-Fusarium in vitro interaction outcomes.
[Show full text]
GRAS Notice for Pichia Kudriavzevii ASCUSDY21 for Use As a Direct Fed Microbial in Dairy Cattle
GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle Prepared for: Division of Animal Feeds, (HFV-220) Center for Veterinary Medicine 7519 Standish Place Rockville, Maryland 20855 Submitted by: ASCUS Biosciences, Inc. 6450 Lusk Blvd Suite 209 San Diego, California 92121 GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle TABLE OF CONTENTS PART 1 – SIGNED STATEMENTS AND CERTIFICATION ................................................................................... 9 1.1 Name and Address of Organization .............................................................................................. 9 1.2 Name of the Notified Substance ................................................................................................... 9 1.3 Intended Conditions of Use .......................................................................................................... 9 1.4 Statutory Basis for the Conclusion of GRAS Status ....................................................................... 9 1.5 Premarket Exception Status .......................................................................................................... 9 1.6 Availability of Information .......................................................................................................... 10 1.7 Freedom of Information Act, 5 U.S.C. 552 .................................................................................. 10 1.8 Certification ................................................................................................................................
[Show full text]
The Species-Specific Acquisition and Diversification of a Novel Family Of
bioRxiv preprint doi: https://doi.org/10.1101/2020.10.05.322909; this version posted October 7, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 The Species-specific Acquisition and Diversification of a Novel 2 Family of Killer Toxins in Budding Yeasts of the Saccharomycotina. 3 4 Lance R. Fredericks1, Mark D. Lee1, Angela M. Crabtree1, Josephine M. Boyer1, Emily A. Kizer1, Nathan T. 5 Taggart1, Samuel S. Hunter2#, Courtney B. Kennedy1, Cody G. Willmore1, Nova M. Tebbe1, Jade S. Harris1, 6 Sarah N. Brocke1, Paul A. Rowley1* 7 8 1Department of Biological Sciences, University of Idaho, Moscow, ID, USA 9 2iBEST Genomics Core, University of Idaho, Moscow, ID 83843, USA 10 #currently at University of California Davis Genome Center, University of California, Davis, 451 Health Sciences Dr., Davis, CA 11 95616 12 *Correspondence: [email protected] 13 14 Abstract 15 Killer toxins are extracellular antifungal proteins that are produced by a wide variety of fungi, 16 including Saccharomyces yeasts. Although many Saccharomyces killer toxins have been 17 previously identified, their evolutionary origins remain uncertain given that many of the se genes 18 have been mobilized by double-stranded RNA (dsRNA) viruses. A survey of yeasts from the 19 Saccharomyces genus has identified a novel killer toxin with a unique spectrum of activity 20 produced by Saccharomyces paradoxus. The expression of this novel killer toxin is associated 21 with the presence of a dsRNA totivirus and a satellite dsRNA.
[Show full text]
Downloaded from NCBI Genbank Or Sequence
Lind and Pollard Microbiome (2021) 9:58 https://doi.org/10.1186/s40168-021-01015-y METHODOLOGY Open Access Accurate and sensitive detection of microbial eukaryotes from whole metagenome shotgun sequencing Abigail L. Lind1 and Katherine S. Pollard1,2,3,4,5* Abstract Background: Microbial eukaryotes are found alongside bacteria and archaea in natural microbial systems, including host-associated microbiomes. While microbial eukaryotes are critical to these communities, they are challenging to study with shotgun sequencing techniques and are therefore often excluded. Results: Here, we present EukDetect, a bioinformatics method to identify eukaryotes in shotgun metagenomic sequencing data. Our approach uses a database of 521,824 universal marker genes from 241 conserved gene families, which we curated from 3713 fungal, protist, non-vertebrate metazoan, and non-streptophyte archaeplastida genomes and transcriptomes. EukDetect has a broad taxonomic coverage of microbial eukaryotes, performs well on low-abundance and closely related species, and is resilient against bacterial contamination in eukaryotic genomes. Using EukDetect, we describe the spatial distribution of eukaryotes along the human gastrointestinal tract, showing that fungi and protists are present in the lumen and mucosa throughout the large intestine. We discover that there is a succession of eukaryotes that colonize the human gut during the first years of life, mirroring patterns of developmental succession observed in gut bacteria. By comparing DNA and RNA sequencing of paired samples from human stool, we find that many eukaryotes continue active transcription after passage through the gut, though some do not, suggesting they are dormant or nonviable. We analyze metagenomic data from the Baltic Sea and find that eukaryotes differ across locations and salinity gradients.
