Pediatric Dermatology at the 2021 Virtual SID Annual Meeting May 3-7, 2021
Total Page：16
File Type：pdf, Size：1020Kb
Load more
Recommended publications
-
Old and New Challenges in Uveitis Associated with Behçet's Disease
Journal of Clinical Medicine Review Old and New Challenges in Uveitis Associated with Behçet’s Disease Julie Gueudry 1,* , Mathilde Leclercq 2, David Saadoun 3,4,5 and Bahram Bodaghi 6 1 Department of Ophthalmology, Hôpital Charles Nicolle, F-76000 Rouen, France 2 Department of Internal Medicine, Hôpital Charles Nicolle, F-76000 Rouen, France; [email protected] 3 Department of Internal Medicine and Clinical Immunology, AP-HP, Centre National de Références Maladies Autoimmunes et Systémiques Rares et Maladies Autoinflammatoires Rares, Groupe Hospitalier Pitié-Salpêtrière, F-75013 Paris, France; [email protected] 4 Sorbonne Universités, UPMC Univ Paris 06, INSERM, UMR S 959, Immunology-Immunopathology-Immunotherapy (I3), F-75005 Paris, France 5 Biotherapy (CIC-BTi), Hôpital Pitié-Salpêtrière, AP-HP, F-75651 Paris, France 6 Department of Ophthalmology, IHU FOReSIGHT, Sorbonne-AP-HP, Groupe Hospitalier Pitié-Salpêtrière, F-75013 Paris, France; [email protected] * Correspondence: [email protected]; Tel.: +33-2-32-88-80-57 Abstract: Behçet’s disease (BD) is a systemic vasculitis disease of unknown origin occurring in young people, which can be venous, arterial or both, classically occlusive. Ocular involvement is particularly frequent and severe; vascular occlusion secondary to retinal vasculitis may lead to rapid and severe loss of vision. Biologics have transformed the management of intraocular inflammation. However, the diagnosis of BD is still a major challenge. In the absence of a reliable biological marker, diagnosis is based on clinical diagnostic criteria and may be delayed after the appearance of the onset sign. However, therapeutic management of BD needs to be introduced early in order to control inflammation, to preserve visual function and to limit irreversible structural damage. -
Pharmacologic Considerations in the Disposition of Antibodies and Antibody-Drug Conjugates in Preclinical Models and in Patients
antibodies Review Pharmacologic Considerations in the Disposition of Antibodies and Antibody-Drug Conjugates in Preclinical Models and in Patients Andrew T. Lucas 1,2,3,*, Ryan Robinson 3, Allison N. Schorzman 2, Joseph A. Piscitelli 1, Juan F. Razo 1 and William C. Zamboni 1,2,3 1 University of North Carolina (UNC), Eshelman School of Pharmacy, Chapel Hill, NC 27599, USA; [email protected] (J.A.P.); [email protected] (J.F.R.); [email protected] (W.C.Z.) 2 Division of Pharmacotherapy and Experimental Therapeutics, UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA; [email protected] 3 Lineberger Comprehensive Cancer Center, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA; [email protected] * Correspondence: [email protected]; Tel.: +1-919-966-5242; Fax: +1-919-966-5863 Received: 30 November 2018; Accepted: 22 December 2018; Published: 1 January 2019 Abstract: The rapid advancement in the development of therapeutic proteins, including monoclonal antibodies (mAbs) and antibody-drug conjugates (ADCs), has created a novel mechanism to selectively deliver highly potent cytotoxic agents in the treatment of cancer. These agents provide numerous benefits compared to traditional small molecule drugs, though their clinical use still requires optimization. The pharmacology of mAbs/ADCs is complex and because ADCs are comprised of multiple components, individual agent characteristics and patient variables can affect their disposition. To further improve the clinical use and rational development of these agents, it is imperative to comprehend the complex mechanisms employed by antibody-based agents in traversing numerous biological barriers and how agent/patient factors affect tumor delivery, toxicities, efficacy, and ultimately, biodistribution. -
Review Anti-Cytokine Biologic Treatment Beyond Anti-TNF in Behçet's Disease
