DOCSLIB.ORG

Recombinant Human Cytoplasmic Protein NCK1 (N-6His)(Discontinued)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Recombinant Human Cytoplasmic Protein NCK1 (N-6His)(Discontinued) 9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-8165: Recombinant Human Cytoplasmic Protein NCK1 (N-6His)(Discontinued) Gene : NCK1 Gene ID : 4690 Uniprot ID : P16333 Description Source: E. coli. MW :45kD. Recombinant Human NCK1 is produced by our E.coli expression system and the target gene encoding Met1-Ser377 is expressed with a 6His tag at the N-terminus. Cytoplasmic Protein NCK1 (NCK1) is a cytoplasmic protein that contains one SH2 domain and three SH3 domains. NCK1 is a member of the adapter family, which associates with tyrosine-phosphorylated growth factor receptors, such as KDR and PDGFRB, or their cellular substrates. NCK1 maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. NCK1 plays a role in the DNA damage response, but not in the detection of the damage by ATM/ATR. It is also involved in transducing signals from receptor tyrosine kinases to downstream signal recipients, such as ELK1-dependent transcriptional activation in response to activated Ras signaling. Product Info Amount : 10 µg / 50 µg Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 50mM NaCl, pH 8.0. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Storage condition : Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. Amino Acid : MGSSHHHHHHSSGLVPRGSHMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRN SMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNM PAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVG SLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGM VGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHE GDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGE KLYLVKHLS Application Note Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. For Research Use Only. Not for use in diagnostic/therapeutics procedures..
Load more

Recommended publications
  • The Proximal Signaling Network of the BCR-ABL1 Oncogene Shows a Modular Organization
    Oncogene (2010) 29, 5895–5910 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 www.nature.com/onc ORIGINAL ARTICLE The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization B Titz, T Low, E Komisopoulou, SS Chen, L Rubbi and TG Graeber Crump Institute for Molecular Imaging, Institute for Molecular Medicine, Jonsson Comprehensive Cancer Center, California NanoSystems Institute, Department of Molecular and Medical Pharmacology, University of California, Los Angeles, CA, USA BCR-ABL1 is a fusion tyrosine kinase, which causes signaling effects of BCR-ABL1 toward leukemic multiple types of leukemia. We used an integrated transformation. proteomic approach that includes label-free quantitative Oncogene (2010) 29, 5895–5910; doi:10.1038/onc.2010.331; protein complex and phosphorylation profiling by mass published online 9 August 2010 spectrometry to systematically characterize the proximal signaling network of this oncogenic kinase. The proximal Keywords: adaptor protein; BCR-ABL1; phospho- BCR-ABL1 signaling network shows a modular and complex; quantitative mass spectrometry; signaling layered organization with an inner core of three leukemia network; systems biology transformation-relevant adaptor protein complexes (Grb2/Gab2/Shc1 complex, CrkI complex and Dok1/ Dok2 complex). We introduced an ‘interaction direction- ality’ analysis, which annotates static protein networks Introduction with information on the directionality of phosphorylation- dependent interactions. In this analysis, the observed BCR-ABL1 is a constitutively active oncogenic fusion network structure was consistent with a step-wise kinase that arises through a chromosomal translocation phosphorylation-dependent assembly of the Grb2/Gab2/ and causes multiple types of leukemia. It is found in Shc1 and the Dok1/Dok2 complexes on the BCR-ABL1 many cases (B25%) of adult acute lymphoblastic core.
