DOCSLIB.ORG

Supporting Information

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supporting Information Supporting Information Sebé-Pedrós et al. 10.1073/pnas.1002257107 Daphnia pulex 5 Integrin α Daphnia pulex 2 -/ - Capitella sp. 2 Capitella sp. 1 Daphnia pulex 1 Lottia gigantea 2 Amphimedon queenslandica 1 Geodia cydonium Drosophila melanogaster PS5 Drosophila melanogaster scab Drosophila melanogaster PS4 Podocoryne carnea Acropora millepora Homo sapiens 9 Homo sapiens 4 Daphnia pulex 4 Nematostella vectensis Homo sapiens 10 Homo sapiens 11 Homo sapiens 1 Homo sapiens 2 Amastigomonas sp. Homo sapiens 5 Homo sapiens 8 30/ 0.99 Homo sapiens IIb Homo sapiens V Lottia gigantea 1 Amphimedon queenslandica 4 Amphimedon queenslandica 2 Amphimedon queenslandica 3 Amphimedon queenslandica 5 Drosophila melanogaster inflated Drosophila melanogaster mew Daphnia pulex 3 Homo sapiens 6 Homo sapiens 7 Capsaspora owczarzaki 3 Capsaspora owczarzaki 4 Capsaspora owczarzaki 2 Capsaspora owczarzaki 1 Kordia algicida Monosiga brevicollis XP_001749484 Chloroherpeton thalassium Flavobacteriales bacterium Gloeobacter violaceus 88/ 1.00 Nostoc punctiforme Stigmatella aurantiaca Other FG-GAP containing proteins Homo sapiens GPI-PL Nematostella vectensis GPI-PL Capitella sp. GPI-PL Proterospongia sp. GPI-PL Capsaspora owczarzaki GPI-PL GPI-PLs Fig. S1. Maximum likelihood tree of the integrin α homolog and other proteins containing FG-GAP repeats. Alignment has been done using the only common region between all these proteins, which are three consecutive FG-GAP repeats. The taxon sampling includes all of the integrin α homologs here described and a wide representation of metazoan homologs. The putative integrin α from Monosiga brevicollis and some FG-GAP repeat-containing bacteria proteins ob- tained when blasting the M. brevicollis sequence have also been included, together with several glycosylphosphatidylinositol phospholipases. The tree is rooted using the midpoint-rooted tree option. Statistical support was obtained by RAxML with 1,000-bootstrap replicates (bootstrap value, BV) and Bayesian posterior probabilities. BV values are <50% for most branches. Both values are only shown for the some external key branches. The general topology is the same for Bayesian and maximum likelihood analyses. Sebé-Pedrós et al. www.pnas.org/cgi/content/short/1002257107 1of8 Deuterostomia Homo sapiens 6 Gallus gallus 6 Xenopus tropicalis 6 Homo sapiens 3 Gallus gallus 3 Xenopus tropicalis 3 Homo sapiens 5 Gallus gallus 5 Xenopus tropicalis 5 Homo sapiens 8 Gallus gallus 8 Xenopus tropicalis 8 Homo sapiens 2 Gallus gallus 2 Xenopus tropicalis 2 Homo sapiens 7 Xenopus tropicalis 7 Homo sapiens 1 Gallus gallus 1 Xenopus tropicalis 1 Anopheles gambiae Protostomia Daphnia pulex 2 Daphnia pulex 1 Lottia gigantea 3 Capitella sp 2 Capitella sp 1 Lottia gigantea 2 Biomphalaria glabrata Lottia gigantea 1 Strongylocentrotus purpuratus C Deuterostomia Strongylocentrotus purpuratus G Strongylocentrotus purpuratus L-like Strongylocentrotus purpuratus L Acropora millepora 2 Cnidaria Nematostella vectensis 1 Nematostella vectensis 2 Podocoryne carnea Trichoplax adhaerens 2 Placozoa Trichoplax adhaerens 1 Acropora millepora 1 Cnidaria Nematostella vectensis 3 Nematostella vectensis 