DOCSLIB.ORG

Cell Adhesion: a FERM Grasp of the Tail Sorts out Integrins

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Cell Adhesion: a FERM Grasp of the Tail Sorts out Integrins Current Biology Vol 22 No 17 R692 and how the cell integrates them with 5. Nott, A., Jung, H.S., Koussevitzky, S., and retrograde pathway that functions in drought Chory, J. (2006). Plastid-to-nucleus retrograde and high light signaling in Arabidopsis. Plant one another and other cell/organelle signaling. Annu. Rev. Plant Biol. 57, 739–759. Cell 23, 3992–4012. functions. Answering these questions 6. Koussevitzky, S., Nott, A., Mockler, T.C., 15. Grieshaber, N.A., Fischer, E.R., Mead, D.J., will likely be a challenge considering Hong, F., Sachetto-Martins, G., Surpin, M., Dooley, C.A., and Hackstadt, T. (2004). Lim, J., Mittler, R., and Chory, J. (2007). Chlamydial histone-DNA interactions are that many of the biosynthetic pathways Signals from chloroplasts converge to regulate disrupted by a metabolite in the involved are essential, which limits our nuclear gene expression. Science 316, methylerythritol phosphate pathway of 715–719. isoprenoid biosynthesis. Proc. Natl. Acad. Sci. ability to generate loss-of-function 7. Susek, R.E., Ausubel, F.M., and Chory, J. USA 101, 7451–7456. mutants. Furthermore, the essential (1993). Signal transduction mutants of 16. Grieshaber, N.A., Sager, J.B., Dooley, C.A., and integrated nature of the plastid Arabidopsis uncouple nuclear CAB and RBCS Hayes, S.F., and Hackstadt, T. (2006). gene expression from chloroplast Regulation of the Chlamydia trachomatis leads to pleiotropic affects when its development. Cell 74, 787–799. histone H1-like protein Hc2 is IspE dependent function is compromised, which can 8. Woodson, J.D., Perez-Ruiz, J.M., and Chory, J. and IhtA independent. J. Bacteriol. 188, (2011). Heme synthesis by plastid 5289–5292. lead to unclear or ambiguous results. ferrochelatase I regulates nuclear gene 17. Ramel, F., Birtic, S., Ginies, C., Soubigou- Nonetheless, it is now clear that plastid expression in plants. Curr. Biol. 21, 897–903. Taconnat, L., Triantaphylides, C., and retrograde signals control important 9. Thomas, J., and Weinstein, J.D. (1990). Havaux, M. (2012). Carotenoid oxidation Measurement of heme efflux and heme content products are stress signals that mediate gene and specific events in cell physiology in isolated developing chloroplasts. Plant responses to singlet oxygen in plants. Proc. and these studies will provide useful Physiol. 94, 1414–1423. Natl. Acad. Sci. USA 109, 5535–5540. 10. Zhang, L., and Hach, A. (1999). Molecular 18. op den Camp, R.G., Przybyla, D., tools to unravel their mechanisms. mechanism of heme signaling in yeast: the Ochsenbein, C., Laloi, C., Kim, C., Danon, A., transcriptional activator Hap1 serves as the Wagner, D., Hideg, E., Gobel, C., Feussner, I., key mediator. Cell Mol. Life Sci. 56, 415–426. et al. (2003). Rapid induction of distinct References 11. Leister, D. (2012). Retrograde signaling in stress responses after the release of singlet 1. Barbrook, A.C., Howe, C.J., and Purton, S. plants: from simple to complex scenarios. oxygen in Arabidopsis. Plant Cell 15, (2006). Why are plastid genomes retained in Front. Plant Sci. 3, 135. 2320–2332. non-photosynthetic organisms? Trends Plant 12. Xiao, Y., Savchenko, T., Baidoo, E.E., 19. Wagner, D., Przybyla, D., Op den Camp, R., Sci. 11, 101–108. Chehab, W.E., Hayden, D.M., Tolstikov, V., Kim, C., Landgraf, F., Lee, K.P., Wursch, M., 2. Martin, W., Rujan, T., Richly, E., Hansen, A., Corwin, J.A., Kliebenstein, D.J., Keasling, J.D., Laloi, C., Nater, M., Hideg, E., et al. (2004). The Cornelsen, S., Lins, T., Leister, D., Stoebe, B., and Dehesh, K. (2012). Retrograde signaling by genetic basis of singlet oxygen-induced stress Hasegawa, M., and Penny, D. (2002). the plastidial metabolite MEcPP regulates responses of Arabidopsis thaliana. Science Evolutionary analysis of Arabidopsis, expression of nuclear stress-response genes. 