    [Show full text]
  • Mutation-Specific and Common Phosphotyrosine Signatures of KRAS G12D and G13D Alleles Anticipated Graduation August 1St, 2018
    MUTATION-SPECIFIC AND COMMON PHOSPHOTYROSINE SIGNATURES OF KRAS G12D AND G13D ALLELES by Raiha Tahir A dissertation submitted to The Johns Hopkins University in conformity with the requirement of the degree of Doctor of Philosophy Baltimore, MD August 2018 © 2018 Raiha Tahir All Rights Reserved ABSTRACT KRAS is one of the most frequently mutated genes across all cancer subtypes. Two of the most frequent oncogenic KRAS mutations observed in patients result in glycine to aspartic acid substitution at either codon 12 (G12D) or 13 (G13D). Although the biochemical differences between these two predominant mutations are not fully understood, distinct clinical features of the resulting tumors suggest involvement of disparate signaling mechanisms. When we compared the global phosphotyrosine proteomic profiles of isogenic colorectal cancer cell lines bearing either G12D or G13D KRAS mutations, we observed both shared as well as unique signaling events induced by the two KRAS mutations. Remarkably, while the G12D mutation led to an increase in membrane proximal and adherens junction signaling, the G13D mutation led to activation of signaling molecules such as non-receptor tyrosine kinases, MAPK kinases and regulators of metabolic processes. The importance of one of the cell surface molecules, MPZL1, which found to be hyperphosphorylated in G12D cells, was confirmed by cellular assays as its knockdown led to a decrease in proliferation of G12D but not G13D expressing cells. Overall, our study reveals important signaling differences across two common KRAS mutations and highlights the utility of our approach to systematically dissect the subtle differences between related oncogenic mutants and potentially lead to individualized treatments.
    [Show full text]
  • Defining Functional Interactions During Biogenesis of Epithelial Junctions
    ARTICLE Received 11 Dec 2015 | Accepted 13 Oct 2016 | Published 6 Dec 2016 | Updated 5 Jan 2017 DOI: 10.1038/ncomms13542 OPEN Defining functional interactions during biogenesis of epithelial junctions J.C. Erasmus1,*, S. Bruche1,*,w, L. Pizarro1,2,*, N. Maimari1,3,*, T. Poggioli1,w, C. Tomlinson4,J.Lees5, I. Zalivina1,w, A. Wheeler1,w, A. Alberts6, A. Russo2 & V.M.M. Braga1 In spite of extensive recent progress, a comprehensive understanding of how actin cytoskeleton remodelling supports stable junctions remains to be established. Here we design a platform that integrates actin functions with optimized phenotypic clustering and identify new cytoskeletal proteins, their functional hierarchy and pathways that modulate E-cadherin adhesion. Depletion of EEF1A, an actin bundling protein, increases E-cadherin levels at junctions without a corresponding reinforcement of cell–cell contacts. This unexpected result reflects a more dynamic and mobile junctional actin in EEF1A-depleted cells. A partner for EEF1A in cadherin contact maintenance is the formin DIAPH2, which interacts with EEF1A. In contrast, depletion of either the endocytic regulator TRIP10 or the Rho GTPase activator VAV2 reduces E-cadherin levels at junctions. TRIP10 binds to and requires VAV2 function for its junctional localization. Overall, we present new conceptual insights on junction stabilization, which integrate known and novel pathways with impact for epithelial morphogenesis, homeostasis and diseases. 1 National Heart and Lung Institute, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK. 2 Computing Department, Imperial College London, London SW7 2AZ, UK. 3 Bioengineering Department, Faculty of Engineering, Imperial College London, London SW7 2AZ, UK. 4 Department of Surgery & Cancer, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK.