Review Anti-cytokine biologic treatment beyond anti-TNF in Behçet’s disease A. Arida, P.P. Sfikakis First Department of Propedeutic Internal ABSTRACT and thrombotic complications (1-3). Medicine Laikon Hospital, Athens, Unmet therapeutic needs in Behçet’s Treatment varies according to type and University Medical School, Greece. disease have drawn recent attention to severity of disease manifestations. Cor- Aikaterini Arida, MD biological agents targeting cytokines ticosteroids, interferon-alpha and con- Petros P. Sfikakis, MD other than TNF. The anti-IL-17 anti- ventional immunosuppressive drugs, Please address correspondence to: body secukinumab and the anti-IL-2 such as azathioprine, cyclosporine-A, Petros P. Sfikakis, MD, receptor antibody daclizumab were not cyclophosphamide and methotrexate, First Department of Propedeutic superior to placebo for ocular Behçet’s and Internal Medicine, are used either alone or in combination Laikon Hospital, in randomised controlled trials, com- for vital organ involvement. During the Athens University Medical School, prising 118 and 17 patients, respec- last decade there has been increased use Ag Thoma, 17, tively. The anti-IL-1 agents anakinra of anti-TNF monoclonal antibodies in GR-11527 Athens, Greece. and canakinumab and the anti-IL-6 patients with BD who were refractory E-mail: [email protected] agent tocilizumab were given to iso- to conventional treatment or developed Received on June 7, 2014; accepted in lated refractory disease patients, who life-threatening complications (4, 5). revised form on September 17, 2014. were either anti-TNF naïve (n=9) or Anti-TNF treatment has been shown to Clin Exp Rheumatol 2014; 32 (Suppl. 84): experienced (n=18). -
Challenges and Approaches for the Development of Safer Immunomodulatory Biologics
REVIEWS Challenges and approaches for the development of safer immunomodulatory biologics Jean G. Sathish1*, Swaminathan Sethu1*, Marie-Christine Bielsky2, Lolke de Haan3, Neil S. French1, Karthik Govindappa1, James Green4, Christopher E. M. Griffiths5, Stephen Holgate6, David Jones2, Ian Kimber7, Jonathan Moggs8, Dean J. Naisbitt1, Munir Pirmohamed1, Gabriele Reichmann9, Jennifer Sims10, Meena Subramanyam11, Marque D. Todd12, Jan Willem Van Der Laan13, Richard J. Weaver14 and B. Kevin Park1 Abstract | Immunomodulatory biologics, which render their therapeutic effects by modulating or harnessing immune responses, have proven their therapeutic utility in several complex conditions including cancer and autoimmune diseases. However, unwanted adverse reactions — including serious infections, malignancy, cytokine release syndrome, anaphylaxis and hypersensitivity as well as immunogenicity — pose a challenge to the development of new (and safer) immunomodulatory biologics. In this article, we assess the safety issues associated with immunomodulatory biologics and discuss the current approaches for predicting and mitigating adverse reactions associated with their use. We also outline how these approaches can inform the development of safer immunomodulatory biologics. Immunomodulatory Biologics currently represent more than 30% of licensed The high specificity of the interactions of immu- biologics pharmaceutical products and have expanded the thera- nomodulatory biologics with their relevant immune Biotechnology-derived peutic options available -
BIOLOGIC THERAPIES ASTHMA DYKEWICZ F BW.Pdf
11/30/2011 Biologic Asthma Therapies and Individualized Medicine Disclosures Advisory boards Mark S. Dykewicz, MD Merck (advisor, honorarium) Director, Allergy & Immunology Shire (advisor, honorarium) Fellowship Program Director Wake Forest University School of Medicine Editorial boards Winston-Salem, North Carolina USA Allergy & Asthma Proceedings American Journal of Rhinology & Allergy Clinical Reviews in Allergy & Immunology Journal of Angioedema Learning Objective Biological therapies May fill unmet needs, potentially in To better understand the use of biologic subpopulations or phenotypes of patients with modifiers in individualized asthma more severe asthma. treatment. May provide insight into mechanisms of asthma Sheharyar, Durrani, Busse. Biological Therapy for Asthma. ACCP PCCSU Article | 03.15.11 Omalizumab (Anti-IgE) Biologics with action against IgE (omalizumab) Biologic mechanism: Mab against IgE; decreases IgE Cytokines levels; results in down-regulation of IgE receptor IL-4 and/or IL-13 Patient subsets: persistent asthma selected for IL-5 specific IgE to perennial allergen, total serum IgE in Chemokine Receptors specified range CCR3 Benefits: 8 trials (n=3429) Rodrigo. Chest 2011 139:28 CXCR2 decreases in exacerbations, dose of inhaled and oral Transcription Factors corticosteroids, hospitalizations PPARs (peroxisome proliferator-activated receptors) improvement in QOL when used as add-on Rx Prostaglandin Receptors no improvement in lung function. CRTH2 6 1 11/30/2011 IL-4 Modifiers IL-13 Altrakincept Solubilized IL-4 Failed to show efficacy in large phase Pleiotropic cytokine of Th2 cells, promotes IgE receptor fragment, 3 trial. production neutralizes IL-4 Adcock et al (2008) May contribute to key features of asthma Pascolizumab Monoclonal Ab Phase 2 study of pascolizumab IL-13 production inhibited by inhaled glucocorticoids against IL- 4 discontinued because of inefficacy. -