4 Nematostella vectensis 5 Amphimedon queenslandica 1 Porifera Ophlitaspongia tenuis Suberites domuncula Geodia cydonium Amphimedon queenslandica 2 Amphimedon queenslandica 4 Amphimedon queenslandica 3 Amphimedon queenslandica 5 Amphimedon queenslandica 6 Amphimedon queenslandica 7 3 95.5/1.00 Capsaspora owczarzaki Filasterea 63.5/ - Capsaspora owczarzaki 2 59.8/0.90 Capsaspora owczarzaki 1 Capsaspora owczarzaki 4 84.2/1.00 84.4/1.00 Amastigomonas sp. Apusozoa Trichodesmium erythraeum Cyanobacteria Fig. S2. Maximum likelihood tree of the integrin β protein. The tree is rooted using the midpoint-rooted tree option. Statistical support was obtained by RAxML with 1,000-bootstrap replicates (bootstrap value, BV) and Bayesian posterior probabilities (BPP). Both values are shown on key branches. A black dot indicates BV >90% and BPP >0.95. Sebé-Pedrós et al. www.pnas.org/cgi/content/short/1002257107 2of8 Amastigomonas EG-ADC--TSYTSCSACISSAD--QCGWCFTPGS--------AGCQAASTS---TCAAPDFLNPMSEVQSQSTTS S-----------------VMTPTDV Homo --MNLQPIFWIGLISSVC C--------------------------------------------------------------------------------- - Cow_Ib1 TS-DPC--SAFTICEDCINNAALTMCGWCGDHGQ----------CQSAAGT----CS--NWQSP-------ASRVLGTSGSTP----------EVSPTTT Cow_Ib2 -----C--TDILTCNECITGDSIYGCSWCVADGT----------CRSPSDNALL-CPNPAGVLNPTSNIR-STTNVANADGVV----------EIRPTTA Amastigomonas -------XEATRTTHRRHV--------------------------------------------------------------------------------- - Cow_Ib3 VDPNTC--AALTDCKSCVNNLNIAGCGWCAQDGT----------CRSAQG----DCPAASYHNPS------STYTAAPISGTP----------EIYPAAA -MAAKRVLALLALALLLCL--------------------------------------------------------------------------------- - Ophlitaspongia (sponge) LG-RLC--NAQVSCGDCIFSSP--NCVWCADQNY------NGTRCYAIGDPDFENLCSGMEQNPMGEI---TDTVDPPLQDLT----------QVSPSRV Cow_Ib1 Capitella (annelid) ----------QRTCGSCVSAGP--LCGWCQQEGF---DATNHERCDTTDNLALHGCDEHYMVFPEHNITYDSELKPRNAEGG Q-------EAIQLSPQKV Cow_Ib2 ----MKLFAALLLLLALAS--------------------------------------------------------------------------------- - Homo (vertebrate) TDENRCLKANAKSCGECIQAGP--NCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDIHQIQPQQL 123 4 567 Cow_Ib3 MRCWTALLAAVALMLALSASSAD AAVAPPTTICNAVDEYGGGMTLTCPTGQTISAIVFASYGLPQPSPFTVGTTPCSSMAYDPCNSRSSRSVVESFCLGQ- Integrin beta domain -----------MLLLVSCISSVE----------------------------------------------------------------------------- - Cow_Ib4 Trichodesmium ------------------------------------------- --------------------------------------------------------- - KVFLRLNDPLSFVVTVTPG P-IPLDLVLVEDLSGSMSDDVNTLRALAR D-MVTRVRTEI----------QADTNFGIAGFIDKPAEPIAWNR D--- NTE Amastigomonas 89 C Cow_Ib1 NVFLRAGQPLLVTVSVTPQPCKPVDLYLLMDFSGSMDDDLTKVRSLAQ P-LATKVTQLCTDTSNPTCSNTNCARLGFGSFLEKPAYPMGRWTTSGWIKDS Cow_Ib2 VVELRKGVPQTVSIVVTIPQRKEVEFFYLFDLSGSMGDDLRNVKNLGN N-LRDKMQSLCRGSSSIS---SDCHYWRLGSHVDRPNGPFGGSGDYEFR IEG Cow_Ib3 NVTLRYNIPVVVPITVTVSTSKPLDLFILLDVSATMADDLATLKSFTQTAFSNSINK NCNGGTAPPSG-SECAYVRFGTFVDKPVVPLGGPTDWNFKIAS Ophlitaspongia (sponge) SINVRPGQPQTFNLNVRPARNFPIDLYLLMDLSYSMRDDLDNLKQLGA D-LAASIVGL-----------STNFRIGFGSFVEKVVAPFTTLDVRFQQ NPC Capitella (annelid) SIKLRPNDAFKFSVNFRQAENYPVDLYYVMDLSNSMSDDKSKLAELGD L-LSEEMGKI-----------TKNFHLGFGSFVDKETMPYISTVPTKLVS PC -------------VFAQTD--E-NRCLK---------------- -ANAKSCGECIQAGP--NCGWCTNSTFLQEGMPTSARCDDLEALKKKGC