DOCSLIB.ORG

Inflammatory Bowel Disease

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Inflammatory Bowel Disease INFLAMMATORY BOWEL DISEASE Edited by Imre Szabo INFLAMMATORY BOWEL DISEASE Edited by Imre Szabo Inflammatory Bowel Disease http://dx.doi.org/10.5772/46222 Edited by Imre Szabo Contributors Hyunjo Kim, Rahul Anil Sheth, Michael Gee, Valeriu Surlin, Adrian Saftoiu, Catalin Copaescu, Diehl, Yves-Jacques Schneider, Alina Martirosyan, Madeleine Polet, Alexandra Bazes, Thérèse Sergent, Ladislava Bartosova, Michal Kolorz, Milan Bartos, Katerina Wroblova, Michael Wannemuehler, Albert E. Jergens, Amanda E. Ramer-Tait, Anne-Marie C. Overstreet, Brankica Mijandrusic Sincic, Ana Brajdić Published by InTech Janeza Trdine 9, 51000 Rijeka, Croatia Copyright © 2012 InTech All chapters are Open Access distributed under the Creative Commons Attribution 3.0 license, which allows users to download, copy and build upon published articles even for commercial purposes, as long as the author and publisher are properly credited, which ensures maximum dissemination and a wider impact of our publications. After this work has been published by InTech, authors have the right to republish it, in whole or part, in any publication of which they are the author, and to make other personal use of the work. Any republication, referencing or personal use of the work must explicitly identify the original source. Notice Statements and opinions expressed in the chapters are these of the individual contributors and not necessarily those of the editors or publisher. No responsibility is accepted for the accuracy of information contained in the published chapters. The publisher assumes no responsibility for any damage or injury to persons or property arising out of the use of any materials, instructions, methods or ideas contained in the book. Publishing Process Manager Danijela Duric Technical Editor InTech DTP team Cover InTech Design team First published December, 2012 Printed in Croatia A free online edition of this book is available at www.intechopen.com Additional hard copies can be obtained from [email protected] Inflammatory Bowel Disease, Edited by Imre Szabo p. cm. ISBN 978-953-51-0879-5 Contents Preface VII Section 1 Pathogenesis of Inflammatory Bowel Disease 1 Chapter 1 Insights to the Ethiopathogenesis of the Inflammatory Bowel Disease 3 Ana Brajdić and Brankica Mijandrušić-Sinčić Chapter 2 Gene Polymorphisms and Inflammatory Bowel Diseases 3 Bartosova Ladislava, Kolorz Michal, Wroblova Katerina and Bartos Milan Chapter 3 The Role of the Microbiota in Gastrointestinal Health and Disease 23 Anne-Marie C. Overstreet, Amanda E. Ramer-Tait, Albert E. Jergens and Michael J. Wannemuehler Chapter 4 Fibrosis in Crohn’s Disease 73 Lauri Diehl Section 2 Management of Disease 175 Chapter 5 The Imaging of Inflammatory Bowel Disease: Current Concepts and Future Directions 151 Rahul A. Sheth and Michael S. Gee Chapter 6 An Update to Surgical Management of Inflammatory Bowel Diseases 177 V. Surlin, C. Copaescu and A. Saftoiu VI Contents Section 3 Future Therapeutic Directions in IDB 225 Chapter 7 Targeting Colon Drug Delivery by Natural Products 197 Hyunjo Kim Chapter 8 Food Nanoparticles and Intestinal Inflammation: A Real Risk? 227 Alina Martirosyan, Madeleine Polet, Alexandra Bazes, Thérèse Sergent and Yves-Jacques Schneider Preface Inflammatory bowel disease (IBD) is a term for a two very different and yet in many characteristics congruent chronic inflammatory disorder of the intestinal tract. Crohn’s disease (CD) and ulcerative colitis are two principal components of IBD. Both CD and ulcerative colitis are considered as multifactoral diseases. For long period of time we keep these inflammatory intestinal disorders as the result of environmental factors and immunological disturbances manifested in persons with genetic predisposition. The pathogenesis of IBD has remained largely unknown, but surely involves environmental factors, immunological factors in a complex form. Increasing disease prevalence and gathered lot of new research data on IBD suggested the pretence for review. Epidemiological studies have shown that prevalence of IDB has dramatically increases in western world probably due to western lifestyle. Environmental factors are suggested to have major role in development of diseases connected to westernalization of the lifestyle. These factors include smoking, use of antibiotics and non-steroidal anti-inflammatory drugs, stress, various infections and diet. The initiating mechanisms of their actions are still not understood. Research has revealed several