[Show full text]
A Survey of Ballistosporic Phylloplane Yeasts in Baton Rouge, Louisiana
Louisiana State University LSU Digital Commons LSU Master's Theses Graduate School 2012 A survey of ballistosporic phylloplane yeasts in Baton Rouge, Louisiana Sebastian Albu Louisiana State University and Agricultural and Mechanical College, [email protected] Follow this and additional works at: https://digitalcommons.lsu.edu/gradschool_theses Part of the Plant Sciences Commons Recommended Citation Albu, Sebastian, "A survey of ballistosporic phylloplane yeasts in Baton Rouge, Louisiana" (2012). LSU Master's Theses. 3017. https://digitalcommons.lsu.edu/gradschool_theses/3017 This Thesis is brought to you for free and open access by the Graduate School at LSU Digital Commons. It has been accepted for inclusion in LSU Master's Theses by an authorized graduate school editor of LSU Digital Commons. For more information, please contact [email protected]. A SURVEY OF BALLISTOSPORIC PHYLLOPLANE YEASTS IN BATON ROUGE, LOUISIANA A Thesis Submitted to the Graduate Faculty of the Louisiana Sate University and Agricultural and Mechanical College in partial fulfillment of the requirements for the degree of Master of Science in The Department of Plant Pathology by Sebastian Albu B.A., University of Pittsburgh, 2001 B.S., Metropolitan University of Denver, 2005 December 2012 Acknowledgments It would not have been possible to write this thesis without the guidance and support of many people. I would like to thank my major professor Dr. M. Catherine Aime for her incredible generosity and for imparting to me some of her vast knowledge and expertise of mycology and phylogenetics. Her unflagging dedication to the field has been an inspiration and continues to motivate me to do my best work.
[Show full text]
Microbiological Aspect and Laboratory Diagnosis of Fungi of the Genus Brettanomyces
Conferinţa tehnico-ştiinţifică a studenţilor, masteranzilor şi doctoranzilor, 1-3 aprilie 2020, Chișinău, Republica Moldova MICROBIOLOGICAL ASPECT AND LABORATORY DIAGNOSIS OF FUNGI OF THE GENUS BRETTANOMYCES Emilia BEHTA1,2 1Universitatea Tehnică a Moldovei, Școala doctorală Știința Alimentelor, Economie și Management, bd. Ștefan cel Mare, 168, Chișinău, Moldova 2 Universitatea de Stat de Medicină și Farmacie“Nicolae Testemitanu, bd Stefan cel Mare165, Chișinău, Moldova *Autor corespondent: e-mail [email protected] Abstract. Wine spoilage can be caused by different genera and types of wild yeast. One of the most harmful microorganisms is the yeast of the genus Brettanomyces/Dekkera. The timely detection and quantification of these microorganisms is essential to prevent wine spoilage. The detection of yeast in the raw wine materials was carried out by classical microbiological methods. The potential of microbiological for wine monitoring has been studied in order to optimize the analysis process. As a result of studies in raw wines produced in the microvinification section of the FTA's Department of Oenology and Chemistry, the advantages and disadvantages of the “gold standard” of microbiology, the cultural method for Brettanomyces/Dekkera yeast, were evaluated. Key words: Brettanomyces, wine, cultivation, culture media. Introduction The wine industry is traditionally considered the main and strategic sector of the economy of the Republic of Moldova, it is an important source of direct and indirect income for a significant part of the country's population. In the conditions of difficult economic situation in the country, the wineries of the Republic of Moldova are making significant efforts to reorient and diversify their exports.