P-PDDIE Homo (vertebrate) VLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGT D-LMNEMRRI-----------TSDFRIGFGSFVEKTVMPYISTTPAKLR NPC Homo 8 Amastigomonas -------------GGGGTG--EGADC------------------ -TSYTSCSACISSAD--QCGWC--------FTPGSAGCQAASTST---CA-APDFL Cow_Ib1 -------------GQARAQ--TSDPC------------------ -SAFTICEDCINNAALTMCGW C--------GDHGQCQSAAGT------CS---NWQ Cow_Ib2 -------------SA------YGQAC------------------ -TDILTCNECITGDSIYGCSW C--------VADGTCRSPSDNALL---CPNPAGVL Amastigomonas SPLANQDCW-NYEYMGWLAAASDENLFFDALENSLENHG N----KDWPESMSEGAFHAAVCTARSGWRS-----NSRHIMLISTDADFHIAGDSELIGVY Cow_Ib1 TYTGGTSLPTNHAFRARLPLSYNLGQFVTLVQGISGIQG N----IDTPENMIDGMLQAILCQKLIDWPSFNTTYQPRRLMLMLTDDTTHFRKE GYMAGIV Cow_Ib3 QTCTITNTNNAAQGGGGFNSYFNDPCQNVVKRLYVSALCVDPNTCAALTDCKSCVNNLNIAGCGW C--------AQDGTCRSAQGD------CP-AASYH Cow_Ib2 IASGDDRSFGSF------------GAFSTALGNAD-TEWG----NDFPESQYSSMLQSLLCVN---WNP-----ARRHILLLATDATGHMEFDSN RLSSA --------------------------------- -VSALTVEDCTALELQSCNACLSK T--SSCGWCKST--------GACMLNTDGTAQ---CPQ-ASWI Cow_Ib3 ------------QYAASSAFSRDFSIARSAVQEP T-ASTNGYSVNDRPNSFLDAAVQAA LCSN---WDP-----THRHMLLVVTDAPFHFAGD AEALSSA Cow_Ib4 Ophlitaspongia (sponge) LNRNDIVCEPTYSYRHIISLTDDADEFNDLVQEQ M-ISGN----QDLPEGGFDGFLQSLLCTNLIGWRD-----VSRKLLLYITDAGFHFAGDGKLGGLI Trichodesmium ----------------------------------------------------------------------------------------------------- - Capitella (annelid) -----NGCAAPYAFRNQLPLTDDTSKFKTKVERT Q-ISGN----LDGPEGGFDAIMQAVSCNNEIGWRE-----TARKLLIYSSDAPYHFAGD GKLGGIV Homo (vertebrate) --TSEQNCTTPFSYKNVLSLTNKGEVFNELVGKQ R-ISGN----LDSPEGGFDAIMQVAVCGSLIGWRN-----VTR-LLVFSTDAGFHFAGDGKLGGIV 9 10 NPRGSKDIKKNKNVTNRSKGTAEKLKPEDIHQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYL M L Y MK LENVKSLGTD-LMNEMRRITSD- Amastigomonas NPHSRLCEDAVGGDGYGPGMA---------------EDY--PSASLIRDALLRQNVVPIFAVTAGDGGNSRFDNIQLYQDIVNEWGF G-FVYTLESDSSN Homo D S S DD Cow_Ib1 EPFPYKC--YVPDSAFTLPSTNTNAVNRFIDDASTKYD Y--PSFSQLKNALIENNIVPIFGSTA T------GINQRTFQDLVTALGFG-QSGTLATNSDN 11 Amastigomonas NP--------MSEVQSQSTTSSV---------MTPTDVKVFLRLNDPLSFVVTVTPGP I-PLDLVLVEDLSGSMSDDVNTLRALARD-MVTRVRTEIQAD Cow_Ib2 TAFPQRRALQKCHVTPG---TASSSSNFANTINAATLDHEIPSWPQIKAAFLDKNVVPILAITA Y------SSNNDHYDSFINALGFG-GRAGLSGDSSN Cow_Ib3 PHAVYKYAQQRCFTGTDAVWASTE------------YEY--PTLGLLSAALLSEFVVPAFIVT N-------AASNNIYTSLVNQLGFGRADLSLASDSNN Cow_Ib1 SP--------ASRVLGTSGSTPE---------VSPTTTNVFLRAGQPLLVTVSVTPQPCKPVDLYLL MDFSGSMDDDLTKVRSLAQP-LATKVTQLCTDT Ophlitaspongia (sponge) LPHQSIC--RLPNSGPHTGSVPVEYMD------AELFDY--PSVGQIAQALREQDIIPIFAA Q--------RDAREFYDVLAAEIGEGASTGTLASDSSN NPTSN---IRSTTNVANADGVVE---------IRPTTAVVELRKGVPQTVSIVVTIPQRKEVEFFYL F L G MG LRNVKNLGNN-LRDKMQSLCRGS Capitella (annelid) TPNDGHC--HLDDDGLYSASLS--------------QDY--PSIGQLSKIISDKKVNVIFAV T--------KSRVPIYRLLGDFIEGS-TVGELANDSSN Cow_Ib2 D S S DD Homo (vertebrate) LPNDGQC--HLENNMYTMSHY---------------YDY--PSIAHLVQKLSENNIQTIFAV T--------EEFQPVYKELKNLIPKS-AVGTLSANSSN Cow_Ib3 NPS-------STYTAAPISGTPE---------IYPAAANVTLRYNIPVVVPITVTVSTSKPLDLFIL LDVSATMADDLATLKSFTQTAFSNSINKNCNGG 11 Cow_Ib4 NPTGQ---LLPNNVPGASAGAFQPSPSAS V--FSPANGTAQLRMGREFTFDITVTPVQYPPVDFYLL
Load more

Recommended publications
  • Multigene Eukaryote Phylogeny Reveals the Likely Protozoan Ancestors of Opis- Thokonts (Animals, Fungi, Choanozoans) and Amoebozoa