    [Show full text]
  • CD93 and Dystroglycan Cooperation in Human Endothelial Cell Adhesion and Migration
    www.impactjournals.com/oncotarget/ Oncotarget, Vol. 7, No. 9 CD93 and dystroglycan cooperation in human endothelial cell adhesion and migration Federico Galvagni1,*, Federica Nardi1,*, Marco Maida1, Giulia Bernardini1, Silvia Vannuccini2, Felice Petraglia2, Annalisa Santucci1, Maurizio Orlandini1 1 Department of Biotechnology, Chemistry and Pharmacy, University of Siena, 2-53100 Siena, Italy 2 Department of Molecular and Developmental Medicine, Obstetrics and Gynecology, University of Siena, 53100 Siena, Italy *These authors contributed equally to this work Correspondence to: Maurizio Orlandini, e-mail: [email protected] Keywords: angiogenesis, signal transduction, C1qRp, Src, Cbl Received: June 29, 2015 Accepted: January 22, 2016 Published: February 02, 2016 ABSTRACT CD93 is a transmembrane glycoprotein predominantly expressed in endothelial cells. Although CD93 displays proangiogenic activity, its molecular function in angiogenesis still needs to be clarified. To get molecular insight into the biological role of CD93 in the endothelium, we performed proteomic analyses to examine changes in the protein profile of endothelial cells after CD93 silencing. Among differentially expressed proteins, we identified dystroglycan, a laminin-binding protein involved in angiogenesis, whose expression is increased in vascular endothelial cells within malignant tumors. Using immunofluorescence, FRET, and proximity ligation analyses, we observed a close interaction between CD93 and β-dystroglycan. Moreover, silencing experiments showed that CD93 and dystroglycan promoted endothelial cell migration and organization into capillary-like structures. CD93 proved to be phosphorylated on tyrosine 628 and 644 following cell adhesion on laminin through dystroglycan. This phosphorylation was shown to be necessary for a proper endothelial migratory phenotype. Moreover, we showed that during cell spreading phosphorylated CD93 recruited the signaling protein Cbl, which in turn was phosphorylated on tyrosine 774.
    [Show full text]
  • NCK1 Antibody (Monoclonal) (M01) Mouse Monoclonal Antibody Raised Against a Partial Recombinant NCK1
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 NCK1 Antibody (monoclonal) (M01) Mouse monoclonal antibody raised against a partial recombinant NCK1. Catalog # AT2980a Specification NCK1 Antibody (monoclonal) (M01) - Product Information Application WB, E Primary Accession P16333 Other Accession BC006403 Reactivity Human Host mouse Clonality Monoclonal Isotype IgG1 Kappa Calculated MW 42864 NCK1 Antibody (monoclonal) (M01) - Additional Information Antibody Reactive Against Recombinant Protein.Western Blot detection against Gene ID 4690 Immunogen (37.73 KDa) . Other Names Cytoplasmic protein NCK1, NCK adaptor protein 1, Nck-1, SH2/SH3 adaptor protein NCK-alpha, NCK1, NCK Target/Specificity NCK1 (AAH06403, 185 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Dilution WB~~1:500~1000 Format Clear, colorless solution in phosphate NCK1 monoclonal antibody (M01), clone 1A1 buffered saline, pH 7.2 . Western Blot analysis of NCK1 expression in Hela S3 NE ( (Cat # AT2980a ) Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Precautions NCK1 Antibody (monoclonal) (M01) is for research use only and not for use in diagnostic or therapeutic procedures. NCK1 Antibody (monoclonal) (M01) - Protocols Page 1/3 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Provided below are standard protocols that you may find useful for product applications. • Western Blot • Blocking Peptides • Dot Blot • Immunohistochemistry • Immunofluorescence • Immunoprecipitation • Flow Cytomety • Cell Culture Western Blot analysis of NCK1 expression in transfected 293T cell line by NCK1 monoclonal antibody (M01), clone 1A1.
    [Show full text]
  • Development and Validation of a Protein-Based Risk Score for Cardiovascular Outcomes Among Patients with Stable Coronary Heart Disease
    Supplementary Online Content Ganz P, Heidecker B, Hveem K, et al. Development and validation of a protein-based risk score for cardiovascular outcomes among patients with stable coronary heart disease. JAMA. doi: 10.1001/jama.2016.5951 eTable 1. List of 1130 Proteins Measured by Somalogic’s Modified Aptamer-Based Proteomic Assay eTable 2. Coefficients for Weibull Recalibration Model Applied to 9-Protein Model eFigure 1. Median Protein Levels in Derivation and Validation Cohort eTable 3. Coefficients for the Recalibration Model Applied to Refit Framingham eFigure 2. Calibration Plots for the Refit Framingham Model eTable 4. List of 200 Proteins Associated With the Risk of MI, Stroke, Heart Failure, and Death eFigure 3. Hazard Ratios of Lasso Selected Proteins for Primary End Point of MI, Stroke, Heart Failure, and Death eFigure 4. 9-Protein Prognostic Model Hazard Ratios Adjusted for Framingham Variables eFigure 5. 9-Protein Risk Scores by Event Type This supplementary material has been provided by the authors to give readers additional information about their work. Downloaded From: https://jamanetwork.com/ on 10/02/2021 Supplemental Material Table of Contents 1 Study Design and Data Processing ......................................................................................................... 3 2 Table of 1130 Proteins Measured .......................................................................................................... 4 3 Variable Selection and Statistical Modeling ........................................................................................
