Your community... your newspaper! Call 1-844-GNG-NEWS to renew
subscribe
PS
BEWFSUJTF today.

$1.50 Vol. 59 No. 26 • Friday, September 25, 2020

Investing in Canada Infrastructure Infrastructure projects sent for approval Fort Qu’Appelle and Balcarres projects total $1.2 million

By Chris Ashfield Grasslands News

The Government of Saskatchewan has recom- mended Fort Qu’Appelle and Balcarres for more than $1.2 million in infrastructure projects to Canada for final approval under the Investing in Canada Infra- structure Program (ICIP). If approved, the provincial and federal governments will be covering more than 70 per cent of the multi-million dollar projects. The Towns of Fort Qu’Appelle applied through the ICIP program for joint provincial and federal funding for HVAC and mechanical upgrades to the Rexentre. Costing $225,600 for the work, the grant would see Fort Qu’Appelle’s share of the work total $60,168 with the federal share being $90,240 and provincial share being $75,192. In Balcarres, the province has recommended for funding approval of $980,000 for a new well project. If approved, the town would be responsible for $261,366 of the cost while the federal and provincial shares would be $392,000 and $326,634 respectively. Province wide, close to $593 million of projects were recommended for approval through the ALAN HUSTAK | GRASSLANDS NEWS “The faster we can move ICIP program, with the Creative metal art provincial commitment Beth Grainger, left, and Marie Bill admire one of two new iron sculptures installed by Communi- these projects forward, the totaling almost $193 mil- WLHVLQ%ORRPLQWKHSODQWHUVRQ%URDGZD\DQG%RXQGDU\$YHQXHLQ)RUW4X·$SSHOOH*UDLQJHU·V lion and the federal por- faster communities, businesses ÁRULVWVSRQVRUHGWKHFDWWDLOVDQGGUDJRQÁLHVE\6WHYHDQG'HVWLQ\9DQKRYH7KHPHWDOUHGZLQJ and families will benefit.” tion close to $235 million. Of the 126 projects in blackbirds and tiger lily arrangement on the opposite corner was a gift from Conexus Credit Union - Minister Lori Carr Saskatchewan that were DQG%LOODQG0DULH%LOOZKRLQVSHFWWKHLQVWDOODWLRQZLWK&RQH[XVPDQDJHU%HY'XWKLH7KHQHZHVW forwarded for approval, ZRUNVFRPSOHWHWKHFRUQHU·VGHVLJQ7ZRRWKHUPHWDOZRUNVE\.HQ:R\WLXNZHUHLQVWDOOHGHDUOLHU $165 million would be funded by local municipalities. Other projects throughout the area recommended for funding approval include $10.8 million for Mel- ville for an expansion and upgrade to their wastewa- ter treatment system; just over $1 million to the RM Pasqua FN to build seniors’ residence of Orkney for replacement work to Grid 726; more than $1.9 million to Grenfell for a secondary lagoon upgrade; over $1.7 million to Indian Head for a swim- Construction beginning on $2.5 million facility ming pool renovation; and almost $30 million to Esterhazy for a regional water system. By Alan Hustak are at least eight elders on Pasqua on the reserve, such as the seniors’ “The faster we can move these projects forward, Grasslands News First Nation who qualify for level residence. the faster communities, businesses and families will two or level-three health care. “Our message is we want to en- benefit from them,” Government Relations Minister The project is being financed sure that what our elders did for Construction on Pasqua First with the interest from the $145-mil- us yesterday will benefit our people Lori Carr said. “Once completed, the legacy of these Nation is expected to begin this projects will improve quality of life and make our lion 1906 land claim settlement the tomorrow,” said Peigan. “This cen- week on a $2.5 million seniors’ res- great province an even better place to call home. First Nation was awarded two years tre will give people a sense of secu- idence. The provincial government encourages its federal ago by the federal government. The rity. We know that they need these Designed by KRN Tolentino Ar- counterparts to work as quickly as possible and ap- capital has been invested, and prof- second and third level services.” prove these projects.” chitecture, the lodge will allow el- its are being used to finance proj- About 70 people living on the re- It is unknown how long the approval process will ders to remain in the community ects that will improve conditions serve are 65 years or older. take but other programs have averaged anywhere instead of having to seek assisted from a couple of months to almost a year. living off the reserve. The 12 pri- The next round of ICIP grants are currently being vate suites will be like spokes accepted by the government until Oct. 30. Projects around a circular communal must be completed by the end of 2021 or 2022, depend- atrium. The building, heated with ing on the size and location of the community where solar power, also includes a lounge, it’s occurring. Projects must have a minimum total a theatre and a sauna. eligible cost of $100,000 to a maximum of $10 million. “It is designated strictly for our Under ICIP, the Government of Saskatchewan se- elders,” said Chief Todd Peigan. cured more than $896 million in federal funding over “One day I may be in there, so I 10 years to support all types of eligible infrastructure have advised my elders to design it $UWLVWVUHQGHULQJRIWKHSURSRVHGVHQLRUV·UHVLGHQFHRQ3DVTXD projects in the province. pretty good.” At the moment there 2 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Nominations now open for municipal elections in Sask.