    Accepted Manuscript Multigene eukaryote phylogeny reveals the likely protozoan ancestors of opis- thokonts (animals, fungi, choanozoans) and Amoebozoa Thomas Cavalier-Smith, Ema E. Chao, Elizabeth A. Snell, Cédric Berney, Anna Maria Fiore-Donno, Rhodri Lewis PII: S1055-7903(14)00279-6 DOI: http://dx.doi.org/10.1016/j.ympev.2014.08.012 Reference: YMPEV 4996 To appear in: Molecular Phylogenetics and Evolution Received Date: 24 January 2014 Revised Date: 2 August 2014 Accepted Date: 11 August 2014 Please cite this article as: Cavalier-Smith, T., Chao, E.E., Snell, E.A., Berney, C., Fiore-Donno, A.M., Lewis, R., Multigene eukaryote phylogeny reveals the likely protozoan ancestors of opisthokonts (animals, fungi, choanozoans) and Amoebozoa, Molecular Phylogenetics and Evolution (2014), doi: http://dx.doi.org/10.1016/ j.ympev.2014.08.012 This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain. 1 1 Multigene eukaryote phylogeny reveals the likely protozoan ancestors of opisthokonts 2 (animals, fungi, choanozoans) and Amoebozoa 3 4 Thomas Cavalier-Smith1, Ema E. Chao1, Elizabeth A. Snell1, Cédric Berney1,2, Anna Maria 5 Fiore-Donno1,3, and Rhodri Lewis1 6 7 1Department of Zoology, University of Oxford, South Parks Road, Oxford OX1 3PS, UK.
    [Show full text]
  • Emerging Genomic and Proteomic Evidence on Relationships Among the Animal, Plant and Fungal Kingdoms
    Review Emerging Genomic and Proteomic Evidence on Relationships Among the Animal, Plant and Fungal Kingdoms John W. Stiller Department of Biology, East Carolina University, Greenville, NC 27858, USA. Sequence-based molecular phylogenies have provided new models of early eu- karyotic evolution. This includes the widely accepted hypothesis that animals are related most closely to fungi, and that the two should be grouped together as the Opisthokonta. Although most published phylogenies have supported an opisthokont relationship, a number of genes contain a tree-building signal that clusters animal and green plant sequences, to the exclusion of fungi. The alter- native tree-building signal is especially intriguing in light of emerging data from genomic and proteomic studies that indicate striking and potentially synapomor- phic similarities between plants and animals. This paper reviews these new lines of evidence, which have yet to be incorporated into models of broad scale eukaryotic evolution. Key words: genomics, proteomics, evolution, animals, plants, fungi Introduction The results of sequence-based, molecular phylogenetic two di®erent and conflicting phylogenetic signals; analyses have reshaped current thinking about an- most available sequences supported an animals + cient evolutionary relationships, and have begun to es- fungi relationship, but a smaller subset of genes in- tablish a new framework for systematizing broad-scale dicated a closer relationship between animals and eukaryotic diversity. Among the most widely accepted plants. Curiously, there was little or no support of the new evolutionary hypotheses is a proposed for the third possible relationship (plants + fungi). sister relationship between animals (+ choanoflagel- This suggested that a persistent phylogenetic artifact, lates) and fungi (see ref.
