OR2H1 (Human) Recombinant Entrez GeneID: 26716
Protein Gene Symbol: OR2H1
Catalog Number: H00026716-G01 Gene Alias: 6M1-16, HS6M1-16, OLFR42A-9004-14, OR2H6, OR2H8, OR6-2, dJ994E9.4 Regulation Status: For research use only (RUO) Gene Summary: Olfactory receptors interact with Product Description: Human OR2H1 full-length ORF odorant molecules in the nose, to initiate a neuronal (NP_112145.1) recombinant protein without tag. response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Sequence: of G-protein-coupled receptors (GPCR) arising from MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLV single coding-exon genes. Olfactory receptors share a GNTLIILLSVLYPRLHSPMYFFLSDLSFLDLCFTTSCVP 7-transmembrane domain structure with many QMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVM neurotransmitter and hormone receptors and are AFDRYVAVCQPLHYATIIHPRLCWQLASVAWVMSLVQ responsible for the recognition and G protein-mediated SIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSY transduction of odorant signals. The olfactory receptor NEIQLAVSSVIFVVVPLSLILASYGATAQAVLRINSATAW gene family is the largest in the genome. The RKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGK nomenclature assigned to the olfactory receptor genes FFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLLGKERD and proteins for this organism is independent of other SRESWRAA organisms. [provided by RefSeq] Host: Wheat Germ (in vitro)
Theoretical MW (kDa): 35.3
Applications: AP (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Form: Liquid
Preparation Method: in vitro wheat germ expression system with proprietary liposome technology
Purification: None
Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Page 1/1
Powered by TCPDF (www.tcpdf.org)