By Elaine Ashfield in which they are quali- a population of 20,000 or Grasslands News fied to vote in a rural mu- more in a city. nicipality. Qualifications for nom- For the office of reeve, inations state: The Notice of Call for nomination papers must • is at least 18 years old Nomination for Munici- be signed by at least two on the day of the election. pal Elections 2020 are now voters of the rural munic- • is not disqualified open. ipality. pursuant to this or any Rural municipalities To seek nomination, other Act. are accepting nomina- the rules are: • is a Canadian citizen tions for the positions of • be at least 18 years old at the time that he/she Reeve and Councillors in on the day of the election. submits the nomination the odd numbered Divi- • is not disqualified paper. sions of 1, 3 and 5. pursuant to this or any • has lived in Sas- Towns and cities are other Act. katchewan for at least accepting nominations to • is a Canadian citizen six consecutive months fill the positions of Mayor at the time that he/she immediately preceding and up to six councillors. submits the nomination the date on which he/she Villages are requesting paper. submitted the nomination nominations for Mayor • has lived in Sas- paper, AND: and councillors that vary katchewan for at least • has lived in that mu- from a minimum of two to six consecutive months nicipality, or on land now four positions. immediately preceding in that municipality, for All nominations close 68%0,77('_*5$66/$1'61(:6 the date on which he/she at least three consecutive Terry Fox Run on October 7 at 4 p.m. submitted the nomination months immediately pre- Kali Smith (giving thumbs up) and Destin Kohlenberg, along with fellow Interested persons can paper, AND: ceding the date on which obtain further informa- VWXGHQWVIURP6W+HQU\·V6HQLRU6FKRROLQ0HOYLOOHSDUWLFLSDWHGLQD • lives in Saskatche- he/she submitted the tion by contacting their Terry Fox Run on Sept. 18. wan, AND nomination paper. municipal office. • is eligible to vote in Once nominations the rural municipality. close, Notice of Elections, Notice of Polls, Notice of Nomination Regulations Advance Polls and Notice Fort Qu’Appelle R-Day service goes online of Abandonment of Polls - Urban Municipalities if a candidate is elected (cities, towns and villages) Qu’Appelle this year be- poppy campaign supports purchase a wreath can do by acclamation will be By Alan Hustak Nomination papers cause of the pandemic. local veterans and their so by dropping into the published. Grasslands News must be signed by at least: There will, however, be families, the food bank Legion, or by making an Nomination Regulations - - five voters of the mu- a virtual service that will and the Sea Cadets. e-transfer to fqlegion@ The Second World War nicipality or ward (if ap- commemorate the legacy Anyone wishing to sasktel.net ended 75 years ago this Rural Municipalities plicable), in a city, town of sacrifice in the wars. It year but for the first time For the office of coun- or village with a popula- will be recorded on Nov. the usual Remembrance cillor, nomination papers tion of less than 20,000; or 4 and posted on the Le- Scam alert Day service and parade must be signed by at least - 25 voters of the mu- gion’s U-Tube channel on will not be held in Fort two voters of the division nicipality or ward with Nov. 11. As part of this year’s Sometimes great usual poppy campaign, Town of Fort Qu’Appelle the Legion needs spon- sors for the memorial 136 Boundary Avenue. - P.O. Box 309 S0G 1S0 wreaths that will be news is just a scam Phone: 306-332-5266 placed during the virtual Email: [email protected] on-line commemoration. Website: www.fortquappelle.com Money raised from the US-based company trying to sell news story plaques