genetic factors contributing to IDB pathogenesis; more than a hundred IDB genes, loci and their allele variation have been defined (e.g. NOD2/CARD15, IL23, ATG16L1, IRGM, ICAM-1, CCR5, TLR4, TNFα). Intestinal stricture is a serious and late complication of CD. Recent studies have identified certain disease specific characteristics that may be used in identifying individuals having higher risk for stricture development. These are lower age at initial diagnosis of CD, need for steroid therapy at the diagnosis, perianal fistulizing disease or small intestinal localized disease. Anti-Saccharomyces cerevisiae antibody (ASCA) levels were also found to be correlated to fibrostenosing or penetrating disease behaviour. Recently, other serological markers (anti-I2 and anti-CBir1), fibronectin, bFGF and YKL-40 glycoprotein of the chitinase family have been shown to lead to the hyperplasia of the intestinal muscle layers and deposition of collagen. Determination of gene polymorphism can also be important in regarding the prediction of therapy response. Since no curative therapy for IBD exists, pharmacological therapy mainly focuses on inflammation control. IBD pharmacotherapy utilizes a wide scale of drugs for inflammation reduction including aminosalicylates, glicocorticoids, immunomodulators and biological therapy. Their pharmocodinamics and pharmacokinetics can be altered by polymorphisms of certain gene coding proteins resulting faster drug elimination, tolerance or more side affect development. Namely, the form of N-acetyltransferase in slow acetylators can develop more side effects for sulfasalazine, mutation of glucocorticoid receptor-β lead to decreased affinity to exogenous glucocorticoids, mutations of thiopurine VIII Preface S-methyltransferase defining allelic variations determine the likeliness of leucopenia and thrombocytopenia development during azathioprine or 6-mercaptopurine treatment. Patients who are homozygous for certain standard alleles of NOD2, TLR4 and TNFα are more often resistant to infliximab therapy. The role of altered composition in intestinal microbiota has also been emphasized in the development of IBD over the years. The gut microbiota composition varies upon individual but remains highly stable containing large amount of Bacteroidetes, Firmicutes, Acinetobacter, Proteobacteria and Fusobacteria containing 150 times larger genetic information than the human genome. This changed composition in IBD surely affects normal barrier function, cell metabolism, antibiotic function and inflammatory responses. This book is trying to give further research data to answer the main question whether altered microbiota composition is a cause of or a consequence of the inflammatory state. In the first part of this book you can read chapters for outstanding researchers on the ethiopathogenesis of IBD including a reviews on environmental factors, genetic predisposition (including gene polymorphisms influencing disease development, efficacy of therapy with standard aminosalicylates, glucocorticoids and immunomodulators as well as biological therapy), altered immune response effecting various components of the innate and acquired immune system leading to loss of tolerance to commersal enteral bacteria and to gut dysbiosis. In the second part of the book clinicians show the management of IBD including the presentation of use of modern radiological diagnostic modalities in the diagnosis and identification of extent and activity of IBD. The place of surgical therapy in the management of IBD patients will be discussed by showing up-to-date minimally invasive techniques along with the long-term results of classical surgical options. The last part of the book focuses on future directions of IBD therapy utilizing new pharmacological methods for more effective drug delivery. Potential role of liposomes and nanoparticules (NP) will be highlighted in the treatment of IBD and colon cancer. Data will show that certain nanopaticules, like Ag-NPs or chitosan, may enhance the epithelial permeability and could therefore serve as an effective carrier for drug delivery, but also might favour the systemic absorption of toxins or other NPs that would likely cause immune activation. You can find more interesting data on the beneficial role and night-side of colon targeting drug delivery systems in this last part of the book. I am sure together with the Commissioning Editors and the Publisher that all readers, researcher, clinicians and novice readers, will receive lot of new scientific information by reading this book. I wish to thank the outstanding work of all authors, the invitation to the publisher and the excellent support throughout the publishing process to the commissioning editors, Ms. Ivona Lovric, Ms. Danijela Duric and Mr. Vedran Greblo. Imre Szabo MD, PhD Division of Gastroenterology First Department of Medicine University of Pécs Hungary Section 1 Pathogenesis of Inflammatory Bowel Disease Chapter 1 Insights to the Ethiopathogenesis of the Inflammatory Bowel Disease Ana Brajdić and Brankica Mijandrušić-Sinčić
