RBM8A (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

RBM8A (Human) Recombinant predominantly in the nucleus, although it is also present Protein (P01) in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear Catalog Number: H00009939-P01 mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced Regulation Status: For research use only (RUO) mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing Product Description: Human RBM8A full-length ORF ( events. Previously, it was thought that two genes encode AAH17088, 1 a.a. - 174 a.a.) recombinant protein with this protein, RBM8A and RBM8B; it is now thought that GST-tag at N-terminal. the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene Sequence: also uses multiple polyadenylation sites. [provided by MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKG RefSeq] RGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEG WILSVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTG YLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVD WCFVRGPPKGKRRGGRRRSRSPDRRRR Host: Wheat Germ (in vitro) Theoretical MW (kDa): 44.88 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 9939 Gene Symbol: RBM8A Gene Alias: BOV-1A, BOV-1B, BOV-1C, MDS014, RBM8, RBM8B, Y14, ZNRP, ZRNP1 Gene Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Thrombocytopenia-Absent Radius Syndrome
Thrombocytopenia-absent radius syndrome Description Thrombocytopenia-absent radius (TAR) syndrome is characterized by the absence of a bone called the radius in each forearm and a shortage (deficiency) of blood cells involved in clotting (platelets). This platelet deficiency (thrombocytopenia) usually appears during infancy and becomes less severe over time; in some cases the platelet levels become normal. Thrombocytopenia prevents normal blood clotting, resulting in easy bruising and frequent nosebleeds. Potentially life-threatening episodes of severe bleeding ( hemorrhages) may occur in the brain and other organs, especially during the first year of life. Hemorrhages can damage the brain and lead to intellectual disability. Affected children who survive this period and do not have damaging hemorrhages in the brain usually have a normal life expectancy and normal intellectual development. The severity of skeletal problems in TAR syndrome varies among affected individuals. The radius, which is the bone on the thumb side of the forearm, is almost always missing in both arms. The other bone in the forearm, which is called the ulna, is sometimes underdeveloped or absent in one or both arms. TAR syndrome is unusual among similar malformations in that affected individuals have thumbs, while people with other conditions involving an absent radius typically do not. However, there may be other abnormalities of the hands, such as webbed or fused fingers (syndactyly) or curved pinky fingers (fifth finger clinodactyly). Some people with TAR syndrome also have skeletal abnormalities affecting the upper arms, legs, or hip sockets. Other features that can occur in TAR syndrome include malformations of the heart or kidneys.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
The Exon Junction Complex Core Represses Caner-Specific Mature Mrna Re-Splicing: a Potential Key Role in Terminating Splicing
bioRxiv preprint doi: https://doi.org/10.1101/2021.04.01.438154; this version posted April 2, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Communication The Exon Junction Complex Core Represses Caner-specific Mature mRNA Re-splicing: A Potential Key Role in Terminating Splicing Yuta Otani1,2, Toshiki Kameyama1,3 and Akila Mayeda1,* 1 Division of Gene Expression Mechanism, Institute for Comprehensive Medical Science, Fujita Health University, Toyoake, Aichi 470-1192, Japan 2 Laboratories of Discovery Research, Nippon Shinyaku Co., Ltd., Kyoto, Kyoto 601-8550, Japan 3 Present address: Department Physiology, Fujita Health University, School of Medicine, Toyoake, Aichi 470-1192, Japan * Correspondence: [email protected] (A.M.) 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.04.01.438154; this version posted April 2, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract: Using the TSG101 pre-mRNA, we previously discovered cancer-specific re-splicing of mature mRNA that generates aberrant transcripts/proteins. The fact that mRNA is aberrantly re- spliced in various cancer cells implies there must be an important mechanism to prevent deleterious re-splicing on the spliced mRNA in normal cells. We thus postulated that the mRNA re-splicing is controlled by specific repressors and we searched for repressor candidates by siRNA-based screening for mRNA re-splicing activity.