PRECAUTIONARY DRINKING By Elaine Ashfield is a clear case of copy- Grasslands News right infringement by Correction TGN.” WATER ADVISORY Based out of Walling- An article published A U.S. company is September 14, 2020 ford, Connecticut, TGN on page 7 of the Septem- attempting to take ad- is becoming well known ber 11, 2020 issue of the vantage of unsuspecting  2YHUWKHFRXUVHRIWKHQH[WVHYHUDOZHHNV3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVR across Canada and the Herald Sun stated that people in the Grasslands ULHVZLOOEHLVVXHGIRUWKHDUHDVDORQJWKH%URDGZD\$YHQXHFRUULGRUDQGVRPHQHDUE\ United States for tak- Grenfell Town Council News area. VWUHHWV$VSDUWRILWVSURMHFWWRUHSODFHDJLQJLQIUDVWUXFWXUHDORQJ%URDGZD\$YHQXH ing stories that have ap- “acknowledged the pass- “We have been in- WKH7RZQLVUHSODFLQJYDOYHVDQGK\GUDQWV:DWHU6HFXULW\$JHQF\SURWRFROLVWRSODFH peared in newspapers ing of Doug Kent who formed on several oc- V\VWHPVXQGHUD3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVRU\ZKHQZDWHUYDOYHDQGK\GUDQW or online and contacting served on council from casions that a company UHSODFHPHQWUHVXOWVLQGHSUHVVXUL]DWLRQXQWLOVXFKWLPHDVWKHV\VWHPLVRSHUDWLQJZLWK customer with an offer to 1988-2006, and expressed called That’s Great News LQUHJXODWHGYDOXHVDQGZDWHULVSURYHQVDIHIRUKXPDQFRQVXPSWLYHXVH3UHFDXWLRQ purchase a plague with condolences to his fam- (TGN) has been calling DU\'ULQNLQJ:DWHU$GYLVRULHVZLOOEHLVVXHGDQGUHPDLQLQHIIHFWXQWLOWKHVDIHW\RIWKH the story and newspapers ily.” Grasslands News people who have had DIIHFWHGSRUWLRQVRIWKH7RZQRI)RUW4X·$SSHOOH·VGLVWULEXWLRQV\VWHPFDQEHHQVXUHG logo at the top. Costs for has been informed that it their stories appear in DWDOOWLPHV this keepsake are between was Don Kent who passed one of our newspapers $179 USD and $289 USD.  :KLOH3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVRULHVDUHLQHIIHFWUHVLGHQWVDQGEXVL away, not his brother and they are attempting “We want to assure QHVVHVDUHDGYLVHGWR Doug Kent. We apologize to sell them a plaque of our customers that That’s  D%RLODOOZDWHUXVHGIRUGULQNLQJSXUSRVHVIRUDWOHDVWRQH  PLQXWHDWDUROOLQJ for the mistake and wish the story,” said Chris Great News has no affil-   ERLOSULRUWRXVH Doug Kent a long and Ashfield, Publisher of iation with Grasslands  E%RLOZDWHUWREHXVHGIRURWKHUDFWLYLWLHVZKHUHLWPD\EHLQJHVWHGLQFOXGLQJ happy life. Grasslands News. “This    L%UXVKLQJWHHWKRUVRDNLQJIDOVHWHHWK News or our publications    LL:DVKLQJIUXLWVDQGYHJHWDEOHV the Melville Advance,    LLL)RRGRUGULQNZKLFKZLOOQRWEHVXEVHTXHQWO\KHDWHGDQG Fort Qu’Appelle Times    LY,FHFXEHV ST. JOHN’S or the Whitewood/Gren-  F1RWXVHWKHZDWHUIRUZDVKLQJGLVKHVXQOHVVWKHZDWHUKDVEHHQERLOHGRU fell Herald Sun,” said   WKHGLVKHVDUHVDQLWL]HGLQDQRWKHUIDVKLRQ:DVKHGGLVKHVDQGXWHQVLOVFDQ ANGLICAN CHURCH Ashfield. “What they are   EHVRDNHGLQDEOHDFKZDWHUVROXWLRQ DSSUR[LPDWHO\WDEOHVSRRQVRIEOHDFK doing is illegal through   SHUJDOORQRUPORIEOHDFKSHUOLWHURIZDWHU IRUDWOHDVWWZRPLQXWHVDIWHU copyright laws in Canada   EHLQJZDVKHGWRNLOODQ\EDFWHULDZKLFKPD\EHSUHVHQW1RWH'RQRWPL[ WORSHIP SERVICE RESUMES and we encourage people   EOHDFKZLWKVRDSVRUGHWHUJHQWV to simply hang up when  G1RWGULQNIURPDQ\SXEOLFGULQNLQJIRXQWDLQVVXSSOLHGZLWKZDWHUIURPWKH Sunday, Sept. 27 at 11:00 a.m. they receive these types   SXEOLFZDWHUVXSSO\ of call.”  H(QVXUH\RXQJHUFKLOGUHQDQGLQIDQWVDUHVSRQJHEDWKHG and continuing every week. Ashfield said that peo-  I8VHDQDOWHUQDWLYHZDWHUVRXUFHNQRZQWREHVDIHLIWKH\GRQRWZLVKWRERLO Everyone Welcome! ple who do want keepsake   WKHZDWHUDQG or back issue copies of a  J&RQVXOWZLWK\RXUSK\VLFLDQLI\RXKDYHFXWVRUUDVKHVWKDWDUHVHYHUHEHIRUH story or the page their   XVLQJWKHZDWHU Social distancing will be followed story appeared on are  8QGHUPRVWFLUFXPVWDQFHVWKHUHLVQRQHHGWRERLOZDWHUXVHGIRURWKHUKRXVHKROG 202 Bay Ave. S., Fort Qu’Appelle, SK more than welcome to SXUSRVHV$GXOWVDGROHVFHQWVDQGROGHUFKLOGUHQPD\VKRZHUEDWKHRUZDVKXVLQJ contact Grasslands News WDSZDWHUEXWVKRXOGDYRLGVZDOORZLQJWKHZDWHU/DXQGU\PD\EHZDVKHGLQWDSZDWHU Phone - 306-332-5201 toll free at 1-844-GNG- HLWKHUE\KDQGRUE\PDFKLQH NEWS (1-844-464-6397) for Hall Contact - 306-331-6720 a paper or digital copy. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 3