[Show full text]
Brettanomyces (Dekkera)
Kvasny Prum. 198 62 / 2016 (7–8) Kvasinky non-Saccharomyces a jejich význam v pivovarském průmyslu. I. část – Brettanomyces (Dekkera) DOI: 10.18832/kp2016024 Kvasinky non-Saccharomyces a jejich význam v pivovarském průmyslu. I. část – Brettanomyces (Dekkera) Non-Saccharomyces Yeasts and Their Importance in the Brewing Industry Part I -Brettanomyces (Dekkera) Tatiana KOCHLÁŇOVÁ1, David KIJ1, Jana KOPECKÁ1, Petra KUBIZNIAKOVÁ2, Dagmar MATOULKOVÁ2 1Ústav experimentální biologie, Přírodovědecká fakulta, Masarykova Univerzita / Department of Experimental Biology, Faculty of Science, Masaryk University, Kotlářská 2, 611 37 Brno, e-mail: [email protected], [email protected] 2Mikrobiologické oddělení, Výzkumný ústav pivovarský a sladařský, a.s., / Department of Microbiology, Research Institute of Brewing and Malting, PLC, Lípová 15, 120 44 Prague e-mail: [email protected], [email protected] Recenzovaný článek / Reviewed Paper Kochláňová, T., Kij, D., Kopecká, J., Kubizniaková, P., Matoulková, D., 2016: Kvasinky non-Saccharomyces a jejich význam v pivovarském průmyslu. I. část – Brettanomyces (Dekkera). Kvasny Prum., 62(7–8), s. 198–205 Kvasinky jiných rodů než Saccharomyces se v historii výroby piva vyskytovaly jako součást spontánního kvašení. Nyní jsou považová- ny většinou za kontaminaci produkující nežádoucí senzoricky aktivní látky a CO2. Výjimkou jsou speciální pivní styly (např. lambik a gu- euze), kde je metabolická činnost non-Saccharomyces kvasinek (zejména rodů Brettanomyces a Dekkera) klíčovým prvkem. V článku je uvedena charakteristika a taxonomické zařazení kvasinek Brettanomyces a Dekkera a popsány jsou základní mikrobiologické aspekty výroby piva lambik a gueuze. Kochláňová, T., Kij, D., Kopecká, J., Kubizniaková, P., Matoulková, D., 2016: Non-Saccharomyces yeasts and their importance in the brewing industry. Part I – Brettanomyces (Dekkera).
[Show full text]
Functions, Transmission and Emission of the Canopy Microbiota Tania Fort
Functions, transmission and emission of the canopy microbiota Tania Fort To cite this version: Tania Fort. Functions, transmission and emission of the canopy microbiota. Vegetal Biology. Univer- sité de Bordeaux, 2019. English. NNT : 2019BORD0338. tel-02869590 HAL Id: tel-02869590 https://tel.archives-ouvertes.fr/tel-02869590 Submitted on 16 Jun 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE PRESENTÉE POUR OBTENIR LE GRADE DE DOCTEUR DE L’UNIVERSITE DE BORDEAUX ECOLE DOCTORALE SCIENCES ET ENVIRONNEMENTS ECOLOGIE ÉVOLUTIVE, FONCTIONNELLE, ET DES COMMUNAUTÉS Par Tania Fort Fonctions, transmission et émission du microbiote de la canopée Sous la direction de Corinne Vacher Soutenue le 10 décembre 2019 Membres du jury : Mme. Anne-Marie DELORT Directrice de recherche Institut de Chimie de Clermont-Ferrand Rapporteuse M. Stéphane Uroz Directeur de recherche INRA Nancy Rapporteur Mme. Patricia Luis Maître de conférence Université de Lyon 1 Rapporteuse Mme. Annabel Porté Directrice de recherche INRA Bordeaux Présidente Mme. Corinne Vacher Directrice de recherche INRA Bordeaux Directrice Fonctions, transmission et émission du microbiote de la canopée. Les arbres interagissent avec des communautés microbiennes diversifiées qui influencent leur fitness et le fonctionnement des écosystèmes terrestres.
