DOCSLIB.ORG

Phosphatases Page 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Phosphatases Page 1 Phosphatases esiRNA ID Gene Name Gene Description Ensembl ID HU-05948-1 ACP1 acid phosphatase 1, soluble ENSG00000143727 HU-01870-1 ACP2 acid phosphatase 2, lysosomal ENSG00000134575 HU-05292-1 ACP5 acid phosphatase 5, tartrate resistant ENSG00000102575 HU-02655-1 ACP6 acid phosphatase 6, lysophosphatidic ENSG00000162836 HU-13465-1 ACPL2 acid phosphatase-like 2 ENSG00000155893 HU-06716-1 ACPP acid phosphatase, prostate ENSG00000014257 HU-15218-1 ACPT acid phosphatase, testicular ENSG00000142513 HU-09496-1 ACYP1 acylphosphatase 1, erythrocyte (common) type ENSG00000119640 HU-04746-1 ALPL alkaline phosphatase, liver ENSG00000162551 HU-14729-1 ALPP alkaline phosphatase, placental ENSG00000163283 HU-14729-1 ALPP alkaline phosphatase, placental ENSG00000163283 HU-14729-1 ALPPL2 alkaline phosphatase, placental-like 2 ENSG00000163286 HU-07767-1 BPGM 2,3-bisphosphoglycerate mutase ENSG00000172331 HU-06476-1 BPNT1 3'(2'), 5'-bisphosphate nucleotidase 1 ENSG00000162813 HU-09086-1 CANT1 calcium activated nucleotidase 1 ENSG00000171302 HU-03115-1 CCDC155 coiled-coil domain containing 155 ENSG00000161609 HU-09022-1 CDC14A CDC14 cell division cycle 14 homolog A (S. cerevisiae) ENSG00000079335 HU-11533-1 CDC14B CDC14 cell division cycle 14 homolog B (S. cerevisiae) ENSG00000081377 HU-06323-1 CDC25A cell division cycle 25 homolog A (S. pombe) ENSG00000164045 HU-07288-1 CDC25B cell division cycle 25 homolog B (S. pombe) ENSG00000101224 HU-06033-1 CDKN3 cyclin-dependent kinase inhibitor 3 ENSG00000100526 HU-02274-1 CTDSP1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 ENSG00000144579 HU-15411-1 CTDSP2 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 ENSG00000175215 HU-00712-1 CTDSPL CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like ENSG00000144677 HU-14008-1 CTDSPL2 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 ENSG00000137770 HU-08603-1 DOLPP1 dolichyl pyrophosphate phosphatase 1 ENSG00000167130 HU-03690-1 DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 ENSG00000188716 HU-01682-1 DUSP1 dual specificity phosphatase 1 ENSG00000120129 HU-12448-1 DUSP10 dual specificity phosphatase 10 ENSG00000143507 HU-01128-1 DUSP11 dual specificity phosphatase 11 (RNA ENSG00000144048 HU-00896-1 DUSP12 dual specificity phosphatase 12 ENSG00000081721 HU-09305-1 DUSP13 dual specificity phosphatase 13 ENSG00000079393 HU-03795-1 DUSP14 dual specificity phosphatase 14 ENSG00000161326 HU-15807-1 DUSP15 dual specificity phosphatase 15 ENSG00000149599 HU-15736-1 DUSP16 dual specificity phosphatase 16 ENSG00000111266 HU-11512-1 DUSP18 dual specificity phosphatase 18 ENSG00000167065 HU-07797-1 DUSP19 dual specificity phosphatase 19 ENSG00000162999 HU-11869-1 DUSP2 dual specificity phosphatase 2 ENSG00000158050 HU-01654-1 DUSP22 dual specificity phosphatase 22 ENSG00000112679 HU-12951-1 DUSP23 dual specificity phosphatase 23 ENSG00000158716 HU-02093-1 DUSP26 dual specificity phosphatase 26 (putative) ENSG00000133878 HU-14368-1 DUSP3 dual specificity phosphatase 3 ENSG00000108861 HU-05974-1 DUSP4 dual specificity phosphatase 4 ENSG00000120875 HU-01129-1 DUSP5 dual specificity phosphatase 5 ENSG00000138166 HU-08107-1 DUSP6 dual specificity phosphatase 6 ENSG00000139318 HU-01434-1 DUSP7 