306, 1183–1185. cyanobacterial, and chloroplast genomes Cell 149, 1525–1535. reveals plastid phylogeny and thousands of 13. Wilson, P.B., Estavillo, G.M., Field, K.J., cyanobacterial genes in the nucleus. Proc. Natl. Pornsiriwong, W., Carroll, A.J., Howell, K.A., 1Plant Biology Laboratory, 2Howard Hughes Acad. Sci. USA 99, 12246–12251. Woo, N.S., Lake, J.A., Smith, S.M., Harvey Medical Institute, The Salk Institute, 3. Pogson, B.J., Woo, N.S., Forster, B., and Millar, A., et al. (2009). The nucleotidase/ Small, I.D. (2008). Plastid signalling to the phosphatase SAL1 is a negative regulator of 10010 North Torrey Pines Road, La Jolla, nucleus and beyond. Trends Plant Sci. 13, drought tolerance in Arabidopsis. Plant J. 58, CA 92037, USA. 602–609. 299–317. E-mail: [email protected], [email protected] 4. Woodson, J.D., and Chory, J. (2008). 14. Estavillo, G.M., Crisp, P.A., Pornsiriwong, W., Coordination of gene expression between Wirtz, M., Collinge, D., Carrie, C., Giraud, E., organellar and nuclear genomes. Nat. Rev. Whelan, J., David, P., Javot, H., et al. (2011). Genet. 9, 383–395. Evidence for a SAL1-PAP chloroplast http://dx.doi.org/10.1016/j.cub.2012.07.028 Cell Adhesion: A FERM Grasp of the from conformations with relatively low affinity for ECM ligands to those Tail Sorts Out Integrins with high affinity. This transition is controlled by the binding of the FERM (4.1, ezrin, radixin, moesin) As well as modulating integrin activation, a conserved NPxY motif in integrin domain from the protein talin to cytoplasmic tails that binds the FERM-domain-containing proteins kindlin a membrane-proximal NPxY motif and sorting nexin 17 plays pivotal roles in integrin recycling and degradation. in the short cytoplasmic tail of the integrin b subunit [4]. Nina N. Brahme migration, embryonic development, More recently, human disease and David A. Calderwood* tissue formation, vasculogenesis, mutations and knockout studies have inflammatory and immune responses, implicated a second family of The ability of metazoan cells to and wound healing [1]. Like other FERM-domain proteins, the kindlins, in sense and adhere to the insoluble cell-surface receptors, integrins integrin activation [5–7]. Kindlins bind extracellular matrix (ECM) that can be regulated by controlling to the b integrin cytoplasmic tail, surrounds them is central to cell-surface delivery, endocytosis, specifically to the membrane-distal multicellular life. Integrins, the major and subsequent recycling or NPxY motif and its preceding family of ECM adhesion receptors degradation. Indeed, the importance threonines (Figure 1), and kindlin responsible for this ability, are of integrin internalization and recycling deficiency leads to defects in integrin transmembrane ab heterodimers that in a range of cellular processes is activation and signaling. However, the link the ECM to intracellular increasingly well appreciated [2,3]. molecular basis for kindlin function is cytoskeletal and signaling networks. However, a unique and defining feature not understood. In this issue of Current Integrins are thus integral to a range of integrin regulation is integrin Biology, Margadant et al. [8] provide of essential processes, including cell activation — the allosteric transition new insights into the differential roles Dispatch R693 of talin and kindlin in b1 integrin Talin Kindlin A regulation and for the first time link 1A: KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK kindlins to the control of lysosomal Sorting nexin-17 degradation of integrins. Using alternative approaches, two other B Active Inactive recent papers [9,10] also reveal a role integrin integrin for the kindlin-binding NPxY motif in 