    [Show full text]
  • Supp Table 6.Pdf
    Supplementary Table 6. Processes associated to the 2037 SCL candidate target genes ID Symbol Entrez Gene Name Process NM_178114 AMIGO2 adhesion molecule with Ig-like domain 2 adhesion NM_033474 ARVCF armadillo repeat gene deletes in velocardiofacial syndrome adhesion NM_027060 BTBD9 BTB (POZ) domain containing 9 adhesion NM_001039149 CD226 CD226 molecule adhesion NM_010581 CD47 CD47 molecule adhesion NM_023370 CDH23 cadherin-like 23 adhesion NM_207298 CERCAM cerebral endothelial cell adhesion molecule adhesion NM_021719 CLDN15 claudin 15 adhesion NM_009902 CLDN3 claudin 3 adhesion NM_008779 CNTN3 contactin 3 (plasmacytoma associated) adhesion NM_015734 COL5A1 collagen, type V, alpha 1 adhesion NM_007803 CTTN cortactin adhesion NM_009142 CX3CL1 chemokine (C-X3-C motif) ligand 1 adhesion NM_031174 DSCAM Down syndrome cell adhesion molecule adhesion NM_145158 EMILIN2 elastin microfibril interfacer 2 adhesion NM_001081286 FAT1 FAT tumor suppressor homolog 1 (Drosophila) adhesion NM_001080814 FAT3 FAT tumor suppressor homolog 3 (Drosophila) adhesion NM_153795 FERMT3 fermitin family homolog 3 (Drosophila) adhesion NM_010494 ICAM2 intercellular adhesion molecule 2 adhesion NM_023892 ICAM4 (includes EG:3386) intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)adhesion NM_001001979 MEGF10 multiple EGF-like-domains 10 adhesion NM_172522 MEGF11 multiple EGF-like-domains 11 adhesion NM_010739 MUC13 mucin 13, cell surface associated adhesion NM_013610 NINJ1 ninjurin 1 adhesion NM_016718 NINJ2 ninjurin 2 adhesion NM_172932 NLGN3 neuroligin
    [Show full text]
  • Anti-VEGFR2 Phospho (Tyr1214) Antibody (ARG51588)
    Product datasheet [email protected] ARG51588 Package: 100 μl, 50 μl anti-VEGFR2 phospho (Tyr1214) antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes VEGFR2 phospho (Tyr1214) Tested Reactivity Hu, Ms Tested Application ICC/IF, IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name VEGFR2 Antigen Species Human Immunogen Peptide sequence around phosphorylation site of tyrosine 1214 (F-H-Y(p)-D-N) derived from Human VEGFR2. Conjugation Un-conjugated Alternate Names FLK1; VEGFR; CD antigen CD309; FLK-1; Fetal liver kinase 1; VEGFR2; Vascular endothelial growth factor receptor 2; VEGFR-2; CD309; Kinase insert domain receptor; EC 2.7.10.1; Protein-tyrosine kinase receptor flk-1; KDR Application Instructions Application table Application Dilution ICC/IF 1:100 - 1:200 IHC-P 1:50 - 1:100 WB 1:500 - 1:1000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 152 kDa Properties Form Liquid Purification Antibodies were produced by immunizing rabbits with KLH-conjugated synthetic phosphopeptide. Antibodies were purified by affinity-chromatography using epitope-specific phosphopeptide. In addition, non-phospho specific antibodies were removed by chromatogramphy using non- phosphopeptide. Buffer PBS (without Mg2+ and Ca2+, pH 7.4), 150mM NaCl, 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol www.arigobio.com 1/3 Concentration 1 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C.