dual specificity phosphatase 7 ENSG00000164086 HU-11820-1 DUSP8 dual specificity phosphatase 8 ENSG00000184545 HU-12319-1 DUSP9 dual specificity phosphatase 9 ENSG00000130829 HU-11972-1 DUT deoxyuridine triphosphatase ENSG00000128951 HU-06998-1 ENOPH1 enolase-phosphatase 1 ENSG00000145293 HU-14597-1 ENPP1 ectonucleotide pyrophosphatase ENSG00000197594 HU-07332-1 ENPP2 ectonucleotide pyrophosphatase ENSG00000136960 HU-08653-1 ENPP3 ectonucleotide pyrophosphatase ENSG00000154269 HU-01268-1 ENPP4 ectonucleotide pyrophosphatase ENSG00000001561 HU-00761-1 ENPP5 ectonucleotide pyrophosphatase ENSG00000112796 HU-06102-1 ENTPD2 ectonucleoside triphosphate diphosphohydrolase 2 ENSG00000054179 HU-01707-1 ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 ENSG00000168032 HU-06215-1 ENTPD4 ectonucleoside triphosphate diphosphohydrolase 4 ENSG00000197217 HU-14371-1 ENTPD5 ectonucleoside triphosphate diphosphohydrolase 5 ENSG00000187097 HU-15694-1 ENTPD6 ectonucleoside triphosphate diphosphohydrolase 6 (putative) ENSG00000197586 HU-03633-1 ENTPD8 ectonucleoside triphosphate diphosphohydrolase 8 ENSG00000188833 HU-09213-1 EYA1 eyes absent homolog 1 (Drosophila) ENSG00000104313 HU-08696-1 EYA2 eyes absent homolog 2 (Drosophila) ENSG00000064655 HU-13464-1 EYA3 eyes absent homolog 3 (Drosophila) ENSG00000158161 HU-08058-1 EYA4 eyes absent homolog 4 (Drosophila) ENSG00000112319 HU-03202-1 FBP1 fructose-1,6-bisphosphatase 1 ENSG00000165140 HU-02466-1 FBP2 fructose-1,6-bisphosphatase 2 ENSG00000130957 HU-00471-1 G6PC glucose-6-phosphatase, catalytic subunit ENSG00000131482 HU-14995-1 G6PC2 glucose-6-phosphatase, catalytic, 2 ENSG00000152254 HU-02088-1 G6PC3 glucose 6 phosphatase, catalytic, 3 ENSG00000141349 HU-02565-1 ILKAP integrin-linked kinase-associated serine ENSG00000132323 HU-05463-1 IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 ENSG00000133731 HU-04856-1 IMPAD1 inositol monophosphatase domain containing 1 ENSG00000104331 HU-04609-1 INPP1 inositol polyphosphate-1-phosphatase ENSG00000151689 HU-08052-1 INPP4A inositol polyphosphate-4-phosphatase, type I, 107kDa ENSG00000040933 HU-09924-1 INPP4B inositol polyphosphate-4-phosphatase, type II, 105kDa ENSG00000109452 HU-06226-1 INPP5A inositol polyphosphate-5-phosphatase, 40kDa ENSG00000068383 HU-10297-1 INPP5B inositol polyphosphate-5-phosphatase, 75kDa ENSG00000204084 HU-07030-1 INPP5D inositol polyphosphate-5-phosphatase, 145kDa ENSG00000168918 HU-04509-1 INPP5E inositol polyphosphate-5-phosphatase, 72 kDa ENSG00000148384 HU-10126-1 INPP5F inositol polyphosphate-5-phosphatase F ENSG00000198825 HU-05771-1 INPP5J inositol polyphosphate-5-phosphatase J ENSG00000185133 HU-06852-1 INPP5K inositol polyphosphate-5-phosphatase K ENSG00000132376 HU-08105-1 INPPL1 inositol polyphosphate phosphatase-like 1 ENSG00000165458 HU-02266-1 ITPA inosine triphosphatase (nucleoside triphosphate pyrophosphatase) ENSG00000125877 HU-03457-1 KIAA1274 KIAA1274 ENSG00000107719 HU-00383-1 LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase ENSG00000107902 HU-11916-1 LPPR5 Lipid phosphate phosphatase-related protein type 5 ENSG00000117598 HU-22988-1 MDP1 magnesium-dependent phosphatase 1 ENSG00000213920 HU-06479-1 MINPP1 multiple inositol-polyphosphate phosphatase 1 ENSG00000107789 HU-03336-1 MTM1 myotubularin 1 ENSG00000171100 HU-06764-1 MTMR10 