1 determining whether integrins are 5 lysosomally degraded or are recycled to the cell surface. However, these investigators find that binding of the Talin FERM-domain-containing protein Kindlin sorting nexin 17 (SNX17) triggers recycling versus degradation. While many details remain to be elucidated, Early endosome and discrepancies resolved, taken together all three new papers suggest that the dynamics of FERM-domain binding to integrin NPxY motifs govern Recycling not only activation but also recycling endosome and degradation. Understanding how this occurs, if and how the processes SNX17 are linked, and how FERM-domain binding and competition are regulated will be the next challenges. Margadant et al. [8] investigated the Lysosome Current Biology roles of the talin- and kindlin-binding sites in b1 integrin activation and trafficking by reconstituting Figure 1. b-tail-binding proteins in integrin activation and sorting. embryoid-body-derived b1 (A) Amino acid sequence of the cytoplasmic tail of human b1 integrin. Regions important for integrin-null cells with wild-type b1or binding talin, kindlin and sorting nexin 17 (SNX17) are indicated, and key residues that were b mutated to disrupt these interactions are highlighted in red. (B) Model for regulation of integrin with 1 containing tyrosine to alanine activation and trafficking. Binding of talin and kindlin leads to integrin activation at the plasma mutations in the membrane-proximal membrane. Internalization leads to dissociation of talin and kindlin from integrin. SNX17 binds or membrane-distal NxxY motifs. integrins in early endosomes and, by an unknown mechanism, facilitates their recycling: integ- As expected, mutations in the rins unable to bind SNX17 are targeted for lysosomal degradation. Kindlin’s role in integrin talin-binding membrane-proximal trafficking remains controversial but kindlin and SNX17 can compete for binding to integrin NPxY motif result in defects in cell and they do not colocalize in the same subcellular compartment. Whether other tail-binding proteins regulate additional
Load more

Recommended publications
  • Sorting Nexin 27 Regulates the Lysosomal Degradation of Aquaporin-2 Protein in the Kidney Collecting Duct
    cells Article Sorting Nexin 27 Regulates the Lysosomal Degradation of Aquaporin-2 Protein in the Kidney Collecting Duct Hyo-Jung Choi 1,2, Hyo-Ju Jang 1,3, Euijung Park 1,3, Stine Julie Tingskov 4, Rikke Nørregaard 4, Hyun Jun Jung 5 and Tae-Hwan Kwon 1,3,* 1 Department of Biochemistry and Cell Biology, School of Medicine, Kyungpook National University, Taegu 41944, Korea; [email protected] (H.-J.C.); [email protected] (H.-J.J.); [email protected] (E.P.) 2 New Drug Development Center, Daegu-Gyeongbuk Medical Innovation Foundation, Taegu 41061, Korea 3 BK21 Plus KNU Biomedical Convergence Program, Department of Biomedical Science, School of Medicine, Kyungpook National University, Taegu 41944, Korea 4 Department of Clinical Medicine, Aarhus University, Aarhus 8200, Denmark; [email protected] (S.J.T.); [email protected] (R.N.) 5 Division of Nephrology, Department of Medicine, Johns Hopkins University School of Medicine, Baltimore, MD 21205, USA; [email protected] * Correspondence: [email protected]; Tel.: +82-53-420-4825; Fax: +82-53-422-1466 Received: 30 March 2020; Accepted: 11 May 2020; Published: 13 May 2020 Abstract: Sorting nexin 27 (SNX27), a PDZ (Postsynaptic density-95/Discs large/Zonula occludens 1) domain-containing protein, cooperates with a retromer complex, which regulates intracellular trafficking and the abundance of membrane proteins. Since the carboxyl terminus of aquaporin-2 (AQP2c) has a class I PDZ-interacting motif (X-T/S-X-F), the role of SNX27 in the regulation of AQP2 was studied. Co-immunoprecipitation assay of the rat kidney demonstrated an interaction of SNX27 with AQP2.
