TRIB2 monoclonal antibody (M04), serine-threonine kinases, but lacks the active site lysine clone 1B1 and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal Catalog Number: H00028951-M04 transduction pathways in a number of physiological and pathological processes. This Tribbles member induces Regulatory Status: For research use only (RUO) apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by Product Description: Mouse monoclonal antibody inflammatory stimuli in myeloid (THP-1) cells, and also raised against a partial recombinant TRIB2. as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) Clone Name: 1B1 and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. Immunogen: TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) [provided by RefSeq] partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. References: 1. TRIB2 inhibits Wnt/?-Catenin/TCF4 signaling through Sequence: its associated Ubiquitin E3 ligases, ?-TrCP, COP1 and FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREP Smurf1, in liver cancer cells. Xu S, Tong M, Huang J, SERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVP Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F FEBS DVNMEENLDPFFN Lett. 2014 Oct 11. pii: S0014-5793(14)00720-0. doi: 10.1016/j.febslet.2014.09.042. Host: Mouse 2. Ubiquitin E3 ligase SCF(?-TRCP) regulates TRIB2 Reactivity: Human stability in liver cancer cells. Qiao Y, Zhang Y, Wang J Biochem Biophys Res Commun. 2013 Nov 5. pii: Applications: ELISA, IHC-P, RNAi-Ab, S-ELISA, S0006-291X(13)01814-7. doi: WB-Re, WB-Tr 10.1016/j.bbrc.2013.10.123. (See our web site product page for detailed applications 3. Impaired phosphorylation and ubiquitination by P70 information) S6 kinase (P70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promotes Tribbles homolog 2 (TRIB2) Protocols: See our web site at stability and carcinogenic property in liver cancer. Wang http://www.abnova.com/support/protocols.asp or product J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan page for detailed protocols Q, Sun F J Biol Chem. 2013 Oct 2.
Isotype: IgG2b Lambda
Storage Buffer: In 1x PBS, pH 7.4
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 28951
Gene Symbol: TRIB2
Gene Alias: C5FW, GS3955, TRB2
Gene Summary: This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein
Page 1/1
Powered by TCPDF (www.tcpdf.org)