    [Show full text]
  • Superorganisms of the Protist Kingdom: a New Level of Biological Organization
    Foundations of Science https://doi.org/10.1007/s10699-020-09688-8 Superorganisms of the Protist Kingdom: A New Level of Biological Organization Łukasz Lamża1 © The Author(s) 2020 Abstract The concept of superorganism has a mixed reputation in biology—for some it is a conveni- ent way of discussing supra-organismal levels of organization, and for others, little more than a poetic metaphor. Here, I show that a considerable step forward in the understand- ing of superorganisms results from a thorough review of the supra-organismal levels of organization now known to exist among the “unicellular” protists. Limiting the discussion to protists has enormous advantages: their bodies are very well studied and relatively sim- ple (as compared to humans or termites, two standard examples in most discussions about superorganisms), and they exhibit an enormous diversity of anatomies and lifestyles. This allows for unprecedented resolution in describing forms of supra-organismal organiza- tion. Here, four criteria are used to diferentiate loose, incidental associations of hosts with their microbiota from “actual” superorganisms: (1) obligatory character, (2) specifc spatial localization of microbiota, (3) presence of attachment structures and (4) signs of co-evolu- tion in phylogenetic analyses. Three groups—that have never before been described in the philosophical literature—merit special attention: Symbiontida (also called Postgaardea), Oxymonadida and Parabasalia. Specifcally, it is argued that in certain cases—for Bihos- pites bacati and Calkinsia aureus (symbiontids), Streblomastix strix (an oxymonad), Joe- nia annectens and Mixotricha paradoxa (parabasalids) and Kentrophoros (a ciliate)—it is fully appropriate to describe the whole protist-microbiota assocation as a single organism (“superorganism”) and its elements as “tissues” or, arguably, even “organs”.
    [Show full text]
  • Protist Phylogeny and the High-Level Classification of Protozoa
    Europ. J. Protistol. 39, 338–348 (2003) © Urban & Fischer Verlag http://www.urbanfischer.de/journals/ejp Protist phylogeny and the high-level classification of Protozoa Thomas Cavalier-Smith Department of Zoology, University of Oxford, South Parks Road, Oxford, OX1 3PS, UK; E-mail: [email protected] Received 1 September 2003; 29 September 2003. Accepted: 29 September 2003 Protist large-scale phylogeny is briefly reviewed and a revised higher classification of the kingdom Pro- tozoa into 11 phyla presented. Complementary gene fusions reveal a fundamental bifurcation among eu- karyotes between two major clades: the ancestrally uniciliate (often unicentriolar) unikonts and the an- cestrally biciliate bikonts, which undergo ciliary transformation by converting a younger anterior cilium into a dissimilar older posterior cilium. Unikonts comprise the ancestrally unikont protozoan phylum Amoebozoa and the opisthokonts (kingdom Animalia, phylum Choanozoa, their sisters or ancestors; and kingdom Fungi). They share a derived triple-gene fusion, absent from bikonts. Bikonts contrastingly share a derived gene fusion between dihydrofolate reductase and thymidylate synthase and include plants and all other protists, comprising the protozoan infrakingdoms Rhizaria [phyla Cercozoa and Re- taria (Radiozoa, Foraminifera)] and Excavata (phyla Loukozoa, Metamonada, Euglenozoa, Percolozoa), plus the kingdom Plantae [Viridaeplantae, Rhodophyta (sisters); Glaucophyta], the chromalveolate clade, and the protozoan phylum Apusozoa (Thecomonadea, Diphylleida). Chromalveolates comprise kingdom Chromista (Cryptista, Heterokonta, Haptophyta) and the protozoan infrakingdom Alveolata [phyla Cilio- phora and Miozoa (= Protalveolata, Dinozoa, Apicomplexa)], which diverged from a common ancestor that enslaved a red alga and evolved novel plastid protein-targeting machinery via the host rough ER and the enslaved algal plasma membrane (periplastid membrane).