    [Show full text]
  • Molecular Evolutionary Analysis of Plastid Genomes in Nonphotosynthetic Angiosperms and Cancer Cell Lines
    The Pennsylvania State University The Graduate School Department or Biology MOLECULAR EVOLUTIONARY ANALYSIS OF PLASTID GENOMES IN NONPHOTOSYNTHETIC ANGIOSPERMS AND CANCER CELL LINES A Dissertation in Biology by Yan Zhang 2012 Yan Zhang Submitted in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Dec 2012 The Dissertation of Yan Zhang was reviewed and approved* by the following: Schaeffer, Stephen W. Professor of Biology Chair of Committee Ma, Hong Professor of Biology Altman, Naomi Professor of Statistics dePamphilis, Claude W Professor of Biology Dissertation Adviser Douglas Cavener Professor of Biology Head of Department of Biology *Signatures are on file in the Graduate School iii ABSTRACT This thesis explores the application of evolutionary theory and methods in understanding the plastid genome of nonphotosynthetic parasitic plants and role of mutations in tumor proliferations. We explore plastid genome evolution in parasitic angiosperms lineages that have given up the primary function of plastid genome – photosynthesis. Genome structure, gene contents, and evolutionary dynamics were analyzed and compared in both independent and related parasitic plant lineages. Our studies revealed striking similarities in changes of gene content and evolutionary dynamics with the loss of photosynthetic ability in independent nonphotosynthetic plant lineages. Evolutionary analysis suggests accelerated evolution in the plastid genome of the nonphotosynthetic plants. This thesis also explores the application of phylogenetic and evolutionary analysis in cancer biology. Although cancer has often been likened to Darwinian process, very little application of molecular evolutionary analysis has been seen in cancer biology research. In our study, phylogenetic approaches were used to explore the relationship of several hundred established cancer cell lines based on multiple sequence alignments constructed with variant codons and residues across 494 and 523 genes.
    [Show full text]
  • Cytoskeleton Cytoskeleton
    CYTOSKELETON CYTOSKELETON The cytoskeleton is composed of three principal types of protein filaments: actin filaments, intermediate filaments, and microtubules, which are held together and linked to subcellular organelles and the plasma membrane by a variety of accessory proteins Muscle Contraction • Skeletal muscles are bundles of muscle fibers • Most of the cytoplasm consists of myofibrils, which are cylindrical bundles of two types of filaments: thick filaments of myosin (about 15 run in diameter) and thin filaments of actin (about 7 nm in diameter). • Each myofibril is organized as a chain of contractile units called sarcomeres, which are responsible for the striated appearance of skeletal and cardiac muscle. Structure of muscle cells Sarcomere • The ends of each sarcomere are defined by the Z disc. • Within each sarcomere, dark bands (called A bands because they are anisotropic when viewed with polarized light) alternate with light bands (called I bands for isotropic). • The I bands contain only thin (actin) filaments, whereas the A bands contain thick (myosin) filaments. • The myosin and actin filaments overlap in peripheral regions of the A band, whereas a middle region (called the H zone) contains only myosin. Muscle contraction • The basis for understanding muscle contraction is the sliding filament model, first proposed in 1954 both by Andrew Huxley and Ralph Niedergerke and by Hugh Huxley and Jean Hanson • During muscle contraction each sarcomere shortens, bringing the Z discs closer together. • There is no change in the width of the A band, but both the I bands and the H zone almost completely disappear. • These changes are explained by the actin and myosin filaments sliding past one another so that the actin filaments move into the A band and H zone.