430 Main St. - P.O. Box 1240, Melville, SK S0A 2P0 • Phone (306) 728-6840 • Fax (306) 728-5911 :HEVLWHZZZPHOYLOOHFD PUBLIC NOTICE SEWER RELINING McGill’s Industrial Services will be relining sewers starting on Wednesday, Sept. 30, 2020 to Saturday, Oct. 3, 2020. - On 6th Avenue West from Saskatchewan Street to Queen Street (Wednesday, Sept. 30, 2020 between 8:00 a.m. to 6:00 p.m.); - On 6th Avenue West from Queen Street to Main Street (Thursday, Oct. 1, 2020 between 8:00 a.m. to 6:00 p.m.); -On Brunswick Street from 1st Avenue East to 2nd Avenue East (Friday, Oct. 2, 2020 between 8:00 a.m. to 6:00 p.m.); -On Brunswick Street from 2nd Avenue East to 3rd Avenue East (Saturday, Oct. 3, 2020 between 8:00 a.m. to 6:00 p.m.) Notices will be handed out to residents aff ected by this process prior to the day of relining with more information. While the work is being performed the sewer service connection will be temporarily sealed off . We need your cooperation to avoid back up of sewer water into your residence or business by preventing water from escaping through any drain during the specifi c time period. During this process please do not: 1. Wash clothes or dishes. 2. Take showers or baths. 3. Flush toilets. 4. Operate sump pumps which are connected to the sewer system. If any problem occurs with your sewer service during this rehabilitation process, please visit one of the on-site representatives. We apologize for any inconvenience this may cause and ask for your patience and understanding. Public Works & Planning Services P.O. Box 1240, 100 Brunswick Street Melville, SK S0A 2P0 Phone: (306) 728-6865 Website: www.melville.ca Email: [email protected]

Creative COVID classes SARAH PACIO | GRASSLANDS NEWS Dominique Baggett paints her new desk during class at Bert Fox Community ELECTION WORKERS NEEDED High School. Teacher Michael Koops designed and built the wooden worksta- WLRQVWRWHDFKVWXGHQWVDERXWÀQLVKLQJZRRGIXUQLWXUHDQGKHOSPHHW&29,' The City of Melville is seeking people interested in working the 19 physical distancing guidelines in the classroom. 2020 Municipal Election. If you are interested, please call Amber Orr at 306-728-6849 or e-mail [email protected] for more information.