Load more

Recommended publications
  • Systems and Chemical Biology Approaches to Study Cell Function and Response to Toxins
    Dissertation submitted to the Combined Faculties for the Natural Sciences and for Mathematics of the Ruperto-Carola University of Heidelberg, Germany for the degree of Doctor of Natural Sciences Presented by MSc. Yingying Jiang born in Shandong, China Oral-examination: Systems and chemical biology approaches to study cell function and response to toxins Referees: Prof. Dr. Rob Russell Prof. Dr. Stefan Wölfl CONTRIBUTIONS The chapter III of this thesis was submitted for publishing under the title “Drug mechanism predominates over toxicity mechanisms in drug induced gene expression” by Yingying Jiang, Tobias C. Fuchs, Kristina Erdeljan, Bojana Lazerevic, Philip Hewitt, Gordana Apic & Robert B. Russell. For chapter III, text phrases, selected tables, figures are based on this submitted manuscript that has been originally written by myself. i ABSTRACT Toxicity is one of the main causes of failure during drug discovery, and of withdrawal once drugs reached the market. Prediction of potential toxicities in the early stage of drug development has thus become of great interest to reduce such costly failures. Since toxicity results from chemical perturbation of biological systems, we combined biological and chemical strategies to help understand and ultimately predict drug toxicities. First, we proposed a systematic strategy to predict and understand the mechanistic interpretation of drug toxicities based on chemical fragments. Fragments frequently found in chemicals with certain toxicities were defined as structural alerts for use in prediction. Some of the predictions were supported with mechanistic interpretation by integrating fragment- chemical, chemical-protein, protein-protein interactions and gene expression data. Next, we systematically deciphered the mechanisms of drug actions and toxicities by analyzing the associations of drugs’ chemical features, biological features and their gene expression profiles from the TG-GATEs database.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Enteric Alpha Defensins in Norm and Pathology Nikolai a Lisitsyn1*, Yulia a Bukurova1, Inna G Nikitina1, George S Krasnov1, Yuri Sykulev2 and Sergey F Beresten1
    Lisitsyn et al. Annals of Clinical Microbiology and Antimicrobials 2012, 11:1 http://www.ann-clinmicrob.com/content/11/1/1 REVIEW Open Access Enteric alpha defensins in norm and pathology Nikolai A Lisitsyn1*, Yulia A Bukurova1, Inna G Nikitina1, George S Krasnov1, Yuri Sykulev2 and Sergey F Beresten1 Abstract Microbes living in the mammalian gut exist in constant contact with immunity system that prevents infection and maintains homeostasis. Enteric alpha defensins play an important role in regulation of bacterial colonization of the gut, as well as in activation of pro- and anti-inflammatory responses of the adaptive immune system cells in lamina propria. This review summarizes currently available data on functions of mammalian enteric alpha defensins in the immune defense and changes in their secretion in intestinal inflammatory diseases and cancer. Keywords: Enteric alpha defensins, Paneth cells, innate immunity, IBD, colon cancer Introduction hydrophobic structure with a positively charged hydro- Defensins are short, cysteine-rich, cationic peptides philic part) is essential for the insertion into the micro- found in vertebrates, invertebrates and plants, which bial membrane and the formation of a pore leading to play an important role in innate immunity against bac- membrane permeabilization and lysis of the microbe teria, fungi, protozoa, and viruses [1]. Mammalian [10]. Initial recognition of numerous microbial targets is defensins are predominantly expressed in epithelial cells a consequence of electrostatic interactions between the of skin, respiratory airways, gastrointestinal and geni- defensins arginine residues and the negatively charged tourinary tracts, which form physical barriers to external phospholipids of the microbial cytoplasmic membrane infectious agents [2,3], and also in leukocytes (mostly [2,5].