    [Show full text]
  • New Perspectives on Analysing Data from Biological Collections Based on Social Network Analytics Pedro C
    www.nature.com/scientificreports OPEN New perspectives on analysing data from biological collections based on social network analytics Pedro C. de Siracusa, Luiz M. R. Gadelha Jr. & Artur Ziviani Biological collections have been historically regarded as fundamental sources of scientifc information on biodiversity. They are commonly associated with a variety of biases, which must be characterized and mitigated before data can be consumed. In this work, we are motivated by taxonomic and collector biases, which can be understood as the efect of particular recording preferences of key collectors on shaping the overall taxonomic composition of biological collections they contribute to. In this context, we propose two network models as the frst steps towards a network-based conceptual framework for understanding the formation of biological collections as a result of the composition of collectors’ interests and activities. Building upon the defned network models, we present a case study in which we use our models to explore the community of collectors and the taxonomic composition of the University of Brasília herbarium. We describe topological features of the networks and point out some of the most relevant collectors in the biological collection as well as their taxonomic groups of interest. We also investigate their collaborative behaviour while recording specimens. Finally, we discuss future perspectives for incorporating temporal and geographical dimensions to the models. Moreover, we indicate some possible investigation directions that could beneft from our approach based on social network analytics to model and analyse biological collections. How data is classifed in information infrastructures directly impacts our potential knowledge about diferent domains1–3.
    [Show full text]
  • Barthelonids Represent a Deep-Branching Metamonad Clade with Mitochondrion-Related Organelles Generating No
    bioRxiv preprint doi: https://doi.org/10.1101/805762; this version posted October 29, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 2 3 Barthelonids represent a deep-branching Metamonad clade with mitochondrion-related 4 organelles generating no ATP. 5 6 Euki Yazaki1*, Keitaro Kume2, Takashi Shiratori3, Yana Eglit 4,5,, Goro Tanifuji6, Ryo 7 Harada7, Alastair G.B. Simpson4,5, Ken-ichiro Ishida7,8, Tetsuo Hashimoto7,8 and Yuji 8 Inagaki7,9* 9 10 1Department of Biochemistry and Molecular Biology, Graduate School and Faculty of 11 Medicine, The University of Tokyo, Tokyo, Japan 12 2Faculty of Medicine, University of Tsukuba, Ibaraki, Japan 13 3Department of Marine Diversity, Japan Agency for Marine-Earth Science and Technology, 14 Yokosuka, Japan 15 4Department of Biology, Dalhousie University, Halifax, Nova Scotia, Canada 16 5Centre for Comparative Genomics and Evolutionary Bioinformatics, Dalhousie University, 17 Halifax, Nova Scotia, Canada 18 6Department of Zoology, National Museum of Nature and Science, Ibaraki, Japan 19 7Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, 20 Ibaraki, Japan 21 8Faculty of Life and Environmental Sciences, University of Tsukuba, Ibaraki, Japan 22 9Center for Computational Sciences, University of Tsukuba, Tsukuba, Ibaraki, Japan 23 24 Running head: Phylogeny and putative MRO functions in a new metamonad clade. 25 26 *Correspondence addressed to Euki Yazaki, [email protected] and Yuji Inagaki, 27 [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/805762; this version posted October 29, 2019.
    [Show full text]
  • Trichonympha Cf
    MOLECULAR PHYLOGENETICS OF TRICHONYMPHA CF. COLLARIS AND A PUTATIVE PYRSONYMPHID: THE RELEVANCE TO THE ORIGIN OF SEX by JOEL BRYAN DACKS B.Sc. The University of Alberta, 1995 A THESIS SUBMITTED IN PARTIAL FULFILMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER'S OF SCIENCE in THE FACULTY OF GRADUATE STUDIES (Department of Zoology) We accept this thesis as conforming to the required standard THE UNIVERSITY OF BRITISH COLUMBIA April 1998 © Joel Bryan Dacks, 1998 In presenting this thesis in partial fulfilment of the requirements for an advanced degree at the University of British Columbia, I agree that the Library shall make it freely available for reference and study. I further agree that permission for extensive copying of this thesis for scholarly purposes may be granted by the head of my department or by his or her representatives. It is understood that copying or publication of this thesis for financial gain shall not be allowed without my written permission. Department of ~2—oc)^Oa^ The University of British Columbia Vancouver, Canada Date {X^ZY Z- V. /^P DE-6 (2/88) Abstract Why sex evolved is one of the central questions in evolutionary genetics. To address this question I have undertaken a molecular phylogenetic study of two candidate lineages to determine the first sexual line. In my thesis the hypermastigotes are confirmed as closely related to the trichomonads in the phylum Parabasalia and found to be more deeply divergent than a putative pyrsonymphid. This means that the Parabasalia are the first sexual lineage. From this I go on to infer that the ancestral sexual cycle included facultative sex.