    [Show full text]
  • Sorting Nexin-27 Regulates AMPA Receptor Trafficking Through The
    RESEARCH ARTICLE Sorting nexin-27 regulates AMPA receptor trafficking through the synaptic adhesion protein LRFN2 Kirsty J McMillan1†*, Paul J Banks2†, Francesca LN Hellel1, Ruth E Carmichael1, Thomas Clairfeuille3, Ashley J Evans1, Kate J Heesom4, Philip Lewis4, Brett M Collins3, Zafar I Bashir2, Jeremy M Henley1, Kevin A Wilkinson1*, Peter J Cullen1* 1School of Biochemistry, University of Bristol, Bristol, United Kingdom; 2School of Physiology, Pharmacology and Neuroscience, University of Bristol, Bristol, United Kingdom; 3Institute for Molecular Bioscience, The University of Queensland, Queensland, Australia; 4Proteomics facility, School of Biochemistry, University of Bristol, Bristol, United Kingdom Abstract The endosome-associated cargo adaptor sorting nexin-27 (SNX27) is linked to various neuropathologies through sorting of integral proteins to the synaptic surface, most notably AMPA receptors. To provide a broader view of SNX27-associated pathologies, we performed proteomics in rat primary neurons to identify SNX27-dependent cargoes, and identified proteins linked to excitotoxicity, epilepsy, intellectual disabilities, and working memory deficits. Focusing on the *For correspondence: synaptic adhesion molecule LRFN2, we established that SNX27 binds to LRFN2 and regulates its [email protected] endosomal sorting. Furthermore, LRFN2 associates with AMPA receptors and knockdown of (KJMM); LRFN2 results in decreased surface AMPA receptor expression, reduced synaptic activity, and [email protected] attenuated hippocampal long-term potentiation. Overall, our study provides an additional (KAW); mechanism by which SNX27 can control AMPA receptor-mediated synaptic transmission and [email protected] (PJC) plasticity indirectly through the sorting of LRFN2 and offers molecular insight into the perturbed †These authors contributed function of SNX27 and LRFN2 in a range of neurological conditions.
    [Show full text]
  • Ciliary Dyneins and Dynein Related Ciliopathies
    cells Review Ciliary Dyneins and Dynein Related Ciliopathies Dinu Antony 1,2,3, Han G. Brunner 2,3 and Miriam Schmidts 1,2,3,* 1 Center for Pediatrics and Adolescent Medicine, University Hospital Freiburg, Freiburg University Faculty of Medicine, Mathildenstrasse 1, 79106 Freiburg, Germany; [email protected] 2 Genome Research Division, Human Genetics Department, Radboud University Medical Center, Geert Grooteplein Zuid 10, 6525 KL Nijmegen, The Netherlands; [email protected] 3 Radboud Institute for Molecular Life Sciences (RIMLS), Geert Grooteplein Zuid 10, 6525 KL Nijmegen, The Netherlands * Correspondence: [email protected]; Tel.: +49-761-44391; Fax: +49-761-44710 Abstract: Although ubiquitously present, the relevance of cilia for vertebrate development and health has long been underrated. However, the aberration or dysfunction of ciliary structures or components results in a large heterogeneous group of disorders in mammals, termed ciliopathies. The majority of human ciliopathy cases are caused by malfunction of the ciliary dynein motor activity, powering retrograde intraflagellar transport (enabled by the cytoplasmic dynein-2 complex) or axonemal movement (axonemal dynein complexes). Despite a partially shared evolutionary developmental path and shared ciliary localization, the cytoplasmic dynein-2 and axonemal dynein functions are markedly different: while cytoplasmic dynein-2 complex dysfunction results in an ultra-rare syndromal skeleto-renal phenotype with a high lethality, axonemal dynein dysfunction is associated with a motile cilia dysfunction disorder, primary ciliary dyskinesia (PCD) or Kartagener syndrome, causing recurrent airway infection, degenerative lung disease, laterality defects, and infertility. In this review, we provide an overview of ciliary dynein complex compositions, their functions, clinical disease hallmarks of ciliary dynein disorders, presumed underlying pathomechanisms, and novel Citation: Antony, D.; Brunner, H.G.; developments in the field.
    [Show full text]
  • Erdj4 Protein Is a Soluble Endoplasmic Reticulum (ER) Dnaj
    Supplemental Material can be found at: http://www.jbc.org/content/suppl/2012/01/20/M111.311290.DC1.html THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 287, NO. 11, pp. 7969–7978, March 9, 2012 © 2012 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A. ERdj4 Protein Is a Soluble Endoplasmic Reticulum (ER) DnaJ Family Protein That Interacts with ER-associated Degradation Machinery*□S Received for publication, October 6, 2011, and in revised form, January 5, 2012 Published, JBC Papers in Press, January 20, 2012, DOI 10.1074/jbc.M111.311290 Chunwei Walter Lai‡1,2, Joel H. Otero§1,3, Linda M. Hendershot§3, and Erik Snapp‡4 From the ‡Department of Anatomy & Structural Biology, Albert Einstein College of Medicine, Bronx, New York 10461 and the §Department of Tumor Cell Biology, St. Jude Children’s Research Hospital, Memphis, Tennessee 38105 Background: ERdj4 is an endoplasmic reticulum chaperone co-factor that assists with destruction of misfolded secretory proteins. Results: ERdj4 is a mobile soluble luminal protein that is recruited to the misfolded secretory protein quality control machinery. Conclusion: The role of ERdj4 in secretory protein destruction is specified by association with the degradation machinery. Downloaded from Significance: These studies provide a new insight into how different ERdj family members regulate the fates of their clients. Protein localization within cells regulates accessibility for strates reflects a combination of subcellular localization, abun- interactions with co-factors and substrates. The endoplasmic dance, and the mobilities of both the protein and its substrates. reticulum (ER) BiP co-factor ERdj4 is up-regulated by ER stress For example, a freely and rapidly diffusing protein can readily www.jbc.org and has been implicated in ER-associated degradation (ERAD) encounter a substrate, even if the substrate is relatively immo- of multiple unfolded secretory proteins.
