DOCSLIB.ORG

Delineation of Key Regulatory Elements Identifies Points Of

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

DELINEATION OF KEY REGULATORY ELEMENTS IDENTIFIES POINTS OF VULNERABILITY IN THE MITOGEN-ACTIVATED SIGNALING NETWORK SUPPLEMENTARY MATERIALS List of contents Supplementary Figures with legends 1. Figure S1: Distribution of primary siRNA screen data, and standardization of assay procedure. 2. Figure S2: Scatter plot of screen data. 3. Figure S3: Functional relevance of the identified targets and Calculation of residence time from PDT and cell cycle distribution. 4. Figure S4: FACS profiles for ABL1 and AKT1. Table for data in Figure 5B. 5. Figure S5: Venn diagram showing the results of the comparative analysis of other screen results 6. Figure S6: Dose response profiles for the AKT1 + ABL1 inhibitor combination for CH1, list of the 14 cell lines and their description, effect of ABL1+AKT1 inhibitor combination on increase in apoptotic cells and G1 arrest in 14 cell lines, effects of CHEK1 inhibitor on combination C1,C2 on 4 cell lines. Supplementary Tables 1. Table S1: siRNA screen results for targeted kinases and phosphatases. 2. Table S2: Gene expression status of the validated hits. 3. Table S3: Role played by identified RNAi hits in regulation of cell cycle, the effect on PDTs along with phase-specific RTs. 4. Table S4: List of molecules classified as cell cycle targets. 5. Table S5: High confidence network used for graph theory analysis. 6. Table S6: Occurrences of nodes in shortest path networks. 7. Table S7: Network file used as SNAVI background. 8. Table S8: Classification of nodes present in modules according to specificity. Legends for tables Supplementary Experimental Procedures References Figure S1 A 450 400 G1 S 350 G2 300 250 200 150 100 50 Distribution of molecules Distribution 0 -6-4-20246 Z-score 350 200 400 G1 S 300 G2 150 300 250 200 100 200 150 100 50 100 Distribution of molecules 50 0 0 0 -4 -2 0 2 4 -4-20246 -4-20246 Z-score B PLK1 GAPDH PLCg BTK PLCg CDC2A PLCg CHEK1 PLCg MET Distribution profiles of complete primary screen and western blots showing knockdown efficiency. Plotted in panel A are the mean z-scores of the replicates for the entire screen with siRNA targeting kinases and phosphatases. The graph shows the distribution of the data points for all the molecules targeted. The normal nature of the distribution curve, with minimal skewness, confirms the robustness of the screen. Panel B shows the effect of siRNA knockdown of 5 targets at 96 hours post transfection. siRNAs targeting BTK and PLK1 were used for screen standardizations. The reductions in protein levels were monitored at 24, 36, 48, 72 and 96 hours post transfection. At each of these time points cells were harvested, lysed and the levels of the respective proteins in the cytoplasm detected by Western blot analysis. Silencing of select proteins, which includes 3 validated screen hits (CHEK1, MET and CDC2A) at 96 hours after transfection is shown here. Here either GAPDH (for PLK1), or PLCg (for the remaining molecules) were also probed in parallel to serve as the loading control. The antibodies were obtained from Cell Signaling Technology. (Also refer Figure 1). Figure S2 8.00 Replicate 1 Replicate 2 G1 6.00 Chka Chka 4.00 2.00 0.00 -50 50 150 250 350 450 550 650 750 850 950 1050 1150 1250 1350 1450 1550 1650 1750 1850 1950 2050 2150 2250 -2.00 -4.00 -6.00 -8.00 6.00 Replicate 1 Replicate 2 S 4.00 Prkar1a Prkar1a 2.00 0.00 -50 50 150 250 350 450 550 650 750 850 950 1050 1150 1250 1350 1450 1550 1650 1750 1850 1950 2050 2150 2250 Z-score -2.00 -4.00 -6.00 -8.00 8.00 Replicate 1 Replicate 2 6.00 G2 4.00 2.00 0.00 -50 50 150 250 350 450 550 650 750 850 950 1050 1150 1250 1350 1450 1550 1650 1750 1850 1950 2050 2150 2250 -2.00 -4.00 MET MET -6.00 -8.00 -10.00 Molecules Scatter plot of z-scores to verify reproducibility of the primary siRNA screen Shown are the scatter plots for the two individual replicate z-scores for the three different phases. (Refer Figure 1) Figure S3 A B 100 Adenocarcinoma Gastric adenocarcinoma Lung adenocarcinoma Adenoma Adrenocortical adenoma Follicular adenoma Anaplastic astrocytoma 90 Anaplastic oligodendroma Astrocytoma Biliary tract cancer Bladder cancer Brain tumour Breast cancer 80 Breast carcinoma Cancer Lung cancer Carcinoma Ductal carcinoma Embryonal carcinoma Neuroendocrine carcinoma 70 Non small cell lung carcinoma Squomous cell carcinoma Cervical cancer/carcinoma Cholangiocarcinoma Chondrosarcoma Colon cancer Colon carcinoma 60 Colorectal cancer Colorectal carcinoma/tumor Endometrial cancer/carcinoma Epithelial tumour Esophagial carcinoma Gastric cancer/carcinoma Glioblastoma 50 Glioma Hepatocellular carcinoma Leukemia –log (P-value) Lymphocytic leukemia T cell leukemia Lung carcinoma 40 Lymphoma B cell lymphoma Non hodgkins