    [Show full text]
  • Integrated Analysis of Multiple Microarray Studies to Identify Novel Gene Signatures in Ulcerative Colitis
    fgene-12-697514 July 5, 2021 Time: 19:1 # 1 ORIGINAL RESEARCH published: 09 July 2021 doi: 10.3389/fgene.2021.697514 Integrated Analysis of Multiple Microarray Studies to Identify Novel Gene Signatures in Ulcerative Colitis Zi-An Chen1, Yu-Feng Sun1, Quan-Xu Wang1, Hui-Hui Ma1, Zhi-Zhao Ma2* and Chuan-Jie Yang1* 1 Department of Gastroenterology, The Second Hospital of Hebei Medical University, Shijiazhuang, China, 2 Department of Neurosurgery, The Second Hospital of Hebei Medical University, Shijiazhuang, China Background: Ulcerative colitis (UC) is a chronic, complicated, inflammatory disease with an increasing incidence and prevalence worldwide. However, the intrinsic molecular mechanisms underlying the pathogenesis of UC have not yet been fully elucidated. Methods: All UC datasets published in the GEO database were analyzed and Edited by: Shulan Tian, summarized. Subsequently, the robust rank aggregation (RRA) method was used to Mayo Clinic, United States identify differentially expressed genes (DEGs) between UC patients and controls. Gene Reviewed by: functional annotation and PPI network analysis were performed to illustrate the potential Espiridión Ramos-Martínez, Universidad Nacional Autónoma functions of the DEGs. Some important functional modules from the protein-protein de México, Mexico interaction (PPI) network were identified by molecular complex detection (MCODE), Panwen Wang, Gene Ontology (GO), and Kyoto Encyclopedia of Genes and Genomes (KEGG), and Mayo Clinic Arizona, United States analyses were performed. The results of CytoHubba, a plug for integrated algorithm for *Correspondence: Zhi-Zhao Ma biomolecular interaction networks combined with RRA analysis, were used to identify [email protected] the hub genes. Finally, a mouse model of UC was established by dextran sulfate sodium Chuan-Jie Yang [email protected] salt (DSS) solution to verify the expression of hub genes.
    [Show full text]
  • DEFA6 (NM 001926) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP310229 DEFA6 (NM_001926) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Recombinant protein of human defensin, alpha 6, Paneth cell-specific (DEFA6) Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 8.9 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_001917 Locus ID: 1671 UniProt ID: Q01524 RefSeq Size: 479 Cytogenetics: 8p23.1 RefSeq ORF: 300 Synonyms: DEF6; HD-6 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 DEFA6 (NM_001926) Human Recombinant Protein – TP310229 Summary: Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif.
    [Show full text]
  • Downloaded from the Protein Data Bank (PDB
    bioRxiv preprint doi: https://doi.org/10.1101/2021.07.07.451411; this version posted July 7, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. CAT, AGTR2, L-SIGN and DC-SIGN are potential receptors for the entry of SARS-CoV-2 into human cells Dongjie Guo 1, 2, #, Ruifang Guo1, 2, #, Zhaoyang Li 1, 2, Yuyang Zhang 1, 2, Wei Zheng 3, Xiaoqiang Huang 3, Tursunjan Aziz 1, 2, Yang Zhang 3, 4, Lijun Liu 1, 2, * 1 College of Life and Health Sciences, Northeastern University, Shenyang, Liaoning, China 2 Key Laboratory of Data Analytics and Optimization for Smart Industry (Ministry of Education), Northeastern University, Shenyang, Liaoning, China 3 Department of Computational Medicine and Bioinformatics, University of Michigan, Ann Arbor, USA 4 Department of Biological Chemistry, University of Michigan, Ann Arbor, USA * Corresponding author. College of Life and Health Sciences, Northeastern University, Shenyang, 110169, China. E-mail address: [email protected] (L. Liu) # These authors contributed equally to this work. 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.07.07.451411; this version posted July 7, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Since December 2019, the COVID-19 caused by SARS-CoV-2 has been widely spread all over the world.
    [Show full text]
  • The Transition from Primary Colorectal Cancer to Isolated Peritoneal Malignancy
    medRxiv preprint doi: https://doi.org/10.1101/2020.02.24.20027318; this version posted February 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY 4.0 International license . The transition from primary colorectal cancer to isolated peritoneal malignancy is associated with a hypermutant, hypermethylated state Sally Hallam1, Joanne Stockton1, Claire Bryer1, Celina Whalley1, Valerie Pestinger1, Haney Youssef1, Andrew D Beggs1 1 = Surgical Research Laboratory, Institute of Cancer & Genomic Science, University of Birmingham, B15 2TT. Correspondence to: Andrew Beggs, [email protected] KEYWORDS: Colorectal cancer, peritoneal metastasis ABBREVIATIONS: Colorectal cancer (CRC), Colorectal peritoneal metastasis (CPM), Cytoreductive surgery and heated intraperitoneal chemotherapy (CRS & HIPEC), Disease free survival (DFS), Differentially methylated regions (DMR), Overall survival (OS), TableFormalin fixed paraffin embedded (FFPE), Hepatocellular carcinoma (HCC) ARTICLE CATEGORY: Research article NOTE: This preprint reports new research that has not been certified by peer review and should not be used to guide clinical practice. 1 medRxiv preprint doi: https://doi.org/10.1101/2020.02.24.20027318; this version posted February 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. It is made available under a CC-BY 4.0 International license . NOVELTY AND IMPACT: Colorectal peritoneal metastasis (CPM) are associated with limited and variable survival despite patient selection using known prognostic factors and optimal currently available treatments.