myotubularin related protein 10 ENSG00000166912 HU-08831-1 MTMR12 myotubularin related protein 12 ENSG00000150712 HU-06311-1 MTMR2 myotubularin related protein 2 ENSG00000087053 HU-13401-1 MTMR3 myotubularin related protein 3 ENSG00000100330 HU-00939-1 MTMR4 myotubularin related protein 4 ENSG00000108389 Page 1 Phosphatases HU-06963-1 MTMR6 myotubularin related protein 6 ENSG00000139505 HU-04401-1 MTMR7 myotubularin related protein 7 ENSG00000003987 HU-06775-1 MTMR8 myotubularin related protein 8 ENSG00000102043 HU-01586-1 MTMR9 myotubularin related protein 9 ENSG00000104643 HU-01446-1 NANP N-acetylneuraminic acid phosphatase ENSG00000170191 HU-01176-1 NT5C2 5'-nucleotidase, cytosolic II ENSG00000076685 HU-10812-1 NT5C3 5'-nucleotidase, cytosolic III ENSG00000122643 HU-16034-1 NT5DC1 5'-nucleotidase domain containing 1 ENSG00000178425 HU-02347-1 NT5E 5'-nucleotidase, ecto (CD73) ENSG00000135318 HU-14214-1 NT5M 5',3'-nucleotidase, mitochondrial ENSG00000205309 HU-06139-1 OCRL oculocerebrorenal syndrome of Lowe ENSG00000122126 HU-08799-1 PDP1 pyruvate dehyrogenase phosphatase catalytic subunit 1 ENSG00000164951 HU-02803-1 PDP2 pyruvate dehyrogenase phosphatase catalytic subunit 2 ENSG00000172840 HU-08871-1 PDPR pyruvate dehydrogenase phosphatase regulatory subunit ENSG00000090857 HU-22210-1 PDXP pyridoxal (pyridoxine, vitamin B6) phosphatase ENSG00000241360 HU-00521-1 PFKFB1 6-phosphofructo-2-kinase ENSG00000158571 HU-07977-1 PFKFB2 6-phosphofructo-2-kinase ENSG00000123836 HU-02987-1 PFKFB4 6-phosphofructo-2-kinase ENSG00000114268 HU-14779-1 PGAM1 phosphoglycerate mutase 1 (brain) ENSG00000171314 HU-15085-1 PGAM2 phosphoglycerate mutase 2 (muscle) ENSG00000164708 HU-01041-1 PGP phosphoglycolate phosphatase ENSG00000184207 HU-00981-1 PHLPP1 PH domain and leucine rich repeat protein phosphatase 1 ENSG00000081913 HU-08877-1 PHLPP2 PH domain and leucine rich repeat protein phosphatase 2 ENSG00000040199 HU-11058-1 PHOSPHO1 phosphatase, orphan 1 ENSG00000173868 HU-13547-1 PHOSPHO2 phosphatase, orphan 2 ENSG00000144362 HU-13232-1 PNKP polynucleotide kinase 3'-phosphatase ENSG00000039650 HU-10902-1 PPA1 pyrophosphatase (inorganic) 1 ENSG00000180817 HU-05677-1 PPAP2B phosphatidic acid phosphatase type 2B ENSG00000162407 HU-08267-1 PPAP2C phosphatidic acid phosphatase type 2C ENSG00000141934 HU-10303-1 PPAPDC1A phosphatidic acid phosphatase type 2 domain containing 1A ENSG00000203805 HU-07531-1 PPAPDC1B phosphatidic acid phosphatase type 2 domain containing 1B ENSG00000147535 HU-21731-1 PPAPDC2 phosphatidic acid phosphatase type 2 domain containing 2 ENSG00000205808 HU-13821-1 PPAPDC3 phosphatidic acid phosphatase type 2 domain containing 3 ENSG00000160539 HU-08419-1 PPEF1 protein phosphatase, EF-hand calcium binding domain 1 ENSG00000086717 HU-15158-1 PPEF2 protein phosphatase, EF-hand calcium binding domain 2 ENSG00000156194 HU-02330-1 PPFIA2 protein
Load more

Recommended publications
  • CDC25B Mediates Rapamycin-Induced Oncogenic Responses in Cancer Cells