lymphoma T cell lymphoma Mammary tumour Melanoma Metastasis 30 Metastatic melanoma Multiple tumors Myeloid leukemia Oral cancer Osteosarcoma Ovarian cancer Ovarian carcinoma 20 Pancreatic cancer Pancreatic carcinoma Primary tumor Promyelocytic leukemia Prostrate cancer Prostrate carcinoma 10 Retinoblastoma Rhabdosarcoma Sarcoma Skin cancer Solid tumors Thyroid cancer Tumors 0 Functional relevance of the identified targets and Calculation of residence time from PDT and cell cycle distribution Panel A depicts the gene-disease relationship score (indicated by the color bar) of our hits with various forms of cancer. These scores were obtained as –log (P-value) from Novoseek gene-disease database. Panel B shows the schematic to explain the method followed to calculate RT for CH1 cells after targeted siRNA mediated perturbation of screen hits. The approach is illustrated by taking the case of PLK1 as a typical example. (Refer Figure 1C and 1D) Figure S4 A # Cells B Panel A shows the histograms obtained from a cell cycle analysis of CH1 cells at 48 hours post treatment with 0.5 x IC50 of ABL1 and AKT1 inhibitor (i.e Imatinib mesylate and LY294002). The respective RTs of the G1, S and G2 phases are indicated. (Figure 5A). Panel B lists the siRNA sequences employed for silencing of the high stress and betweeness targets shown in Figure 5B. Figure S5 A B C D E Panel A shows the Venn diagram comparing the overlap of IMP nodes identified from the three different screens. Panel B shows the Venn diagram comparing the overlap of nodes from the IMP node networks of the three different screens. Panel C is the comparison between IMP nodes identified from three sets of randomly sampled source-target pairs. A very poor overlap can be observed here. Panel D is the comparison between IMP nodes identified from three sets of randomly sampled sources but retaining the target nodes to assess target biasness in IMP nodes selection. Again a very poor overlap can be observed here. Panel E is the comparison between IMP nodes identified from three sets of randomly sampled sources and the IMP nodes identified from our study in CH1. A very poor overlap can be observed here when compared to the overlap observed between U2OS and HeLa cells. Figure S6 A B G1 population Dead cells 70 70 60 AAKT1 60 AABL1 AAKT1+ABL1 50 50 40 40 30 20 % % Apoptotic cells 30 10 20 0 0.01 0.1 1 10 0.01 0.1 1 10 Dose (x IC50) C % % Apoptotic cells DE G1 % cells % G1 Δ % % Apoptotic cells Panel A depicts the dose-response profile for increase in G1 population, and increase in apoptotic cells in CH1 cells treated with pharmacological inhibitors of ABL1, AKT1 and the combination of the respective doses. Doses for each inhibitor used were in multiples of their corresponding IC50 values as indicated. Values (mean ± S.D. of three experiments) are expressed as the percent of cells obtained at 48h post treatment. (Also refer Figure 5). Panel B lists and describes all the human cell lines used in this study. In Panel C, the effect of inhibition of ABL1, AKT1 and their combination (at concentrations corresponding to 5 times their respective IC50 values) on inducing apoptosis of fourteen different human cancer cell lines is shown. Here, the cells were treated with a single addition of the inhibitor or inhibitor combination, and the frequency of apoptotic cells was determined 48h later. In all cases, results are the mean (± S.D.) of three experiments. In Panel D, cells of the indicated cancer cell lines were treated with inhibitors against either the indicated kinase, or the kinase combinations and the consequent effect on cellular apoptosis was determined 48 hours later. The concentration of the relevant inhibitor employed was five-fold greater than its corresponding IC50 value in all cases and results are the mean (± S.D.) of three experiments. The protocol followed was similar to panel C. As is evident, with the exception of Jurkat cells, apoptosis resulted from the dominant effects of CHEK1 inhibition in all cases (Refer Figure 7). Panel E depicts the increase in G1 population observed in the fourteen different human cancer cell lines following treatment with inhibitors of both ABL1 and AKT1 (at concentration corresponding to their IC50 values). Values (mean ± S.D., n=3) are those obtained at 24 h post-treatment and are expressed as increase in the percent of cells in the G1 phase, relative to that in the absence of any inhibitor (i.e. vehicle only). Table S3 Classification of hits based on RT affecting the cell cycle phases Observed Population Phenotype Total No. GO Involved Doubling (Based on of GO Cell Cycle or time increase in RT) Pubmed IDs for Cell Cycle role known Role in cell proliferation terms Proliferation Ratio Residence Time (Hours)(Hours) Std.
Recommended publications
  • Examples of Amino Acid Changes in Notothenioids Methods To