    [Show full text]
  • Nck Adaptor Proteins Link Tks5 to Invadopodia Actin Regulation and ECM Degradation
    Research Article 2727 Nck adaptor proteins link Tks5 to invadopodia actin regulation and ECM degradation Stanley S. Stylli1, Stacey T. T. I1, Anne M. Verhagen2, San San Xu1, Ian Pass3, Sara A. Courtneidge3 and Peter Lock1,*,‡ 1Department of Surgery, University of Melbourne, Level 5, Clinical Sciences Building, Royal Melbourne Hospital, Parkville, Victoria 3052, Australia 2Walter and Eliza Hall Institute of Medical Research, Parkville, Victoria 3052, Australia 3Burnham Institute for Medical Research, Torrey Pines Road, La Jolla, CA 92037, USA *Present address: Biochemistry Department, La Trobe University, Victoria 3086, Australia ‡Author for correspondence (e-mail: [email protected]) Accepted 5 May 2009 Journal of Cell Science 122, 2727-2740 Published by The Company of Biologists 2009 doi:10.1242/jcs.046680 Summary Invadopodia are actin-based projections enriched with overexpression and inhibited by Nck1 depletion. We show that proteases, which invasive cancer cells use to degrade the clustering at the plasma membrane of the Tks5 inter-SH3 region extracellular matrix (ECM). The Phox homology (PX)-Src containing Y557 triggers phosphorylation at this site, facilitating homology (SH)3 domain adaptor protein Tks5 (also known as Nck recruitment and F-actin assembly. These results identify a SH3PXD2A) cooperates with Src tyrosine kinase to promote Src-Tks5-Nck pathway in ECM-degrading invadopodia that invadopodia formation but the underlying pathway is not clear. shows parallels with pathways linking several mammalian and Here we show that Src phosphorylates Tks5 at Y557, inducing pathogen-derived proteins to local actin regulation. it to associate directly with the SH3-SH2 domain adaptor proteins Nck1 and Nck2 in invadopodia.
    [Show full text]
  • NCK1 Antibody (N-Term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap13726a
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 NCK1 Antibody (N-term) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP13726a Specification NCK1 Antibody (N-term) - Product Information Application WB, IHC-P,E Primary Accession P16333 Other Accession NP_006144.1, NP_001177725.1 Reactivity Human Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 42864 Antigen Region 63-92 NCK1 Antibody (N-term) - Additional Information NCK1 Antibody (N-term) (Cat. #AP13726a) Gene ID 4690 western blot analysis in K562 cell line lysates (35ug/lane).This demonstrates the NCK1 Other Names antibody detected the NCK1 protein (arrow). Cytoplasmic protein NCK1, NCK adaptor protein 1, Nck-1, SH2/SH3 adaptor protein NCK-alpha, NCK1, NCK Target/Specificity This NCK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-92 amino acids from the N-terminal region of human NCK1. Dilution WB~~1:1000 IHC-P~~1:10~50 Format Purified polyclonal antibody supplied in PBS Western blot analysis of NCK1 (arrow) using with 0.09% (W/V) sodium azide. This rabbit polyclonal NCK1 Antibody (N-term) antibody is purified through a protein A (Cat. #AP13726a). 293 cell lysates (2 column, followed by peptide affinity ug/lane) either nontransfected (Lane 1) or purification. transiently transfected (Lane 2) with the NCK1 gene. Storage Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. Precautions Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 NCK1 Antibody (N-term) is for research use only and not for use in diagnostic or therapeutic procedures.