[Show full text]
Supplementary Materials
Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
[Show full text]
1Q21.1 Deletion and a Rare Functional Polymorphism in Siblings with Thrombocytopenia-Absent Radius–Like Phenotypes
Downloaded from molecularcasestudies.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press COLD SPRING HARBOR Molecular Case Studies | RESEARCH ARTICLE 1q21.1 deletion and a rare functional polymorphism in siblings with thrombocytopenia-absent radius–like phenotypes Seth A. Brodie,1 Jean Paul Rodriguez-Aulet,2 Neelam Giri,2 Jieqiong Dai,1 Mia Steinberg,1 Joshua J. Waterfall,3 David Roberson,1 Bari J. Ballew,1 Weiyin Zhou,1 Sarah L. Anzick,3 Yuan Jiang,3 Yonghong Wang,3 Yuelin J. Zhu,3 Paul S. Meltzer,3 Joseph Boland,1 Blanche P. Alter,2 and Sharon A. Savage2 1Cancer Genomics Research Laboratory, Leidos Biomedical Research, NCI-Frederick, Rockville, Maryland 20850, USA; 2Clinical Genetics Branch, Division of Cancer Epidemiology and Genetics, 3Genetics Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, Maryland 20859, USA Abstract Thrombocytopenia-absent radii (TAR) syndrome, characterized by neonatal thrombocytopenia and bilateral radial aplasia with thumbs present, is typically caused by the inheritance of a 1q21.1 deletion and a single-nucelotide polymorphism in RBM8A on the nondeleted allele. We evaluated two siblings with TAR-like dysmorphology but lacking thrombocytopenia in infancy. Family NCI-107 participated in an IRB-approved cohort study and underwent comprehensive clinical and genomic evaluations, including aCGH, whole- exome, whole-genome, and targeted sequencing. Gene expression assays and electromo- bility shift assays (EMSAs) were performed to evaluate the variant of interest. The previously identified TAR-associated 1q21.1 deletion was present in the affected siblings and one healthy parent. Multiple sequencing approaches did not identify previously described TAR-associated SNPs or mutations in relevant genes.
[Show full text]
Mechanism and Molecular Network of RBM8A- Mediated Regulation of Oxaliplatin Resistance in Hepatocellular Carcinoma Via EMT
Mechanism and molecular network of RBM8A- mediated regulation of oxaliplatin resistance in hepatocellular carcinoma via EMT Yan Lin ( [email protected] ) Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Rong Liang Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Jinyan Zhang Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Zhihui Liu Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Ziyu Liu Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Qian Li Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Xiaoling Luo Guangxi Medical University Yongqiang Li Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Jiazhou Ye Guangxi Cancer Hospital and Guangxi Medical University Aliated Cancer Hospital Research Keywords: RBM8A, HCC, oxaliplatin, Drug resistance, HDAC9 Posted Date: March 4th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-15789/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/27 Abstract Epithelial-mesenchymal transition (EMT) has been shown to be closely associated with Oxaliplatin (OXA) resistance. Previous study found that RBM8A is highly expressed in HCC and induce EMT, suggesting that it may be involved in the regulation of OXA resistance in HCC. However, the accurate mechanism has not been concluded. In our study, ectopic expression and silencing of RBM8A were performed to explore its function. The OXA resistance potential of RBM8A and its downstream pathway was investigated using in vitro and in vivo models. The results showed that RBM8A overexpression induced EMT in OXA- resistant HCC cells, thereby affecting cell proliferation, apoptosis, migration, and invasion and promoting OXA resistance in vivo and in vitro.
[Show full text]
RBM8A Gene RNA Binding Motif Protein 8A
RBM8A gene RNA binding motif protein 8A Normal Function The RBM8A gene provides instructions for making a protein called RNA-binding motif protein 8A. This protein is believed to be involved in several important cellular functions involving protein production. These functions include helping to transport molecules called messenger RNA (mRNA), which serve as the genetic blueprint for making proteins. RNA-binding motif protein 8A likely carries mRNA molecules from the nucleus to areas of the cell where proteins are assembled. It may also be involved in controlling how the instructions in mRNA molecules are used to build proteins and in destroying mRNA that is defective or not needed. Health Conditions Related to Genetic Changes Thrombocytopenia-absent radius syndrome Mutations in the RBM8A gene cause thrombocytopenia-absent radius (TAR) syndrome. This disorder is characterized by the absence of a bone called the radius in each forearm and a shortage (deficiency) of blood cells involved in clotting (platelets). Most people with TAR syndrome have a mutation in one copy of the RBM8A gene and a deletion of genetic material from chromosome 1 that includes the other copy of the RBM8A gene in each cell. A small number of affected individuals have mutations in both copies of the RBM8A gene in each cell and do not have a deletion on chromosome 1. RBM8A gene mutations that cause TAR syndrome reduce the amount of RNA-binding motif protein 8A in cells. The deletions involved in TAR syndrome eliminate at least 200, 000 DNA building blocks (200 kilobases, or 200 kb) from the long (q) arm of chromosome 1 in a region called 1q21.1.