    Examples of Amino Acid Changes in Notothenioids Methods To

    Supplementary Information S1 Candidate genes: examples of amino acid changes in notothenioids Methods To evaluate notothenioid amino acid changes in a cross‐section of genes, six candidates from a range of functional categories of interest were chosen for a more detailed examination. The selected genes comprised small, well‐characterised genes present in multiple fish species (mainly teleosts, but in some cases these analyses were extended to the Actinopterygii when sequences from the spotted gar (Lepisosteus oculatus) were available) and available in at least two notothenioids. The amino acid composition of a series of six candidate genes were further analysed in depth at the amino acid sequence level. These genes were superoxide dismutase 1 (SOD1), neuroglobin, dihydrofolate reductase (both paralogues), p53 and calmodulin. Clustal X alignments were constructed from orthologues identified in the four Notothenioid transcriptomes along with other fish orthologues extracted from either SwissProt (Bateman et al., 2017) or Ensembl release 91 (Aken et al., 2017). Alignment data were visualised and annotated in BoxShade version 3.21 (https://embnet.vital‐ it.ch/software/BOX_form.html). Notothenioid‐specific changes were noted and the type of substitution in terms of amino acid properties was noted. Results A range of amino acid changes were revealed, from virtually complete conservation between the notothenioids and other fish (calmodulin), to one amino acid substitution present in neuroglobin and SOD1, to more extensive changes in dihydrofolate reductase, dihydrofolate reductase‐like and p53. In the case of the latter three genes, notothenioid‐specific changes were at positions that were often highly variable in temperate fish species with up to six different amino acid substitutions and did not result in a definable pattern of directional substitution.
  • Gene Essentiality Landscape and Druggable Oncogenic Dependencies in Herpesviral Primary Effusion Lymphoma