    [Show full text]
  • Cytoskeleton
    Cytoskeleton B. Balen Importance and function structural backbone of the cell → supports the fragile plasma membrane → provides mechanical linkages that let the cell bear stresses without being ripped apart defines cellular shape and general organization of the cytoplasm responsible for all cellular movements → movements of the whole cell - sperm to swim - fibroblasts and white blood cell to crawl → internal transport of organelles and other structures dynamic and adaptable structure → it permanently reorganizes which is dependent on cell movements and changes in cell shape Three types of cytoskeletal filaments microtubules actin filaments • actin filaments (5-9 nm) – determine the shape of cell’s surface and whole cell locomotion • intermediate filaments (~ 10 nm) – provide mechanical strength • microtubules (25 nm) – determine the positions of organelles and direct intracellular transport Figure 16-1 Molecular Biology of the Cell (© Garland Science 2008) Actin filaments (microfilaments) protein actin → polymerization → actin filaments (thin and flexible) diameter 5 - 9 nm; length up to several µm Actin filaments can be organized into more complex structures: → linear bundles → 2D-networks → 3D-gels most highly concentrated just beneath the plasma membrane → cell cortex → network for mechanical support → cell shape → movements of the cell surface Actin and actin filaments actin was isolated from the muscle cell in 1942. present in all eukaryotic cells yeast – only 1 actin gene other eukaryotes – actin gene family (mammals 6 genes) → all actins have similar amino acid sequence → highly conserved during the evolution individual molecules → globular proteins of 375 aa (43 kDa) polymerization of globular proteins → assembly of actin filaments Assembly of actin filaments actin monomer – globular [G] actin → has two binding sites for other 2 monomers after polymerization – filament [F] actin each monomer in filament is rotated for 166º → two-stranded helical polymers each monomer has the same orientation → filament polarity (plus and minus end) 2002.
    [Show full text]
  • Interaction of the Wiskott–Aldrich Syndrome Protein with Sorting Nexin 9 Is Required for CD28 Endocytosis and Cosignaling in T Cells
    Interaction of the Wiskott–Aldrich syndrome protein with sorting nexin 9 is required for CD28 endocytosis and cosignaling in T cells Karen Badour*, Mary K. H. McGavin*, Jinyi Zhang*, Spencer Freeman*, Claudia Vieira*, Dominik Filipp†, Michael Julius†, Gordon B. Mills‡, and Katherine A. Siminovitch*§ *Departments of Medicine, Immunology, Medical Genetics, and Microbiology, University of Toronto, Toronto General Hospital and Samuel Lunenfeld Research Institutes, Mount Sinai Hospital, Toronto, ON, Canada M5G 1X5; †Department of Immunology, University of Toronto, Sunnybrook Research Institute, Toronto, ON, Canada M4N 3M5; and ‡Department of Molecular Therapeutics, University of Texas M. D. Anderson Cancer Center, Houston, TX 77030 Communicated by Louis Siminovitch, Mount Sinai Hospital, Toronto, ON, Canada, December 1, 2006 (received for review October 4, 2006) The Wiskott–Aldrich syndrome protein (WASp) plays a major role coupling WASp to CD2 receptors and actin polymerization at the in coupling T cell antigen receptor (TCR) stimulation to induction of immune synapse (5). WASp effects on T cell behaviors thus are actin cytoskeletal changes required for T cell activation. Here, we mediated via interactions with multiple upstream binding partners report that WASp inducibly binds the sorting nexin 9 (SNX9) in T that activate and redistribute WASp so as to transduce TCR cells and that WASp, SNX9, p85, and CD28 colocalize within stimulatory signals to actin cytoskeletal rearrangement. clathrin-containing endocytic vesicles after TCR/CD28 costimula- WASp deficiency is also associated with impaired T cell response tion. SNX9, implicated in clathrin-mediated endocytosis, binds to TCR/CD28 costimulation (3). CD28 costimulatory signals, trig- WASp via its SH3 domain and uses its PX domain to interact gered by binding to B7 ligand on antigen-presenting cells, are key with the phosphoinositol 3-kinase regulatory subunit p85 and to the activation of resting naı¨ve T cells, enabling sustained acti- product, phosphoinositol (3,4,5)P3.
