LHX6 (Human) Recombinant Protein (Q01)

Catalog # : H00026468-Q01 規格 : [ 10 ug ] [ 25 ug ] List All

Specification Application Image

Product Human LHX6 partial ORF ( NP_055183, 274 a.a. - 363 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIES protein) QVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Antibody Production Host: Wheat Germ (in vitro) Protein Array Theoretical MW 35.64 (kDa):

Preparation in vitro wheat germ expression system Method:

Purification: Glutathione Sepharose 4 Fast Flow

Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing:

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction:

Note: Best use within three months from the date of receipt of this protein.

MSDS: Download

Datasheet: Download

Applications

Enzyme-linked Immunoabsorbent Assay

Western Blot (Recombinant protein)

Antibody Production

Protein Array Page 1 of 2 2016/5/23 Gene Information

Entrez GeneID: 26468

GeneBank NM_014368 Accession#:

Protein NP_055183 Accession#:

Gene Name: LHX6

Gene Alias: LHX6.1,MGC119542,MGC119544,MGC119545

Gene LIM homeobox 6 Description:

Omim ID: 608215

Gene Ontology: Hyperlink

Gene Summary: This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq

Other LIM homeobox protein 6,LIM homeodomain protein Designations: 6.1,OTTHUMP00000022046,OTTHUMP00000064113,OTTHUMP00000 064114,OTTHUMP00000196635

Related Disease Tobacco Use Disorder

Page 2 of 2 2016/5/23