    Gene Essentiality Landscape and Druggable Oncogenic Dependencies in Herpesviral Primary Effusion Lymphoma

    ARTICLE DOI: 10.1038/s41467-018-05506-9 OPEN Gene essentiality landscape and druggable oncogenic dependencies in herpesviral primary effusion lymphoma Mark Manzano1, Ajinkya Patil1, Alexander Waldrop2, Sandeep S. Dave2, Amir Behdad3 & Eva Gottwein1 Primary effusion lymphoma (PEL) is caused by Kaposi’s sarcoma-associated herpesvirus. Our understanding of PEL is poor and therefore treatment strategies are lacking. To address this 1234567890():,; need, we conducted genome-wide CRISPR/Cas9 knockout screens in eight PEL cell lines. Integration with data from unrelated cancers identifies 210 genes as PEL-specific oncogenic dependencies. Genetic requirements of PEL cell lines are largely independent of Epstein-Barr virus co-infection. Genes of the NF-κB pathway are individually non-essential. Instead, we demonstrate requirements for IRF4 and MDM2. PEL cell lines depend on cellular cyclin D2 and c-FLIP despite expression of viral homologs. Moreover, PEL cell lines are addicted to high levels of MCL1 expression, which are also evident in PEL tumors. Strong dependencies on cyclin D2 and MCL1 render PEL cell lines highly sensitive to palbociclib and S63845. In summary, this work comprehensively identifies genetic dependencies in PEL cell lines and identifies novel strategies for therapeutic intervention. 1 Department of Microbiology-Immunology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. 2 Duke Cancer Institute and Center for Genomic and Computational Biology, Duke University, Durham, NC 27708, USA. 3 Department of Pathology, Feinberg School of Medicine, Northwestern University, Chicago, IL 60611, USA. Correspondence and requests for materials should be addressed to E.G. (email: [email protected]) NATURE COMMUNICATIONS | (2018) 9:3263 | DOI: 10.1038/s41467-018-05506-9 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/s41467-018-05506-9 he human oncogenic γ-herpesvirus Kaposi’s sarcoma- (IRF4), a critical oncogene in multiple myeloma33.
  • Analysis of Trans Esnps Infers Regulatory Network Architecture

    Analysis of Trans Esnps Infers Regulatory Network Architecture

    Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
  • Price List for Out-Of-State Patients (Jul 2017 – Dec 2017)

    Price List for Out-Of-State Patients (Jul 2017 – Dec 2017)

    Department of Diagnostic Genomics QEII Medical Centre PRICE LIST FOR OUT-OF-STATE PATIENTS (JUL 2017 – DEC 2017) What methods of testing do we employ? Available Methods PCR and/or Sanger DNA Sequencing for predictive testing and familial cascade screening. Targeted Massive Parallel Sequencing (MPS) panels and Sanger sequencing to analyse large genes. MLPA to detect larger deletions and duplications. MS-MLPA to detect methylation changes in addition to deletions and duplications. If you are unsure which method is appropriate for your patient, please contact us by phone on 08 6383 4223 or email on [email protected]. Who do we accept testing requests from? Requesting Clinicians Diagnostic testing can only be requested by a suitably qualified clinician – we do not provide a service direct to the public. For some tests, we will only accept requests once the patient has undergone genetic counselling from a recognised genetic counsellor, due to the clinical sensitivity of these tests. What types of sample(s) are required for testing? Sample requirements for each test are listed below. EDTA Samples Most tests will require a single 2-4mls sample of blood collected with an EDTA preservative. EDTA samples must arrive at our lab within 5 days of phlebotomy, and must be sent at room temperature. Tissue 10-50mg of tissue is required for DNA extraction DNA 1-5µg of extracted DNA (depending on test request) in place of EDTA blood Predictive Testing We recommend testing two separate EDTA blood samples collected from the patient at least 10 minutes apart. Familial Cancer and We recommend testing a second EDTA blood sample in cases where a pathogenic variant is found.
  • Functional Roles of Bromodomain Proteins in Cancer