    [Show full text]
  • A New Vision of Iga Nephropathy: the Missing Link
    International Journal of Molecular Sciences Review A New Vision of IgA Nephropathy: The Missing Link Fabio Sallustio 1,2,* , Claudia Curci 2,3,* , Vincenzo Di Leo 3 , Anna Gallone 2, Francesco Pesce 3 and Loreto Gesualdo 3 1 Interdisciplinary Department of Medicine (DIM), University of Bari “Aldo Moro”, 70124 Bari, Italy 2 Department of Basic Medical Sciences, Neuroscience and Sense Organs, University of Bari “Aldo Moro”, 70124 Bari, Italy; [email protected] 3 Nephrology, Dialysis and Transplantation Unit, DETO, University “Aldo Moro”, 70124 Bari, Italy; [email protected] (V.D.L.); [email protected] (F.P.); [email protected] (L.G.) * Correspondence: [email protected] (F.S.); [email protected] (C.C.) Received: 7 December 2019; Accepted: 24 December 2019; Published: 26 December 2019 Abstract: IgA Nephropathy (IgAN) is a primary glomerulonephritis problem worldwide that develops mainly in the 2nd and 3rd decade of life and reaches end-stage kidney disease after 20 years from the biopsy-proven diagnosis, implying a great socio-economic burden. IgAN may occur in a sporadic or familial form. Studies on familial IgAN have shown that 66% of asymptomatic relatives carry immunological defects such as high IgA serum levels, abnormal spontaneous in vitro production of IgA from peripheral blood mononuclear cells (PBMCs), high serum levels of aberrantly glycosylated IgA1, and an altered PBMC cytokine production profile. Recent findings led us to focus our attention on a new perspective to study the pathogenesis of this disease, and new studies showed the involvement of factors driven by environment, lifestyle or diet that could affect the disease.
    [Show full text]
  • Ontogeny of the Intestinal Circadian Clock and Its Role in the Response to Clostridium Difficile Toxin B
    Ontogeny of the intestinal circadian clock and its role in the response to Clostridium difficile toxin B A dissertation submitted to the Graduate School of the University of Cincinnati in partial fulfilment of the requirements for the degree of Doctor of Philosophy In the Department of Pharmacology & Systems Physiology of the College of Medicine by Andrew Rosselot B.S. Biology, Wittenberg University October 2019 Committee Chair: Christian I. Hong Ph.D. Abstract: The endogenous clock of the intestine regulates physiological processes ranging from nutrient absorption to the pathogenic response. The developmental timepoint when the human intestinal clock becomes active is unknown. We investigated intestinal circadian clock ontogeny using in vitro samples that are representative of distinct developmental timepoints. Induced pluripotent stem cells (iPSCs) were differentiated into 3D human intestinal organoids (HIOs) to mimic intestinal embryonic development in vitro. HIOs were then matured beyond their early fetal state via kidney capsule transplantation. Differentiation of iPSCs into HIOs did not activate robust circadian clock activity. Enteroids isolated from kidney capsule matured HIOs possessed a functional circadian clock, similar to adult biopsy derived human intestinal enteroids (bHIEs). Samples were challenged with toxin B (TcdB) from Clostridium difficile to provide functional insights on intestinal clock activity. The necrotic cell death response to TcdB was clock phase- dependent in samples that possessed an active clock and anti-phasic between mouse enteroids and bHIEs. RNA-seq analysis of mouse enteroids and bHIEs showed both possess robust rhythmic gene expression with up to 20% and 8% of their transcriptome oscillating, respectively. The phase and identity of rhythmic genes was however species-dependent.