    Published OnlineFirst March 10, 2009; DOI: 10.1158/0008-5472.CAN-08-3222 Research Article CDC25B Mediates Rapamycin-Induced Oncogenic Responses in Cancer Cells Run-qiang Chen,1 Qing-kai Yang,1 Bing-wen Lu,2 Wei Yi,1 Greg Cantin,2 Yan-ling Chen,1 Colleen Fearns,3 John R. Yates III,2 and Jiing-Dwan Lee1 Departments of 1Immunology and Microbial Science, 2Chemical Physiology, and 3Chemistry, The Scripps Research Institute, La Jolla, California Abstract expression of PTEN, increased PI3K activity, and increased expression or activation of AKT in advanced prostate cancer Because the mammalian target of rapamycin (mTOR) pathway (8–10). These aberrations also are indicators of a poor prognosis is commonly deregulated in human cancer, mTOR inhibitors, for prostate cancer patients (11, 12). More importantly, long-term rapamycin and its derivatives, are being actively tested in androgen deprivation treatment for prostate cancer patients that cancer clinical trials. Clinical updates indicate that the reinforces the PI3K/AKT pathway also up-regulates mTOR anticancer effect of these drugs is limited, perhaps due to activation in prostate tumor (9, 10). These abovementioned rapamycin-dependent induction of oncogenic cascades by an experimental and clinical data lead to the supposition that mTOR as yet unclear mechanism. As such, we investigated rapamy- inhibitors (rapamycin and its derivatives) should be effective in cin-dependent phosphoproteomics and discovered that 250 treating human cancer. Unfortunately, recent clinical data indicates phosphosites in 161 cellular proteins were sensitive to that rapamycin shows therapeutic potential in only few types of rapamycin. Among these, rapamycin regulated four kinases human cancer: endometrial carcinoma, renal cell carcinoma, and and four phosphatases.
    [Show full text]
  • Deciphering the Functions of Ets2, Pten and P53 in Stromal Fibroblasts in Multiple
    Deciphering the Functions of Ets2, Pten and p53 in Stromal Fibroblasts in Multiple Breast Cancer Models DISSERTATION Presented in Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy in the Graduate School of The Ohio State University By Julie Wallace Graduate Program in Molecular, Cellular and Developmental Biology The Ohio State University 2013 Dissertation Committee: Michael C. Ostrowski, PhD, Advisor Gustavo Leone, PhD Denis Guttridge, PhD Dawn Chandler, PhD Copyright by Julie Wallace 2013 Abstract Breast cancer is the second most common cancer in American women, and is also the second leading cause of cancer death in women. It is estimated that nearly a quarter of a million new cases of invasive breast cancer will be diagnosed in women in the United States this year, and approximately 40,000 of these women will die from breast cancer. Although death rates have been on the decline for the past decade, there is still much we need to learn about this disease to improve prevention, detection and treatment strategies. The majority of early studies have focused on the malignant tumor cells themselves, and much has been learned concerning mutations, amplifications and other genetic and epigenetic alterations of these cells. However more recent work has acknowledged the strong influence of tumor stroma on the initiation, progression and recurrence of cancer. Under normal conditions this stroma has been shown to have protective effects against tumorigenesis, however the transformation of tumor cells manipulates this surrounding environment to actually promote malignancy. Fibroblasts in particular make up a significant portion of this stroma, and have been shown to impact various aspects of tumor cell biology.