    Functional Roles of Bromodomain Proteins in Cancer

    cancers Review Functional Roles of Bromodomain Proteins in Cancer Samuel P. Boyson 1,2, Cong Gao 3, Kathleen Quinn 2,3, Joseph Boyd 3, Hana Paculova 3 , Seth Frietze 3,4,* and Karen C. Glass 1,2,4,* 1 Department of Pharmaceutical Sciences, Albany College of Pharmacy and Health Sciences, Colchester, VT 05446, USA; [email protected] 2 Department of Pharmacology, Larner College of Medicine, University of Vermont, Burlington, VT 05405, USA; [email protected] 3 Department of Biomedical and Health Sciences, University of Vermont, Burlington, VT 05405, USA; [email protected] (C.G.); [email protected] (J.B.); [email protected] (H.P.) 4 University of Vermont Cancer Center, Burlington, VT 05405, USA * Correspondence: [email protected] (S.F.); [email protected] (K.C.G.) Simple Summary: This review provides an in depth analysis of the role of bromodomain-containing proteins in cancer development. As readers of acetylated lysine on nucleosomal histones, bromod- omain proteins are poised to activate gene expression, and often promote cancer progression. We examined changes in gene expression patterns that are observed in bromodomain-containing proteins and associated with specific cancer types. We also mapped the protein–protein interaction network for the human bromodomain-containing proteins, discuss the cellular roles of these epigenetic regu- lators as part of nine different functional groups, and identify bromodomain-specific mechanisms in cancer development. Lastly, we summarize emerging strategies to target bromodomain proteins in cancer therapy, including those that may be essential for overcoming resistance. Overall, this review provides a timely discussion of the different mechanisms of bromodomain-containing pro- Citation: Boyson, S.P.; Gao, C.; teins in cancer, and an updated assessment of their utility as a therapeutic target for a variety of Quinn, K.; Boyd, J.; Paculova, H.; cancer subtypes.
  • Knock-In Mice Limits Responses to Muramyl Dipeptide in Alters

    Knock-In Mice Limits Responses to Muramyl Dipeptide in Alters

    Blau Syndrome−Associated Nod2 Mutation Alters Expression of Full-Length NOD2 and Limits Responses to Muramyl Dipeptide in Knock-in Mice This information is current as of September 28, 2021. Jae Dugan, Eric Griffiths, Paige Snow, Holly Rosenzweig, Ellen Lee, Brieanna Brown, Daniel W. Carr, Carlos Rose, James Rosenbaum and Michael P. Davey J Immunol published online 26 November 2014 http://www.jimmunol.org/content/early/2014/11/26/jimmun Downloaded from ol.1402330 Supplementary http://www.jimmunol.org/content/suppl/2014/11/26/jimmunol.140233 http://www.jimmunol.org/ Material 0.DCSupplemental Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists by guest on September 28, 2021 • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2014 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published November 26, 2014, doi:10.4049/jimmunol.1402330 The Journal of Immunology Blau Syndrome–Associated Nod2 Mutation Alters Expression of Full-Length NOD2 and Limits Responses to Muramyl Dipeptide in Knock-in Mice Jae Dugan,*,† Eric Griffiths,* Paige Snow,* Holly Rosenzweig,*,‡,x Ellen Lee,‡ Brieanna Brown,‡ Daniel W.
  • FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet

    FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet

    Lot Number: A9C701N Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 thermofisher.com/contactus FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet Details Species Reactivity Size 100 µl Tested species reactivity Equine, Guinea Pig, Human, Mouse, Host / Isotype Rabbit IgG Rabbit, Rat Class Polyclonal Tested Applications Dilution * Type Antibody Immunohistochemistry (Paraffin) 4-8 µg/mL (IHC (P)) Immunogen Synthetic peptide directed towards the C-terminal of human FUSIP1 Western Blot (WB) 0.2-1 µg/mL Conjugate Unconjugated * Suggested working dilutions are given as a guide only. It is recommended that the user titrate the product for use in their own experiment using appropriate negative and positive controls. Form Liquid Concentration 0.5mg/mL Purification Affinity Chromatography Storage Buffer PBS with 2% sucrose Contains 0.09% sodium azide Storage Conditions -20° C, Avoid Freeze/Thaw Cycles Product Specific Information Peptide sequence: TDSKTHYKSG SRYEKESRKK EPPRSKSQSR SQSRSRSKSR SRSWTSPKSS Sequence homology: Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% Background/Target Information FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing.
  • FUSIP1 (SRSF10) (NM 006625) Human Tagged ORF Clone Product Data

    FUSIP1 (SRSF10) (NM 006625) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221759 FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Tag: Myc-DDK Symbol: SRSF10 Synonyms: FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221759 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCGCTACCTGCGTCCCCCCAACACGTCTCTGTTCGTCAGGAACGTGGCCGACGACACCAGGTCTG AAGACTTGCGGCGTGAATTTGGTCGTTATGGTCCTATAGTTGATGTGTATGTTCCACTTGATTTCTACAC TCGCCGTCCAAGAGGATTTGCTTATGTTCAATTTGAGGATGTTCGTGATGCTGAAGACGCTTTACATAAT TTGGACAGAAAGTGGATTTGTGGACGGCAGATTGAAATACAGTTTGCCCAGGGGGATCGAAAGACACCAA ATCAGATGAAAGCCAAGGAAGGGAGGAATGTGTACAGTTCTTCACGCTATGATGATTATGACAGATACAG ACGTTCTAGAAGCCGAAGTTATGAAAGGAGGAGATCAAGAAGTCGGTCTTTTGATTACAACTATAGAAGA TCGTATAGTCCTAGAAACAGTAGACCGACTGGAAGACCACGGCGTAGCAGAAGCCATTCCGACAATGATA GACCAAACTGCAGCTGGAATACCCAGTACAGTTCTGCTTACTACACTTCAAGAAAGATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221759 protein sequence Red=Cloning site Green=Tags(s) MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Estrogen-Related Receptor Alpha: an Under-Appreciated Potential Target for the Treatment of Metabolic Diseases

    Estrogen-Related Receptor Alpha: an Under-Appreciated Potential Target for the Treatment of Metabolic Diseases

    International Journal of Molecular Sciences Review Estrogen-Related Receptor Alpha: An Under-Appreciated Potential Target for the Treatment of Metabolic Diseases Madhulika Tripathi, Paul Michael Yen and Brijesh Kumar Singh * Laboratory of Hormonal Regulation, Cardiovascular and Metabolic Disorders Program, Duke-NUS Medical School, Singapore 169857, Singapore; [email protected] (M.T.); [email protected] (P.M.Y.) * Correspondence: [email protected] Received: 7 February 2020; Accepted: 24 February 2020; Published: 28 February 2020 Abstract: The estrogen-related receptor alpha (ESRRA) is an orphan nuclear receptor (NR) that significantly influences cellular metabolism. ESRRA is predominantly expressed in metabolically-active tissues and regulates the transcription of metabolic genes, including those involved in mitochondrial turnover and autophagy. Although ESRRA activity is well-characterized in several types of cancer, recent reports suggest that it also has an important role in metabolic diseases. This minireview focuses on the regulation of cellular metabolism and function by ESRRA and its potential as a target for the treatment of metabolic disorders. Keywords: estrogen-related receptor alpha; mitophagy; mitochondrial turnover; metabolic diseases; non-alcoholic fatty liver disease (NAFLD); adipogenesis; adaptive thermogenesis 1. Introduction When the estrogen-related receptor alpha (ESRRA) was first cloned, it was found to be a nuclear receptor (NR) that had DNA sequence homology to the estrogen receptor alpha (ESR1) [1]. There are several examples of estrogen-related receptor (ESRR) and estrogen-signaling cross-talk via mutual transcriptional regulation or reciprocal binding to each other’s response elements of common target genes in a context-specific manner [2,3].
  • Exploring Prostate Cancer Genome Reveals Simultaneous Losses of PTEN, FAS and PAPSS2 in Patients with PSA Recurrence After Radical Prostatectomy