    [Show full text]
  • APOSTILA DIDATICA 402 Protozoa
    UNIVERSIDADE FEDERAL RURAL DO RIO DE JANEIRO INSTITUTO DE VETERINÁRIA CLASSIFICAÇÃO E MORFOLOGIA DE PROTOZOÁRIOS E RICKÉTTSIAS EM MEDICINA VETERINÁRIA SEROPÉDICA 2016 PREFÁCIO Este material didático foi produzido como parte do projeto intitulado “Desenvolvimento e produção de material didático para o ensino de Parasitologia Animal na Universidade Federal Rural do Rio de Janeiro: atualização e modernização”. Este projeto foi financiado pela Fundação Carlos Chagas Filho de Amparo à Pesquisa do Estado do Rio de Janeiro (FAPERJ) Processo 2010.6030/2014-28 e coordenado pela professora Maria de Lurdes Azevedo Rodrigues (IV/DPA). SUMÁRIO Caracterização morfológica dos táxons superiores de eukaryota 08 1. Império Eukaryota 08 1.1. Reino Protozoa 08 1.2. Reino Chromista 08 1.3. Reino Fungi 08 1.4. Reino Animalia 08 1.5. Reino Plantae 08 Caracterização morfológica de parasitos do reino Protozoa 08 1.1.A. Filo Metamonada 09 A.1. Classe Trepomonadea 09 A.1.1. Ordem Diplomonadida 09 1. Família Hexamitidae 09 a. Gênero Giardia 09 a.1. Espécie Giardia intestinalis 09 1.2.B. Filo Rhizopoda 09 A.1. Classe Entamoebidea 10 A.1.1. Ordem Amoebida 10 1. Família Endamoebidae 10 a. Gênero Entamoeba 10 a.1. Espécie Entamoeba histolytica 10 a.2. Espécie Entomoeba coli 10 1.2.C. Filo Parabasala 11 A.1. Classe Trichomonadea 11 A.1.1. Ordem Trichomonadida 11 1. Família Trichomonadidae 11 a. Gênero Tritrichomonas 11 a.1. Espécie Tritrichomonas foetus 11 2. Família Monocercomonadidae 12 a. Gênero Histomonas 12 a.2. Espécie Histomonas meleagridis 12 1.2.D. Filo Euglenozoa 13 C.1. Classe Kinotoplastidea 13 C.1.1.
    [Show full text]
  • "Phycology". In: Encyclopedia of Life Science
    Phycology Introductory article Ralph A Lewin, University of California, La Jolla, California, USA Article Contents Michael A Borowitzka, Murdoch University, Perth, Australia . General Features . Uses The study of algae is generally called ‘phycology’, from the Greek word phykos meaning . Noxious Algae ‘seaweed’. Just what algae are is difficult to define, because they belong to many different . Classification and unrelated classes including both prokaryotic and eukaryotic representatives. Broadly . Evolution speaking, the algae comprise all, mainly aquatic, plants that can use light energy to fix carbon from atmospheric CO2 and evolve oxygen, but which are not specialized land doi: 10.1038/npg.els.0004234 plants like mosses, ferns, coniferous trees and flowering plants. This is a negative definition, but it serves its purpose. General Features Algae range in size from microscopic unicells less than 1 mm several species are also of economic importance. Some in diameter to kelps as long as 60 m. They can be found in kinds are consumed as food by humans. These include almost all aqueous or moist habitats; in marine and fresh- the red alga Porphyra (also known as nori or laver), an water environments they are the main photosynthetic or- important ingredient of Japanese foods such as sushi. ganisms. They are also common in soils, salt lakes and hot Other algae commonly eaten in the Orient are the brown springs, and some can grow in snow and on rocks and the algae Laminaria and Undaria and the green algae Caulerpa bark of trees. Most algae normally require light, but some and Monostroma. The new science of molecular biology species can also grow in the dark if a suitable organic carbon has depended largely on the use of algal polysaccharides, source is available for nutrition.