    [Show full text]
  • Structural Characterization of Polysaccharides from Cordyceps Militaris and Their Hypolipidemic Effects Cite This: RSC Adv.,2018,8,41012 in High Fat Diet Fed Mice†
    RSC Advances View Article Online PAPER View Journal | View Issue Structural characterization of polysaccharides from Cordyceps militaris and their hypolipidemic effects Cite this: RSC Adv.,2018,8,41012 in high fat diet fed mice† Zhen-feng Huang, ‡ Ming-long Zhang,‡ Song Zhang,* Ya-hui Wang and Xue-wen Jiang Cordyceps militaris is a crude dietary therapeutic mushroom with high nutritional and medicinal values. Mushroom-derived polysaccharides have been found to possess antihyperglycemic and antihyperlipidemic activities. This study aimed to partially clarify the structural characterization and comparatively evaluate hypolipidemic potentials of intracellular- (IPCM) and extracellular polysaccharides of C. militaris (EPCM) in high fat diet fed mice. Results indicated that IPCM-2 is a-pyran polysaccharide with an average molecular weight of 32.5 kDa, was mainly composed of mannose, glucose and galactose with mass percentages of 51.94%, 10.54%, and 37.25%, respectively. EPCM-2 is an a-pyran Creative Commons Attribution 3.0 Unported Licence. polysaccharide with an average molecular weight of 20 kDa that is mainly composed of mannose, glucose and galactose with mass percentages of 44.51%, 18.33%, and 35.38%, respectively. In in vivo study, EPCM-1 treatment (100 mg kgÀ1 dÀ1) showed potential effects on improving serum lipid profiles of hyperlipidemic mice, reflected by decreasing serum total cholesterol (TC), triglyceride (TG) and low density lipoprotein-cholesterol (LDL-C) levels by 20.05%, 45.45% and 52.63%, respectively, while IPCM-1 treatment
    [Show full text]
  • Table S1 the Four Gene Sets Derived from Gene Expression Profiles of Escs and Differentiated Cells
    Table S1 The four gene sets derived from gene expression profiles of ESCs and differentiated cells Uniform High Uniform Low ES Up ES Down EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol 269261 Rpl12 11354 Abpa 68239 Krt42 15132 Hbb-bh1 67891 Rpl4 11537 Cfd 26380 Esrrb 15126 Hba-x 55949 Eef1b2 11698 Ambn 73703 Dppa2 15111 Hand2 18148 Npm1 11730 Ang3 67374 Jam2 65255 Asb4 67427 Rps20 11731 Ang2 22702 Zfp42 17292 Mesp1 15481 Hspa8 11807 Apoa2 58865 Tdh 19737 Rgs5 100041686 LOC100041686 11814 Apoc3 26388 Ifi202b 225518 Prdm6 11983 Atpif1 11945 Atp4b 11614 Nr0b1 20378 Frzb 19241 Tmsb4x 12007 Azgp1 76815 Calcoco2 12767 Cxcr4 20116 Rps8 12044 Bcl2a1a 219132 D14Ertd668e 103889 Hoxb2 20103 Rps5 12047 Bcl2a1d 381411 Gm1967 17701 Msx1 14694 Gnb2l1 12049 Bcl2l10 20899 Stra8 23796 Aplnr 19941 Rpl26 12096 Bglap1 78625 1700061G19Rik 12627 Cfc1 12070 Ngfrap1 12097 Bglap2 21816 Tgm1 12622 Cer1 19989 Rpl7 12267 C3ar1 67405 Nts 21385 Tbx2 19896 Rpl10a 12279 C9 435337 EG435337 56720 Tdo2 20044 Rps14 12391 Cav3 545913 Zscan4d 16869 Lhx1 19175 Psmb6 12409 Cbr2 244448 Triml1 22253 Unc5c 22627 Ywhae 12477 Ctla4 69134 2200001I15Rik 14174 Fgf3 19951 Rpl32 12523 Cd84 66065 Hsd17b14 16542 Kdr 66152 1110020P15Rik 12524 Cd86 81879 Tcfcp2l1 15122 Hba-a1 66489 Rpl35 12640 Cga 17907 Mylpf 15414 Hoxb6 15519 Hsp90aa1 12642 Ch25h 26424 Nr5a2 210530 Leprel1 66483 Rpl36al 12655 Chi3l3 83560 Tex14 12338 Capn6 27370 Rps26 12796 Camp 17450 Morc1 20671 Sox17 66576 Uqcrh 12869 Cox8b 79455 Pdcl2 20613 Snai1 22154 Tubb5 12959 Cryba4 231821 Centa1 17897
    [Show full text]
  • Analysis of the Stability of 70 Housekeeping Genes During Ips Reprogramming Yulia Panina1,2*, Arno Germond1 & Tomonobu M