    Exploring Prostate Cancer Genome Reveals Simultaneous Losses of PTEN, FAS and PAPSS2 in Patients with PSA Recurrence After Radical Prostatectomy

    Int. J. Mol. Sci. 2015, 16, 3856-3869; doi:10.3390/ijms16023856 OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Article Exploring Prostate Cancer Genome Reveals Simultaneous Losses of PTEN, FAS and PAPSS2 in Patients with PSA Recurrence after Radical Prostatectomy Chinyere Ibeawuchi 1, Hartmut Schmidt 2, Reinhard Voss 3, Ulf Titze 4, Mahmoud Abbas 5, Joerg Neumann 6, Elke Eltze 7, Agnes Marije Hoogland 8, Guido Jenster 9, Burkhard Brandt 10 and Axel Semjonow 1,* 1 Prostate Center, Department of Urology, University Hospital Muenster, Albert-Schweitzer-Campus 1, Gebaeude 1A, Muenster D-48149, Germany; E-Mail: [email protected] 2 Center for Laboratory Medicine, University Hospital Muenster, Albert-Schweitzer-Campus 1, Gebaeude 1A, Muenster D-48149, Germany; E-Mail: [email protected] 3 Interdisciplinary Center for Clinical Research, University of Muenster, Albert-Schweitzer-Campus 1, Gebaeude D3, Domagkstrasse 3, Muenster D-48149, Germany; E-Mail: [email protected] 4 Pathology, Lippe Hospital Detmold, Röntgenstrasse 18, Detmold D-32756, Germany; E-Mail: [email protected] 5 Institute of Pathology, Mathias-Spital-Rheine, Frankenburg Street 31, Rheine D-48431, Germany; E-Mail: [email protected] 6 Institute of Pathology, Klinikum Osnabrueck, Am Finkenhuegel 1, Osnabrueck D-49076, Germany; E-Mail: [email protected] 7 Institute of Pathology, Saarbrücken-Rastpfuhl, Rheinstrasse 2, Saarbrücken D-66113, Germany; E-Mail: [email protected] 8 Department
  • Downloaded from [266]

    Downloaded from [266]

    Patterns of DNA methylation on the human X chromosome and use in analyzing X-chromosome inactivation by Allison Marie Cotton B.Sc., The University of Guelph, 2005 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in The Faculty of Graduate Studies (Medical Genetics) THE UNIVERSITY OF BRITISH COLUMBIA (Vancouver) January 2012 © Allison Marie Cotton, 2012 Abstract The process of X-chromosome inactivation achieves dosage compensation between mammalian males and females. In females one X chromosome is transcriptionally silenced through a variety of epigenetic modifications including DNA methylation. Most X-linked genes are subject to X-chromosome inactivation and only expressed from the active X chromosome. On the inactive X chromosome, the CpG island promoters of genes subject to X-chromosome inactivation are methylated in their promoter regions, while genes which escape from X- chromosome inactivation have unmethylated CpG island promoters on both the active and inactive X chromosomes. The first objective of this thesis was to determine if the DNA methylation of CpG island promoters could be used to accurately predict X chromosome inactivation status. The second objective was to use DNA methylation to predict X-chromosome inactivation status in a variety of tissues. A comparison of blood, muscle, kidney and neural tissues revealed tissue-specific X-chromosome inactivation, in which 12% of genes escaped from X-chromosome inactivation in some, but not all, tissues. X-linked DNA methylation analysis of placental tissues predicted four times higher escape from X-chromosome inactivation than in any other tissue. Despite the hypomethylation of repetitive elements on both the X chromosome and the autosomes, no changes were detected in the frequency or intensity of placental Cot-1 holes.