    [Show full text]
  • Next Generation Sequencing, Assembly, and Analysis of Bovine
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Doctoral Dissertations Graduate School 5-2018 Next Generation Sequencing, Assembly, and Analysis of Bovine and Feline Tritrichomonas foetus Genomes Toward Taxonomic Clarification And Improved Therapeutic and Preventive Targets Ellen Ann Fleetwood University of Tennessee, [email protected] Follow this and additional works at: https://trace.tennessee.edu/utk_graddiss Recommended Citation Fleetwood, Ellen Ann, "Next Generation Sequencing, Assembly, and Analysis of Bovine and Feline Tritrichomonas foetus Genomes Toward Taxonomic Clarification And Improved Therapeutic and Preventive Targets. " PhD diss., University of Tennessee, 2018. https://trace.tennessee.edu/utk_graddiss/4925 This Dissertation is brought to you for free and open access by the Graduate School at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Doctoral Dissertations by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. To the Graduate Council: I am submitting herewith a dissertation written by Ellen Ann Fleetwood entitled "Next Generation Sequencing, Assembly, and Analysis of Bovine and Feline Tritrichomonas foetus Genomes Toward Taxonomic Clarification And Improved Therapeutic and Preventive Targets." I have examined the final electronic copy of this dissertation for form and content and recommend that it be accepted in partial fulfillment of the equirr ements for the
    [Show full text]
  • Phylogenomic Analyses Support the Monophyly of Excavata and Resolve Relationships Among Eukaryotic ‘‘Supergroups’’
    Phylogenomic analyses support the monophyly of Excavata and resolve relationships among eukaryotic ‘‘supergroups’’ Vladimir Hampla,b,c, Laura Huga, Jessica W. Leigha, Joel B. Dacksd,e, B. Franz Langf, Alastair G. B. Simpsonb, and Andrew J. Rogera,1 aDepartment of Biochemistry and Molecular Biology, Dalhousie University, Halifax, NS, Canada B3H 1X5; bDepartment of Biology, Dalhousie University, Halifax, NS, Canada B3H 4J1; cDepartment of Parasitology, Faculty of Science, Charles University, 128 44 Prague, Czech Republic; dDepartment of Pathology, University of Cambridge, Cambridge CB2 1QP, United Kingdom; eDepartment of Cell Biology, University of Alberta, Edmonton, AB, Canada T6G 2H7; and fDepartement de Biochimie, Universite´de Montre´al, Montre´al, QC, Canada H3T 1J4 Edited by Jeffrey D. Palmer, Indiana University, Bloomington, IN, and approved January 22, 2009 (received for review August 12, 2008) Nearly all of eukaryotic diversity has been classified into 6 strong support for an incorrect phylogeny (16, 19, 24). Some recent suprakingdom-level groups (supergroups) based on molecular and analyses employ objective data filtering approaches that isolate and morphological/cell-biological evidence; these are Opisthokonta, remove the sites or taxa that contribute most to these systematic Amoebozoa, Archaeplastida, Rhizaria, Chromalveolata, and Exca- errors (19, 24). vata. However, molecular phylogeny has not provided clear evi- The prevailing model of eukaryotic phylogeny posits 6 major dence that either Chromalveolata or Excavata is monophyletic, nor supergroups (25–28): Opisthokonta, Amoebozoa, Archaeplastida, has it resolved the relationships among the supergroups. To Rhizaria, Chromalveolata, and Excavata. With some caveats, solid establish the affinities of Excavata, which contains parasites of molecular phylogenetic evidence supports the monophyly of each of global importance and organisms regarded previously as primitive Rhizaria, Archaeplastida, Opisthokonta, and Amoebozoa (16, 18, eukaryotes, we conducted a phylogenomic analysis of a dataset of 29–34).
    [Show full text]
  • Final Copy 2021 05 11 Scam
    This electronic thesis or dissertation has been downloaded from Explore Bristol Research, http://research-information.bristol.ac.uk Author: Scambler, Ross D Title: Exploring the evolutionary relationships amongst eukaryote groups using comparative genomics, with a particular focus on the excavate taxa General rights Access to the thesis is subject to the Creative Commons Attribution - NonCommercial-No Derivatives 4.0 International Public License. A copy of this may be found at https://creativecommons.org/licenses/by-nc-nd/4.0/legalcode This license sets out your rights and the restrictions that apply to your access to the thesis so it is important you read this before proceeding. Take down policy Some pages of this thesis may have been removed for copyright restrictions prior to having it been deposited in Explore Bristol Research. However, if you have discovered material within the thesis that you consider to be unlawful e.g. breaches of copyright (either yours or that of a third party) or any other law, including but not limited to those relating to patent, trademark, confidentiality, data protection, obscenity, defamation, libel, then please contact [email protected] and include the following information in your message: •Your contact details •Bibliographic details for the item, including a URL •An outline nature of the complaint Your claim will be investigated and, where appropriate, the item in question will be removed from public view as soon as possible. Exploring the evolutionary relationships amongst eukaryote groups using comparative genomics, with a particular focus on the excavate taxa Ross Daniel Scambler Supervisor: Dr. Tom A. Williams A dissertation submitted to the University of Bristol in accordance with the requirements for award of the degree of Master of Science (by research) in the Faculty of Life Sciences, Novem- ber 2020.
    [Show full text]