    [Show full text]
  • Ephrin-B1 Forward Signaling Regulates Craniofacial Morphogenesis by Controlling Cell Proliferation Across Eph–Ephrin Boundaries
    Downloaded from genesdev.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Ephrin-B1 forward signaling regulates craniofacial morphogenesis by controlling cell proliferation across Eph–ephrin boundaries Jeffrey O. Bush1 and Philippe Soriano1,2 Program in Developmental Biology and Division of Basic Sciences, Fred Hutchinson Cancer Research Center, Seattle, Washington 98109, USA; and Department of Developmental and Regenerative Biology, Mt. Sinai School of Medicine, New York, New York 10029, USA Mutations in the X-linked human EPHRIN-B1 gene result in cleft palate and other craniofacial anomalies as part of craniofrontonasal syndrome (CFNS), but the molecular and developmental mechanisms by which ephrin-B1 controls the underlying developmental processes are not clear. Here we demonstrate that ephrin-B1 plays an intrinsic role in palatal shelf outgrowth in the mouse by regulating cell proliferation in the anterior palatal shelf mesenchyme. In ephrin-B1 heterozygous mutants, X inactivation generates ephrin-B1-expressing and -nonex- pressing cells that sort out, resulting in mosaic ephrin-B1 expression. We now show that this process leads to mosaic disruption of cell proliferation and post-transcriptional up-regulation of EphB receptor expression through relief of endocytosis and degradation. The alteration in proliferation rates resulting from ectopic Eph–ephrin expression boundaries correlates with the more severe dysmorphogenesis of ephrin-B1+/À heterozygotes that is a hallmark of CFNS. Finally, by integrating phosphoproteomic and transcriptomic approaches, we show that ephrin-B1 controls proliferation in the palate by regulating the extracellular signal-regulated kinase/mitogen- activated protein kinase (ERK/MAPK) signal transduction pathway. [Keywords: Ephrin; cell proliferation; ERK/MAPK; endocytosis; boundaries; craniofrontonasal syndrome; palate] Supplemental material is available at http://www.genesdev.org.
    [Show full text]
  • Functional Enrichments of Disease Variants Indicate Hundreds of Independent Loci Across Eight Diseases
    Functional enrichments of disease variants indicate hundreds of independent loci across eight diseases Abhishek K. Sarkar, Lucas D. Ward, & Manolis Kellis 1.00 0.75 Cohort correlation !"SS 0.50 #AN"$" %&!" N"!"C1 N"!"C2 Pearson 0.25 'verall )TC## 0.00 Hold-out -0.25 0 25000 50000 75000 100000 Top n SNPs (full meta-analysis) Supplementary Figure 1: Correlation between individual cohort 푧-scores and meta-analyzed 푧- scores of the remainder in a study of rheumatoid arthritis considering increasing number of SNPs. SNPs are ranked by 푝-value in the overall meta-analysis. Overall correlation is between sample-size weighted 푧-scores and published inverse-variance weighted 푧-scores. 1 15-state model, 5 marks, 127 epigenomes Cell type/ tissue group Epigenome name Addtl marks H3K4me1 H3K4me3 H3K36me3 H3K27me3 H3K9me3 H3K27ac H3K9ac DNase-Seq DNA methyl RNA-Seq EID states Chrom. E017 IMR90 fetal lung fibroblasts Cell Line 21 IMR90 E002 ES-WA7 Cell Line E008 H9 Cell Line 21 E001 ES-I3 Cell Line E015 HUES6 Cell Line ESC E014 HUES48 Cell Line E016 HUES64 Cell Line E003 H1 Cell Line 20 E024 ES-UCSF4 Cell Line E020 iPS-20b Cell Line E019 iPS-18 Cell Line iPSC E018 iPS-15b Cell Line E021 iPS DF 6.9 Cell Line E022 iPS DF 19.11 Cell Line E007 H1 Derived Neuronal Progenitor Cultured Cells 13 E009 H9 Derived Neuronal Progenitor Cultured Cells 1 E010 H9 Derived Neuron Cultured Cells 1 E013 hESC Derived CD56+ Mesoderm Cultured Cells ES-deriv E012 hESC Derived CD56+ Ectoderm Cultured Cells E011 hESC Derived CD184+ Endoderm Cultured Cells E004 H1 BMP4 Derived Mesendoderm Cultured Cells 11 E005 H1 BMP4 Derived Trophoblast Cultured Cells 15 E006 H1 Derived Mesenchymal Stem Cells 13 E062 Primary mononuclear cells from peripheral blood E034 Primary T cells from peripheral blood E045 Prim.
    [Show full text]