Biological Therapies for Atopic Dermatitis: an Update (Review)
EXPERIMENTAL AND THERAPEUTIC MEDICINE 17: 1061-1067, 2019 Biological therapies for atopic dermatitis: An update (Review) DIANA DELEANU1-3 and IRENA NEDELEA1,2 1Allergology and Immunology Discipline, ‘Iuliu Hatieganu’ University of Medicine and Pharmacy, 400058 Cluj-Napoca; Departments of 2Allergy and 3Internal Medicine, ‘Professor Doctor Octavian Fodor’ Regional Institute of Gastroenterology and Hepatology, 400162 Cluj-Napoca, Romania Received July 6, 2018; Accepted August 22, 2018 DOI: 10.3892/etm.2018.6989 Abstract. Severe atopic dermatitis, which affects both adults in low-income countries (3). Furthermore, the past decades and children, is a debilitating disorder with a significant decline brought a 2-3-fold increase in prevalence in industrialized of patients' quality of life. Although aetiopathogenic factors countries (3). Generally AD onset is in early childhood, as are currently a topic of study and interpretation, the main one of the first steps of the ‘atopic march’, which describes the features of atopic eczema are skin barrier disturbance and natural history of atopic manifestations, and it is character- immune dysregulation. Severe refractory disease that fails to ized by xerotic skin and acute flare-ups of intensely pruritic improve with conventional therapy may benefit from biologic eczematous lesions (4). Recent studies recognize a predilection therapy. Progress in understanding immunopathology of atopic of AD for persistence in adulthood, with a lifetime prevalence dermatitis have allowed identification of therapeutic molecular accounting for 34.1% (5). Early onset, allergic rhinitis and targets in the field of biological therapy. We reviewed the hand eczema in childhood are high-risk factors for persistent different biological treatments with a focus on novel targeted AD (5). -
Sarcoidosis Manifesting During Treatment with Secukinumab for Psoriatic Arthritis Colm Kirby ,1 Darragh Herlihy,2 Lindsey Clarke,3 Ronan Mullan1
Case report BMJ Case Rep: first published as 10.1136/bcr-2020-240615 on 22 February 2021. Downloaded from Sarcoidosis manifesting during treatment with secukinumab for psoriatic arthritis Colm Kirby ,1 Darragh Herlihy,2 Lindsey Clarke,3 Ronan Mullan1 1Rheumatology, Tallaght SUMMARY University Hospital, Dublin, Sarcoidosis is a multisystem inflammatory disorder Ireland 2 of uncertain aetiology. There are numerous case Radiology, Beaumont Hospital, reports of sarcoidosis occurring during treatment with Dublin, Ireland biological immunotherapies. Here, we describe the case 3Pathology, Tallaght University Hospital, Dublin, Ireland of a 52- year- old woman with psoriatic arthritis who developed multisystem sarcoidosis while being treated Correspondence to with secukinumab (anti-interleukin- 17A) therapy which, Dr Colm Kirby; to our knowledge, is the first such case. We discuss colmkirby11@ gmail. com existing literature and hypothesise that IL-17 blockade may precipitate the development of granulomatous Accepted 8 February 2021 disease. BACKGROUND Figure 1 (A) Palmar longitudinal view of dactylitic Sarcoidosis is a multisystem disorder characterised finger showing tendon sheath effusion with power by the presence of non-caseat ing granulomata. Doppler signal. (B) longitudinal view of posterior tibialis While the disease is most commonly character- tendon showing tendon sheath effusion, tenosynovial ised by thoracic adenopathy, lung parenchyma, thickening and power Doppler signal. skin and articular disease, all organ systems may be affected. While the precise aetiology of sarcoid- sedimentation rate (ESR) of 16 mm/hour (1–15), osis is unclear, numerous case reports of sarcoid- normal C- reactive protein (CRP) and normal osis occurring during the treatment with biological rheumatoid factor, anti- cyclic citrullinated peptide immunotherapies indicate that immune dysregula- (anti- CCP) and anti- neutrophil cytoplasm antibody tion plays a key role. -