    [Show full text]
  • Product Datasheet DEFA6 Antibody NBP1-84281
    Product Datasheet DEFA6 Antibody NBP1-84281 Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 3 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP1-84281 Updated 1/6/2021 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NBP1-84281 Page 1 of 4 v.20.1 Updated 1/6/2021 NBP1-84281 DEFA6 Antibody Product Information Unit Size 0.1 ml Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Clonality Polyclonal Preservative 0.02% Sodium Azide Isotype IgG Purity Immunogen affinity purified Buffer PBS (pH 7.2) and 40% Glycerol Product Description Host Rabbit Gene ID 1671 Gene Symbol DEFA6 Species Human Reactivity Notes Reactivity reported in scientific literature (PMID: 23519454) Specificity/Sensitivity Specificity of human DEFA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTC HCRRSCYSTEYSYGTCTVMGINHRFC Product Application Details Applications Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry- Paraffin Recommended Dilutions Western Blot 0.04 - 0.4 ug/ml, Simple Western, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 Application Notes For IHC-Paraffin, HIER pH 6 retrieval is recommended. Images Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in control (vector only transfected HEK293T lysate) and DEFA6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
    [Show full text]
  • Crosstalk Between H9N2 Avian Influenza Virus and Crypt-Derived
    Huang et al. Vet Res (2017) 48:71 DOI 10.1186/s13567-017-0478-6 RESEARCH ARTICLE Open Access Crosstalk between H9N2 avian infuenza virus and crypt‑derived intestinal organoids Lulu Huang, Qihang Hou, Lulu Ye, Qian Yang and Qinghua Yu* Abstract The spread of Avian infuenza virus via animal feces makes the virus difcult to prevent, which causes great threat to human health. Therefore, it is imperative to understand the survival and invasion mechanism of H9N2 virus in the intestinal mucosa. In this study, we used mouse threedimensional intestinal organoids that contained intestinal crypts and villi diferentiated from intestinal stem cells to explore interactions between H9N2 avian infuenza virus and the intestinal mucosa. The HA, NA, NP and PB1 genes of H9N2 viruses could be detected in intestinal organoids at 1 h, and reached peak levels at 48 h post-infection. Moreover, the HA and NP proteins of H9N2 virus could also be detected in organoids via immunofuorescence. Virus invasion caused damage to intestinal organoids with reduced mRNA tran- script expression of Wnt3, Dll1 and Dll4. The abnormal growth of intestinal organoids may be attributed to the loss of Paneth cells, as indicated by the low mRNA transcript levels of lyz1 and defcr1. This present study demonstrates that H9N2 virus could invade intestinal organoids and then cause damage, as well as afect intestinal stem cell proliferation and diferentiation, promoting the loss of Paneth cells. Introduction Caco-2 cells, and cause severe epithelial apoptosis [5, 6]. In China, low pathogenicity avian infuenza (LPAI) viruses However, the intestinal mucosa contains intestinal crypt of the H9N2 subtype have become endemic.
    [Show full text]
  • Severity of Experimental Autoimmune Uveitis Is Reduced by Pretreatment with Live Probiotic Escherichia Coli Nissle 1917
    cells Article Severity of Experimental Autoimmune Uveitis Is Reduced by Pretreatment with Live Probiotic Escherichia coli Nissle 1917 Otakar Dusek 1, Alena Fajstova 2, Aneta Klimova 1, Petra Svozilkova 1 , Tomas Hrncir 3 , Miloslav Kverka 2,* , Stepan Coufal 2 , Johan Slemin 2, Helena Tlaskalova-Hogenova 2, John V. Forrester 4,5,6 and Jarmila Heissigerova 1 1 Department of Ophthalmology, First Faculty of Medicine, Charles University and General University Hospital in Prague, 128 08 Prague, Czech Republic; [email protected] (O.D.); [email protected] (A.K.); [email protected] (P.S.); [email protected] (J.H.) 2 Institute of Microbiology of the Czech Academy of Sciences, v.v.i., 142 20 Prague, Czech Republic; [email protected] (A.F.); [email protected] (S.C.); [email protected] (J.S.); [email protected] (H.T.-H.) 3 Institute of Microbiology of the Czech Academy of Sciences, v.v.i., 549 22 Novy Hradek, Czech Republic; [email protected] 4 Section of Immunology and Infection, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB24 3FX, UK; [email protected] 5 Immunology and Virology Program, Centre for Ophthalmology and Visual Science, The University of Western Australia, Crawley, Western Australia 6009, Australia 6 Centre for Experimental Immunology, Lions Eye Institute, Nedlands, Western Australia 6009, Australia * Correspondence: [email protected]; Tel.: +420-24106-2452 Abstract: Non-infectious uveitis is considered an autoimmune disease responsible for a significant burden of blindness in developed countries and recent studies have linked its pathogenesis to dys- regulation of the gut microbiota.
    [Show full text]