    www.nature.com/scientificreports OPEN Analysis of the stability of 70 housekeeping genes during iPS reprogramming Yulia Panina1,2*, Arno Germond1 & Tomonobu M. Watanabe1 Studies on induced pluripotent stem (iPS) cells highly rely on the investigation of their gene expression which requires normalization by housekeeping genes. Whether the housekeeping genes are stable during the iPS reprogramming, a transition of cell state known to be associated with profound changes, has been overlooked. In this study we analyzed the expression patterns of the most comprehensive list to date of housekeeping genes during iPS reprogramming of a mouse neural stem cell line N31. Our results show that housekeeping genes’ expression fuctuates signifcantly during the iPS reprogramming. Clustering analysis shows that ribosomal genes’ expression is rising, while the expression of cell-specifc genes, such as vimentin (Vim) or elastin (Eln), is decreasing. To ensure the robustness of the obtained data, we performed a correlative analysis of the genes. Overall, all 70 genes analyzed changed the expression more than two-fold during the reprogramming. The scale of this analysis, that takes into account 70 previously known and newly suggested genes, allowed us to choose the most stable of all genes. We highlight the fact of fuctuation of housekeeping genes during iPS reprogramming, and propose that, to ensure robustness of qPCR experiments in iPS cells, housekeeping genes should be used together in combination, and with a prior testing in a specifc line used in each study. We suggest that the longest splice variants of Rpl13a, Rplp1 and Rps18 can be used as a starting point for such initial testing as the most stable candidates.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • TNAP As a New Player in Chronic Inflammatory Conditions And
    International Journal of Molecular Sciences Review TNAP as a New Player in Chronic Inflammatory Conditions and Metabolism Stephanie Graser 1,*, Daniel Liedtke 2,† and Franz Jakob 1,† 1 Bernhard-Heine-Center for Locomotion Research, Department of Orthopedics, Julius-Maximilians-University Würzburg, 97076 Würzburg, Germany; [email protected] 2 Institute for Human Genetics, Biocenter, Julius-Maximilians-University Würzburg, 97074 Würzburg, Germany; [email protected] * Correspondence: [email protected] † These authors contributed equally to this work. Abstract: This review summarizes important information on the ectoenzyme tissue-nonspecific alkaline phosphatase (TNAP) and gives a brief insight into the symptoms, diagnostics, and treatment of the rare disease Hypophosphatasia (HPP), which is resulting from mutations in the TNAP encoding ALPL gene. We emphasize the role of TNAP beyond its well-known contribution to mineralization processes. Therefore, above all, the impact of the enzyme on central molecular processes in the nervous system and on inflammation is presented here. Keywords: TNAP; Hypophosphatasia; HPP; mineralization; nervous system; inflammation 1. Structure, Function, and Substrates of TNAP Tissue-nonspecific alkaline phosphatase (TNAP) or liver/bone/kidney alkaline phos- phatase is an ectoenzyme that is anchored to the outer cell membrane (e.g. in osteoblasts) Citation: Graser, S.; Liedtke, D.; and to extracellular vesicles via its glycosyl-inositol-phosphate (GPI)-anchor [1,2]. TNAP Jakob, F. TNAP as a New Player in belongs to the family of alkaline phosphatases (AP) that comprises in humans three addi- Chronic Inflammatory Conditions tional tissue-specific isoforms: placental (PLAP, ALPP National Center for Biotechnology and Metabolism. Int.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-DUSP15
    Anti-DUSP15 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-DUSP15 Product Number HPA076649 Gene Description dual specificity phosphatase 15 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSST PGNPDGITHLQCSCLHPKRA Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:200 - 1:500 - Retrieval method: HIER pH6 ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA076649 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • 9. Atypical Dusps: 19 Phosphatases in Search of a Role