Atopic Dermatitis (AD)
This activity is provided by PRIME Education. There is no fee to participate. This activity is supported by education grants from AbbVie, Inc., Sanofi Genzyme and Regeneron Pharmaceuticals. © 2019 PRIME® Education, LLC. All Rights Reserved.. Overview This downloadable fact‐sheet provides an easy‐to‐follow collection of the latest evidence shaping the treatment and management of psoriasis (PsO) and atopic dermatitis (AD). Learn about validated tools, evidence‐based strategies, and new and emerging targeted therapies that can be incorporated in daily practice to improve outcomes for patients with these conditions. © 2019 PRIME® Education, LLC. All Rights Reserved.. 2 1 Learning Objectives • Identify major barriers to evidence‐based treatment and management in federal and public sectors • Implement appropriate methods for diagnosis and assessment of disease activity • Assess current evidence on targeted biologic and small‐molecule therapies to guide treatment decisions for patients with moderate to severe disease • Monitor treatment responses according to treat‐to‐target principles and methods • Apply current evidence and guidelines to inform treatment decisions for patients with inadequate responses to initial therapies • Incorporate patient‐reported outcomes and shared decision‐making into clinical practice • Apply effective strategies for multidisciplinary care coordination and shared patient management © 2019 PRIME® Education, LLC. All Rights Reserved.. 3 Accreditation In support of improving patient care, PRIME® is jointly accredited by the Accreditation Council for Continuing Medical Education (ACCME), the Accreditation Council for Pharmacy Education (ACPE), and the American Nurses Credentialing Center (ANCC) to provide continuing education for the healthcare team. This activity was planned by and for the healthcare team, and learners will receive 2.25 Interprofessional Continuing Education (IPCE) credits for learning and change. -
Pharmacokinetic-Pharmacodynamic Modelling of Systemic IL13 Blockade by Monoclonal Antibody Therapy: a Free Assay Disguised As Total
pharmaceutics Article Pharmacokinetic-Pharmacodynamic Modelling of Systemic IL13 Blockade by Monoclonal Antibody Therapy: A Free Assay Disguised as Total John Hood 1,*, Ignacio González-García 1 , Nicholas White 1, Leeron Marshall 1,2, Vincent F. S. Dubois 1 , Paolo Vicini 1,3 and Paul G. Baverel 1,4 1 Clinical Pharmacology and Quantitative Pharmacology, AstraZeneca, Cambridge CB21 6GH, UK; [email protected] (I.G.-G.); [email protected] (N.W.); [email protected] (L.M.); [email protected] (V.F.S.D.); [email protected] (P.V.); [email protected] (P.G.B.) 2 Salford Royal Foundation Trust, Salford M6 8HD, UK 3 Confo Therapeutics, 9052 Ghent, Zwijnaarde, Belgium 4 Roche Pharma Research and Early Development, Clinical Pharmacology, Pharmaceutical Sciences, Roche Innovation Center Basel F. Hoffmann-La Roche Ltd., CH-4070 Basel, Switzerland * Correspondence: [email protected]; Tel.: +44-1223-749-6288 Abstract: A sequential pharmacokinetic (PK) and pharmacodynamic (PD) model was built with Nonlinear Mixed Effects Modelling based on data from a first-in-human trial of a novel biologic, MEDI7836. MEDI7836 is a human immunoglobulin G1 lambda (IgG1λ-YTE) monoclonal antibody, Citation: Hood, J.; González-García, with an Fc modification to reduce metabolic clearance. MEDI7836 specifically binds to, and function- I.; White, N.; Marshall, L.; Dubois, ally neutralizes interleukin-13. Thirty-two healthy male adults were enrolled into a dose-escalation V.F.S.; Vicini, P.; Baverel, P.G. clinical trial. Four active doses were tested (30, 105, 300, and 600 mg) with 6 volunteers enrolled Pharmacokinetic-Pharmacodynamic per cohort. Eight volunteers received placebo as control. -
Secukinumab - Drugbank