    [Show full text]
  • Genetic Compartmentalization in the Complex Plastid of Amphidinium Carterae
    Genetic compartmentalization in the complex plastid of Amphidinium carterae and The endomembrane system (ES) in Phaeodactylum tricornutum Dissertation zur Erlangung des Doktorgrades der Naturwissenschaften (Dr. rer. nat.) Vorgelegt dem Fachbereich Biologie der Philipps-Universität Marburg FB 17 – Biologie, Zellbiologie von Xiaojuan Liu aus Fujian, China Marburg/Lahn 2015 Vom Fachbereich Biologie der Philipps-Universität Marburg als Dissertation angenommen am: 2015 Erstgutachter: Prof. Dr. Uwe-G. Maier Zweitgutachterin: Prof. Dr. Ralf Jacob Prof. Dr. Andrea Maisner Prof. Dr. Susanne Önel Tag der Disputation am: 2015 Publications X. liu, F. Hempel, S. Stork, K. Bolte, D. Moog, T. Heimerl, UG. Maier, S. Zauner (2015). Addressing various compartments via sub-cellular marker proteins of the diatom model organism Phaeodactylum tricornutum. Algal Research. In preparation. In preparation: X. liu, C. Grosche, UG. Maier, S. Zauner (2015). Isolation of individual minicircles via a novel transposon-insertion based approach in Amphidinium carterae. Forthcoming. Contents Summary ................................................................................................................................................. 1 Zusammenfassung ................................................................................................................................... 2 Abbreviations .......................................................................................................................................... 3 Figures and Tables ..................................................................................................................................
    [Show full text]
  • New Tools for Old Organelles
    New tools for old organelles Bioinformatics for comparative cell biology Marc Gouw Dissertation presented to obtain the Ph.D degree in Bioinformatics Instituto de Tecnologia Química e Biológica António Xavier | Universidade Nova de Lisboa Oeiras, July, 2015 New tools for old organelles Bioinformatics for comparative cell biology Marc Gouw Dissertation presented to obtain the Ph.D degree in Evolutionary Biology Instituto de Tecnologia Química e Biológica António Xavier | Universidade Nova de Lisboa Research work coordinated by: Oeiras July, 2015 Acknowledgments This thesis and the years of work and inspiration put into it would not have been possible without the help of many people. First of all, I just generally want to thank everyone for being so great. Especially those who in any way contributed to making the past few years in Portugal and at the IGC such a wonderful experience: without all of you, my life and this thesis would have turned out very different indeed. A special thanks to all of the past and present members of the Computational Genomics Laboratory, who have always been kind enough to be unforgivingly critical of my work, and equally enthusiastic to go enjoy a beer on a Friday afternoon. And especially Beatriz Ferreira Gomes and Yoan Diekmann, who were essential to my PhD project: You have been truly inspiring collogues and close friends. A lot of this work would not have been possible without you. The epic mtoc-explorer.org, and indeed this thesis would also not have been possible without Renato Alves. I blame you, your programming genius and incredible patience for teaching me so much.