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Digital.CSIC Transworld Research Network 37/661 (2), Fort P.O. Trivandrum-695 023 Kerala, India Emerging Signaling Pathways in Tumor Biology, 2010: 185-208 ISBN: 978-81-7895-477-6 Editor: Pedro A. Lazo 9. Atypical DUSPs: 19 phosphatases in search of a role Yolanda Bayón and Andrés Alonso Instituto de Biología y Genética Molecular, CSIC-Universidad de Valladolid c/ Sanz y Forés s/n, 47003 Valladolid, Spain Abstract. Atypical Dual Specificity Phosphatases (A-DUSPs) are a group of 19 phosphatases poorly characterized. They are included among the Class I Cys-based PTPs and contain the active site motif HCXXGXXR conserved in the Class I PTPs. These enzymes present a phosphatase domain similar to MKPs, but lack any substrate targeting domain similar to the CH2 present in this group. Although most of these phosphatases have no more than 250 amino acids, their size ranges from the 150 residues of the smallest A-DUSP, VHZ/DUSP23, to the 1158 residues of the putative PTP DUSP27. The substrates of this family include MAPK, but, in general terms, it does not look that MAPK are the general substrates for the whole group. In fact, other substrates have been described for some of these phosphatases, like the 5’CAP structure of mRNA, glycogen, or STATs and still the substrates of many A-DUSPs have not been identified. In addition to the PTP domain, most of these enzymes present no additional recognizable domains in their sequence, with the exception of CBM-20 in laforin, GTase in HCE1 and a Zn binding domain in DUSP12.
    [Show full text]
  • Review Article PTEN Gene: a Model for Genetic Diseases in Dermatology
    The Scientific World Journal Volume 2012, Article ID 252457, 8 pages The cientificWorldJOURNAL doi:10.1100/2012/252457 Review Article PTEN Gene: A Model for Genetic Diseases in Dermatology Corrado Romano1 and Carmelo Schepis2 1 Unit of Pediatrics and Medical Genetics, I.R.C.C.S. Associazione Oasi Maria Santissima, 94018 Troina, Italy 2 Unit of Dermatology, I.R.C.C.S. Associazione Oasi Maria Santissima, 94018 Troina, Italy Correspondence should be addressed to Carmelo Schepis, [email protected] Received 19 October 2011; Accepted 4 January 2012 Academic Editors: G. Vecchio and H. Zitzelsberger Copyright © 2012 C. Romano and C. Schepis. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. PTEN gene is considered one of the most mutated tumor suppressor genes in human cancer, and it’s likely to become the first one in the near future. Since 1997, its involvement in tumor suppression has smoothly increased, up to the current importance. Germline mutations of PTEN cause the PTEN hamartoma tumor syndrome (PHTS), which include the past-called Cowden, Bannayan- Riley-Ruvalcaba, Proteus, Proteus-like, and Lhermitte-Duclos syndromes. Somatic mutations of PTEN have been observed in glioblastoma, prostate cancer, and brest cancer cell lines, quoting only the first tissues where the involvement has been proven. The negative regulation of cell interactions with the extracellular matrix could be the way PTEN phosphatase acts as a tumor suppressor. PTEN gene plays an essential role in human development. A recent model sees PTEN function as a stepwise gradation, which can be impaired not only by heterozygous mutations and homozygous losses, but also by other molecular mechanisms, such as transcriptional regression, epigenetic silencing, regulation by microRNAs, posttranslational modification, and aberrant localization.