2/22/2018 Secukinumab - DrugBank Secukinumab Targets (1) Biointeractions (1) IDENTIFICATION Name Secukinumab Accession Number DB09029 Type Biotech Groups Approved Biologic Classification Protein Based Therapies Monoclonal antibody (mAb) Description Secukinumab (Cosentyx) is a human monoclonal antibody designed for the treatment of uveitis, rheumatoid arthritis, ankylosing spondylitis, and psoriasis. Secukinumab is an interleukin-17A (IL- 17A) inhibitor marketed by Novartis. IL-17 is a group of proinflammatory cytokines released by cells of the immune system and and exist in higher levels in many immune conditions associated with chronic inflammation. By targeting IL-17A, secukinumab has shown excellent efficacy in psoriasis by normalizing skin histology and was approved by the United States Food and Drug Administration on January 21, 2015 to treat adults with moderate-to-severe plaque psoriasis. Protein structure Protein chemical formula C6584H10134N1754O2042S44 Protein average weight 147940.0 Da Sequences https://www.drugbank.ca/drugs/DB09029 1/11 2/22/2018 Secukinumab - DrugBank > Secukinumab Heavy Chain (CAS 875356-43-7) EVQLVESGGGLVQPGGSLRLSCAASGFTFSNYWMNWVRQAPGKGLEWVAAINQDGSEKYY VGSVKGRFTISRDNAKNSLYLQMNSLRVEDTAVYYCVRDYYDILTDYYIHYWYFDLWGRG TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL -
September 2017 ~ Resource #330909
−This Clinical Resource gives subscribers additional insight related to the Recommendations published in− September 2017 ~ Resource #330909 Medications Stored in the Refrigerator (Information below comes from current U.S. and Canadian product labeling and is current as of date of publication) Proper medication storage is important to ensure medication shelf life until the manufacturer expiration date and to reduce waste. Many meds are recommended to be stored at controlled-room temperature. However, several meds require storage in the refrigerator or freezer to ensure stability. See our toolbox, Medication Storage: Maintaining the Cold Chain, for helpful storage tips and other resources. Though most meds requiring storage at temperatures colder than room temperature should be stored in the refrigerator, expect to see a few meds require storage in the freezer. Some examples of medications requiring frozen storage conditions include: anthrax immune globulin (Anthrasil [U.S. only]), carmustine wafer (Gliadel [U.S. only]), cholera (live) vaccine (Vaxchora), dinoprostone vaginal insert (Cervidil), dinoprostone vaginal suppository (Prostin E2 [U.S.]), varicella vaccine (Varivax [U.S.]; Varivax III [Canada] can be stored in the refrigerator or freezer), zoster vaccine (Zostavax [U.S.]; Zostavax II [Canada] can be stored in the refrigerator or freezer). Use the list below to help identify medications requiring refrigerator storage and become familiar with acceptable temperature excursions from recommended storage conditions. Abbreviations: RT = room temperature Abaloparatide (Tymlos [U.S.]) Aflibercept (Eylea) Amphotericin B (Abelcet, Fungizone) • Once open, may store at RT (68°F to 77°F • May store at RT (77°F [25°C]) for up to Anakinra (Kineret) [20°C to 25°C]) for up to 30 days. -
Asthma Agents
APPROVED PA Criteria Initial Approval Date: July 10, 2019 Revised Date: January 20, 2021 CRITERIA FOR PRIOR AUTHORIZATION Asthma Agents BILLING CODE TYPE For drug coverage and provider type information, see the KMAP Reference Codes webpage. MANUAL GUIDELINES Prior authorization will be required for all current and future dose forms available. All medication-specific criteria, including drug-specific indication, age, and dose for each agent is defined in Table 1 below. Benralizumab (Fasenra®) Dupilumab (Dupixent®) Mepolizumab (Nucala®) Omalizumab (Xolair®) Reslizumab (Cinqair®) GENERAL CRITERIA FOR INITIAL PRIOR AUTHORIZATION: (must meet all of the following) • Must be approved for the indication, age, and not exceed dosing limits listed in Table 1. • Must be prescribed by or in consultation with a pulmonologist, allergist, or immunologist.1,2 • For all agents listed, the preferred PDL drug, which treats the PA indication, is required unless the patient meets the non-preferred PDL PA criteria. • Must have experienced ≥ 2 exacerbations within the last 12 months despite meeting all of the following (exacerbation is defined as requiring the use of oral/systemic corticosteroids, urgent care/hospital admission, or intubation: o Patient adherence to two long-term controller medications, including a high-dose inhaled corticosteroid 1,2 (ICS) and a long-acting beta2-agonist (LABA) listed in Table 2. ▪ Combination ICS/LABA and ICS/LABA/LAMA products meet the requirement of two controller medications. o Patient must have had an adequate trial (at least 90 consecutive days) of a leukotriene modifier or a long-acting muscarinic antagonist (LAMA) as a third long-term controller medication listed in Table 2.