[Show full text]
A Curated Ortholog Database for Yeasts and Fungi Spanning 600 Million Years of Evolution
bioRxiv preprint doi: https://doi.org/10.1101/237974; this version posted October 8, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. AYbRAH: a curated ortholog database for yeasts and fungi spanning 600 million years of evolution Kevin Correia1, Shi M. Yu1, and Radhakrishnan Mahadevan1,2,* 1Department of Chemical Engineering and Applied Chemistry, University of Toronto, Canada, ON 2Institute of Biomaterials and Biomedical Engineering, University of Toronto, Ontario, Canada Corresponding author: Radhakrishnan Mahadevan∗ Email address: [email protected] ABSTRACT Budding yeasts inhabit a range of environments by exploiting various metabolic traits. The genetic bases for these traits are mostly unknown, preventing their addition or removal in a chassis organism for metabolic engineering. To help understand the molecular evolution of these traits in yeasts, we created Analyzing Yeasts by Reconstructing Ancestry of Homologs (AYbRAH), an open-source database of predicted and manually curated ortholog groups for 33 diverse fungi and yeasts in Dikarya, spanning 600 million years of evolution. OrthoMCL and OrthoDB were used to cluster protein sequence into ortholog and homolog groups, respectively; MAFFT and PhyML were used to reconstruct the phylogeny of all homolog groups. Ortholog assignments for enzymes and small metabolite transporters were compared to their phylogenetic reconstruction, and curated to resolve any discrepancies. Information on homolog and ortholog groups can be viewed in the AYbRAH web portal (https://kcorreia.github. io/aybrah/) to review ortholog groups, predictions for mitochondrial localization and transmembrane domains, literature references, and phylogenetic reconstructions.
[Show full text]
Notes, Outline and Divergence Times of Basidiomycota
Fungal Diversity (2019) 99:105–367 https://doi.org/10.1007/s13225-019-00435-4 (0123456789().,-volV)(0123456789().,- volV) Notes, outline and divergence times of Basidiomycota 1,2,3 1,4 3 5 5 Mao-Qiang He • Rui-Lin Zhao • Kevin D. Hyde • Dominik Begerow • Martin Kemler • 6 7 8,9 10 11 Andrey Yurkov • Eric H. C. McKenzie • Olivier Raspe´ • Makoto Kakishima • Santiago Sa´nchez-Ramı´rez • 12 13 14 15 16 Else C. Vellinga • Roy Halling • Viktor Papp • Ivan V. Zmitrovich • Bart Buyck • 8,9 3 17 18 1 Damien Ertz • Nalin N. Wijayawardene • Bao-Kai Cui • Nathan Schoutteten • Xin-Zhan Liu • 19 1 1,3 1 1 1 Tai-Hui Li • Yi-Jian Yao • Xin-Yu Zhu • An-Qi Liu • Guo-Jie Li • Ming-Zhe Zhang • 1 1 20 21,22 23 Zhi-Lin Ling • Bin Cao • Vladimı´r Antonı´n • Teun Boekhout • Bianca Denise Barbosa da Silva • 18 24 25 26 27 Eske De Crop • Cony Decock • Ba´lint Dima • Arun Kumar Dutta • Jack W. Fell • 28 29 30 31 Jo´ zsef Geml • Masoomeh Ghobad-Nejhad • Admir J. Giachini • Tatiana B. Gibertoni • 32 33,34 17 35 Sergio P. Gorjo´ n • Danny Haelewaters • Shuang-Hui He • Brendan P. Hodkinson • 36 37 38 39 40,41 Egon Horak • Tamotsu Hoshino • Alfredo Justo • Young Woon Lim • Nelson Menolli Jr. • 42 43,44 45 46 47 Armin Mesˇic´ • Jean-Marc Moncalvo • Gregory M. Mueller • La´szlo´ G. Nagy • R. Henrik Nilsson • 48 48 49 2 Machiel Noordeloos • Jorinde Nuytinck • Takamichi Orihara • Cheewangkoon Ratchadawan • 50,51 52 53 Mario Rajchenberg • Alexandre G.
[Show full text]