[Show full text]
Prenatal Detection of TAR Syndrome in a Fetus with Compound Inheritance of an RBM8A SNP and a 334‑Kb Deletion: a Case Report
MOLECULAR MEDICINE REPORTS 9: 163-165, 2014 Prenatal detection of TAR syndrome in a fetus with compound inheritance of an RBM8A SNP and a 334‑kb deletion: A case report IOANNIS PAPOULIDIS1, EIRINI OIKONOMIDOU1, SANDRO ORRU2, ELISAVET SIOMOU1, MARIA KONTODIOU1, MAKARIOS ELEFTHERIADES3, VASILIOS BACOULAS4, JUAN C. CIGUDOSA5, JAVIER SUELA5, LORETTA THOMAIDIS6 and EMMANOUIL MANOLAKOS1,2 1Laboratory of Genetics, Eurogenetica S.A., Thessaloniki 55133, Greece; 2Department of Medical Genetics, University of Cagliari, Binaghi Hospital, Cagliari I‑09126, Italy; 3Embryocare, Fetal Medicine Unit, Athens 11522; 4Fetal Medicine Centre, Athens 10674, Greece; 5NIMGenetics, Madrid 28049, Spain; 6Department of Pediatrics, Aglaia Kyriakou Children's Hospital, University of Athens, Athens 11527, Greece Received May 30, 2013; Accepted October 16, 2013 DOI: 10.3892/mmr.2013.1788 Abstract. Thrombocytopenia-absent radius syndrome identified the presence of a minimally deleted 200‑kb region (TAR) is a rare genetic disorder that is characterized by the at chromosome band 1q21.1 in patients with TAR, but it is not absence of the radius bone in each forearm and a markedly sufficient to cause the phenotype (3,4). A study identified two reduced platelet count that results in life-threatening bleeding rare single nucleotide polymorphisms (SNPs) in the regulatory episodes (thrombocytopenia). Tar syndrome has been associ- region of the RBM8A gene that are involved in TAR syndrome ated with a deletion of a segment of 1q21.1 cytoband. The through the reduction of the expression of the RBM8A-encoded 1q21.1 deletion syndrome phenotype includes Tar and other Y14 protein (4). The first allele (rs139428292 G>A), which is features such as mental retardation, autism and microcephaly.
[Show full text]
Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration
International Journal of Molecular Sciences Review Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration Baojin Ding * and Masood Sepehrimanesh Department of Biology, University of Louisiana at Lafayette, 410 East Saint Mary Boulevard, Lafayette, LA 70503, USA; [email protected] * Correspondence: [email protected] Abstract: Nucleocytoplasmic transport (NCT) across the nuclear envelope is precisely regulated in eukaryotic cells, and it plays critical roles in maintenance of cellular homeostasis. Accumulating evidence has demonstrated that dysregulations of NCT are implicated in aging and age-related neurodegenerative diseases, including amyotrophic lateral sclerosis (ALS), frontotemporal dementia (FTD), Alzheimer’s disease (AD), and Huntington disease (HD). This is an emerging research ﬁeld. The molecular mechanisms underlying impaired NCT and the pathogenesis leading to neurodegener- ation are not clear. In this review, we comprehensively described the components of NCT machinery, including nuclear envelope (NE), nuclear pore complex (NPC), importins and exportins, RanGTPase and its regulators, and the regulatory mechanisms of nuclear transport of both protein and transcript cargos. Additionally, we discussed the possible molecular mechanisms of impaired NCT underlying aging and neurodegenerative diseases, such as ALS/FTD, HD, and AD. Keywords: Alzheimer’s disease; amyotrophic lateral sclerosis; Huntington disease; neurodegenera- tive diseases; nuclear pore complex; nucleocytoplasmic transport; Ran GTPase Citation: Ding, B.; Sepehrimanesh, M. Nucleocytoplasmic Transport: Regulatory Mechanisms and the Implications in Neurodegeneration. 1. Introduction Int. J. Mol. Sci. 2021, 22, 4165. As a hallmark of eukaryotic cells, the genetic materials are separated from the cyto- https://doi.org/10.3390/ijms plasmic contents by a highly regulated membrane, called nuclear envelope (NE), which 22084165 has two concentric bilayer membranes, the inner nuclear membrane (INM), and outer nuclear membrane (ONM).