    [Show full text]
  • DUSP10 Regulates Intestinal Epithelial Cell Growth and Colorectal Tumorigenesis
    Oncogene (2016) 35, 206–217 © 2016 Macmillan Publishers Limited All rights reserved 0950-9232/16 www.nature.com/onc ORIGINAL ARTICLE DUSP10 regulates intestinal epithelial cell growth and colorectal tumorigenesis CW Png1,2, M Weerasooriya1,2, J Guo3, SJ James1,2,HMPoh1,2, M Osato3, RA Flavell4, C Dong5, H Yang3 and Y Zhang1,2 Dual specificity phosphatase 10 (DUSP10), also known as MAP kinase phosphatase 5 (MKP5), negatively regulates the activation of MAP kinases. Genetic polymorphisms and aberrant expression of this gene are associated with colorectal cancer (CRC) in humans. However, the role of DUSP10 in intestinal epithelial tumorigenesis is not clear. Here, we showed that DUSP10 knockout (KO) mice had increased intestinal epithelial cell (IEC) proliferation and migration and developed less severe colitis than wild-type (WT) mice in response to dextran sodium sulphate (DSS) treatment, which is associated with increased ERK1/2 activation and Krüppel-like factor 5 (KLF5) expression in IEC. In line with increased IEC proliferation, DUSP10 KO mice developed more colon tumours with increased severity compared with WT mice in response to administration of DSS and azoxymethane (AOM). Furthermore, survival analysis of CRC patients demonstrated that high DUSP10 expression in tumours was associated with significant improvement in survival probability. Overexpression of DUSP10 in Caco-2 and RCM-1 cells inhibited cell proliferation. Our study showed that DUSP10 negatively regulates IEC growth and acts as a suppressor for CRC. Therefore, it could be targeted for the development of therapies for colitis and CRC. Oncogene (2016) 35, 206–217; doi:10.1038/onc.2015.74; published online 16 March 2015 INTRODUCTION development.
    [Show full text]
  • Bioinformatics-Based Screening of Key Genes for Transformation of Liver
    Jiang et al. J Transl Med (2020) 18:40 https://doi.org/10.1186/s12967-020-02229-8 Journal of Translational Medicine RESEARCH Open Access Bioinformatics-based screening of key genes for transformation of liver cirrhosis to hepatocellular carcinoma Chen Hao Jiang1,2, Xin Yuan1,2, Jiang Fen Li1,2, Yu Fang Xie1,2, An Zhi Zhang1,2, Xue Li Wang1,2, Lan Yang1,2, Chun Xia Liu1,2, Wei Hua Liang1,2, Li Juan Pang1,2, Hong Zou1,2, Xiao Bin Cui1,2, Xi Hua Shen1,2, Yan Qi1,2, Jin Fang Jiang1,2, Wen Yi Gu4, Feng Li1,2,3 and Jian Ming Hu1,2* Abstract Background: Hepatocellular carcinoma (HCC) is the most common type of liver tumour, and is closely related to liver cirrhosis. Previous studies have focussed on the pathogenesis of liver cirrhosis developing into HCC, but the molecular mechanism remains unclear. The aims of the present study were to identify key genes related to the transformation of cirrhosis into HCC, and explore the associated molecular mechanisms. Methods: GSE89377, GSE17548, GSE63898 and GSE54236 mRNA microarray datasets from Gene Expression Omni- bus (GEO) were analysed to obtain diferentially expressed genes (DEGs) between HCC and liver cirrhosis tissues, and network analysis of protein–protein interactions (PPIs) was carried out. String and Cytoscape were used to analyse modules and identify hub genes, Kaplan–Meier Plotter and Oncomine databases were used to explore relationships between hub genes and disease occurrence, development and prognosis of HCC, and the molecular mechanism of the main hub gene was probed using Kyoto Encyclopedia of Genes and Genomes(KEGG) pathway analysis.
    [Show full text]