    [Show full text]
  • The Sorting Nexin 3 Retromer Pathway Regulates the Cell Surface Localization and Activity of a Wnt- Activated Polycystin Channel Complex
    BASIC RESEARCH www.jasn.org The Sorting Nexin 3 Retromer Pathway Regulates the Cell Surface Localization and Activity of a Wnt- Activated Polycystin Channel Complex † ‡ † Shuang Feng,* Andrew J. Streets,* Vasyl Nesin, Uyen Tran, Hongguang Nie, † ‡ † Marta Onopiuk, Oliver Wessely, Leonidas Tsiokas, and Albert C.M. Ong* *Kidney Genetics Group, Academic Nephrology Unit and the Bateson Centre, Department of Infection, Immunity and Cardiovascular Disease, University of Sheffield Medical School, Sheffield, United Kingdom; †Department of Cell Biology, University of Oklahoma Health Sciences Center, Oklahoma City, Oklahoma; and ‡Department of Cellular and Molecular Medicine, Lerner Research Institute, Cleveland Clinic Foundation, Cleveland, Ohio ABSTRACT Autosomal dominant polycystic kidney disease (ADPKD) is caused by inactivating mutations in PKD1 (85%) or PKD2 (15%). The ADPKD proteins encoded by these genes, polycystin-1 (PC1) and polycystin-2 (PC2), form a plasma membrane receptor–ion channel complex. However, the mechanisms controlling the sub- cellular localization of PC1 and PC2 are poorly understood. Here, we investigated the involvement of the retromer complex, an ancient protein module initially discovered in yeast that regulates the retrieval, sorting, and retrograde transport of membrane receptors. Using yeast two-hybrid, biochemical, and cel- lular assays, we determined that PC2 binds two isoforms of the retromer-associated protein sorting nexin 3 (SNX3), including a novel isoform that binds PC2 in a direct manner. Knockdown of SNX3 or the core retromer protein VPS35 increased the surface expression of endogenous PC1 and PC2 in vitro and in vivo and increased Wnt-activated PC2-dependent whole-cell currents. These findings indicate that an SNX3- retromer complex regulates the surface expression and function of PC1 and PC2.
    [Show full text]
  • The Nexin Link and B-Tubule Glutamylation Maintain the Alignment Of
    The nexin link and B-tubule glutamylation maintain the alignment of outer doublets in the ciliary axoneme Lea Alford, Emory University Daniel Stoddard, Brandeis University Jennifer H. Li, Emory University Emily L. Hunter, Emory University Douglas Tritschler, University of Minnesota Raqual Bower, University of Minnesota Daniela Nicastro, University of Texas Southwestern Medical School Mary E. Porter, University of Minnesota Winfield Sale, Emory University Journal Title: Cytoskeleton Volume: Volume 73, Number 7 Publisher: Wiley | 2016-06-01, Pages 331-340 Type of Work: Article | Post-print: After Peer Review Publisher DOI: 10.1002/cm.21301 Permanent URL: https://pid.emory.edu/ark:/25593/s34sk Final published version: http://dx.doi.org/10.1002/cm.21301 Copyright information: © 2016 Wiley Periodicals, Inc. This is the peer reviewed version of the following article, which has been published in final form. This article may be used for non-commercial purposes in accordance with Wiley Terms and Conditions for Self-Archiving. Accessed September 28, 2021 8:29 AM EDT HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Cytoskeleton Manuscript Author (Hoboken) Manuscript Author . Author manuscript; available in PMC 2017 June 13. Published in final edited form as: Cytoskeleton (Hoboken). 2016 June ; 73(7): 331–340. doi:10.1002/cm.21301. The nexin link and B-tubule glutamylation maintain the alignment of outer doublets in the ciliary axoneme Lea M. Alford*, Daniel Stoddard^,&, Jennifer H. Li*, Emily L. Hunter*, Douglas Tritschler@, Raqual Bower@, Daniela Nicastro&, Mary E. Porter@, and Winfield S. Sale*,# *Department of Cell Biology, Emory University, 465 Whitehead Biomedical Research Building, 615 Michael Street, Atlanta, GA 30322 ^Biology Department, Brandeis University, Rosenstiel Basic Medical Science Research Center, 415 South Street, Waltham, MA 02454 @Department of Genetics, Cell Biology and Development, University of Minnesota Medical School, 6-160 Jackson Hall, 321 Church Street SE, Minneapolis, MN 55455 &Dept.
    [Show full text]