[Show full text]
UPF3A and UPF3B Are Redundant and Modular Activators of Nonsense-Mediated Mrna Decay in Human Cells
bioRxiv preprint doi: https://doi.org/10.1101/2021.07.07.451444; this version posted July 13, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 1 UPF3A and UPF3B are redundant and modular activators of 2 nonsense-mediated mRNA decay in human cells 3 4 Damaris Wallmeroth1,2, Volker Boehm1,2, Jan-Wilm Lackmann3, Janine Altmüller4,5, Christoph 5 Dieterich6,7, Niels H. Gehring1,2 6 7 1 Institute for Genetics, University of Cologne, 50674 Cologne, Germany 8 2 Center for Molecular Medicine Cologne (CMMC), University of Cologne, 50937 Cologne, 9 Germany 10 3 CECAD Research Center, University of Cologne, Joseph-Stelzmann-Str. 26, 50931 11 Cologne, Germany 12 4 Cologne Center for Genomics (CCG), University of Cologne, 50931 Cologne, Germany 13 5 Present address: Berlin Institute of Health at Charité – Universitätsmedizin Berlin, Core 14 Facility Genomics, Charitéplatz 1, 10117 Berlin, Germany and Max Delbrück Center for 15 Molecular Medicine in the Helmholtz Association (MDC), Berlin, Germany 16 6 Section of Bioinformatics and Systems Cardiology, Department of Internal Medicine III and 17 Klaus Tschira Institute for Integrative Computational Cardiology, Heidelberg University 18 Hospital, 69120 Heidelberg, Germany 19 7 DZHK (German Centre for Cardiovascular Research), Partner site Heidelberg/Mannheim, 20 69120 Heidelberg, Germany 21 22 *Correspondence: [email protected] (V.B.), [email protected] (N.H.G.) 23 24 Keywords 25 Nonsense-mediated mRNA decay, gene paralogs, mRNA turnover, UPF3 26 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.07.07.451444; this version posted July 13, 2021.
[Show full text]
Produktinformation
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic SAN TA C RUZ BI OTEC HNOL OG Y, INC . karyopherin 13 siRNA (h): sc-62521 BACKGROUND STORAGE AND RESUSPENSION Belonging to the importin β family, karyopherin 13 (Kap13), also known as Store lyophilized siRNA duplex at -20° C with desiccant. Stable for at least Importin-13 (IPO13) or Ran-binding protein 13, is a 963 amino acid protein that one year from the date of shipment. Once resuspended, store at -20° C, contains 20 HEAT repeats and one importin N-terminal domain. Localizing to avoid contact with RNAses and repeated freeze thaw cycles. the nucleus as well as the cytoplasm, karyopherin 13 is expressed in fetal Resuspend lyophilized siRNA duplex in 330 µl of the RNAse-free water brain, heart, intestine and kidney. Karyopherin 13 acts as a nuclear transport pro vided. Resuspension of the siRNA duplex in 330 µl of RNAse-free water receptor, participating in nuclear protein import and nuclear localization sig - makes a 10 µM solution in a 10 µM Tris-HCl, pH 8.0, 20 mM NaCl, 1 mM nals (NLS) in cargo substrates, in a Ras-related nuclear protein-GTPase EDTA buffered solution.
[Show full text]
High Functioning Autism with Missense
International Journal of Molecular Sciences Article High Functioning Autism with Missense Mutations in Synaptotagmin-Like Protein 4 (SYTL4) and Transmembrane Protein 187 (TMEM187) Genes: SYTL4- Protein Modeling, Protein-Protein Interaction, Expression Profiling and MicroRNA Studies Syed K. Rafi 1,* , Alberto Fernández-Jaén 2 , Sara Álvarez 3, Owen W. Nadeau 4 and Merlin G. Butler 1,* 1 Departments of Psychiatry & Behavioral Sciences and Pediatrics, University of Kansas Medical Center, Kansas City, KS 66160, USA 2 Department of Pediatric Neurology, Hospital Universitario Quirón, 28223 Madrid, Spain 3 Genomics and Medicine, NIM Genetics, 28108 Madrid, Spain 4 Department of Biochemistry and Molecular Biology, University of Kansas Medical Center, Kansas City, KS 66160, USA * Correspondence: rafi[email protected] (S.K.R.); [email protected] (M.G.B.); Tel.: +816-787-4366 (S.K.R.); +913-588-1800 (M.G.B.) Received: 25 March 2019; Accepted: 17 June 2019; Published: 9 July 2019 Abstract: We describe a 7-year-old male with high functioning autism spectrum disorder (ASD) and maternally-inherited rare missense variant of Synaptotagmin-like protein 4 (SYTL4) gene (Xq22.1; c.835C>T; p.Arg279Cys) and an unknown missense variant of Transmembrane protein 187 (TMEM187) gene (Xq28; c.708G>T; p. Gln236His). Multiple in-silico predictions described in our study indicate a potentially damaging status for both X-linked genes. Analysis of predicted atomic threading models of the mutant and the native SYTL4 proteins suggest a potential structural change induced by the R279C variant which eliminates the stabilizing Arg279-Asp60 salt bridge in the N-terminal half of the SYTL4, affecting the functionality of the protein’s critical RAB-Binding Domain.
[Show full text]