Creative classes helping PUBLIC NOTICE Water Main Flushing schools through COVID The City of Melville has approximately 44km of a complex network of water lines in the City. Water lines are to be fl ushed to ensure the By Sarah Pacio ers’ creativity and resourcefulness, highest quality water possible to our residents and to maintain the Grasslands News students got personalized workstations and a project for their PAA class. integrity of the water system. Last week, teachers at Broadview This year the city will be fl ushing the West part of the city. Schools have a lot of new regulations School took advantage of sunny weather Flushing will occur between 9:30 p.m. and 5:30 a.m. to follow this fall but a little creativity and led students outdoors to partici- October 5th to October 29th. can go a long way to coping with the pate in activities that met curriculum COVID-19 pandemic. Teachers in Fort requirements and encouraged physical Qu’Appelle, Broadview, and Grenfell distancing. The Grade 1/2 class prac- are finding innovative ways to engage ticed math skills by drawing patterns students in education and encourage with chalk while sitting a suitable dis- camaraderie among classes, in spite of tance from each other along the side- physical distancing rules. walk. Students from the Grade 3/4 class As staff prepared for classes to re- independently explored the property sume at Bert Fox Community High around the school, recording character- School, teacher Michael Koops realized istics of the habitat and organisms that that the seating arrangement in the art they saw. room would not meet COVID-19 safety Grenfell High Community School requirements. The existing tables were (GHCS) initiated a “Toilet Paper Tro- large but did not allow enough space be- phy Challenge” to foster relationships tween students. Although they could be between cohorts while maintaining moved farther apart, regular desks were physical distance. “Throughout the too small for most art projects. Koops year, our students will compete in their began brainstorming alternatives with homeroom cohort through a virtual his intern, Lily Elder, and they came platform, to build a sense of commu- up with a solution that would involve nity at GHCS,” Principal Dionne Sproat During the fl ushing process, residents in the aff ected areas may Grade 9 students in the process. explained. For the first challenge, each “I said to her that maybe we need to homeroom class at the high school cre- notice low water pressure, your water may appear discolored, do make larger tables and students could ated a short music video and posted it not be alarmed. It is recommended you do not use the water or do paint them and design stencils for to the school’s social media site. Then laundry for a few hours following the fl ashing in your area, run your them,” Koops explained. “Lily thought it the Grade 4/5 class down the street at cold water faucets for 5 to 10 minutes to make sure the water is was a great idea as it would be an oppor- Grenfell Elementary Community School tunity for the students to feel ownership watched the productions and voted for clear; at which time you may resume normal water use. City offi cials over the tables.” their favourite. recommend that residents limit water use and especially hot water Koops created a design for the tables Principal Sproat said the activity was use when a fl ush is going on in their neighborhood. and then purchased supplies for the designed to promote unity, which is one Although fl ashing is occurring on the West part of the City, project using surplus funds from the of the school’s core values. “Although previous school year. He and his intern we need to stay distanced apart, we discoloration may be experienced outside the fl ashing area. If this built the 21 tables in the school shop the want to stay connected with each other occurs, please follow the same steps provided to aff ected areas. week before school started. When the when at school,” she said. “We look If the water does not clear after a few hours, please notify the students arrived, they spent their first forward to finding unique ways to stay Public Works Department at 306-728-6865 classes sanding and painting the unfin- connected as we physically distance ished wooden desks. Through the teach- ourselves from one another.” 4 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Patiences helps Roberts tag record-breaking elk

By Sarah Pacio “I got a real raspy, growly response,” Grasslands News he told Grasslands News, “Knowing this was likely the herd bull I challenged him with a bugle.” The bull answered, Patience and persistence produced but moved in another direction with tremendous results for Grenfell resident the rest of its herd. The same scenario Clay Roberts last week when he success- played out over the next few days. fully hunted a record-breaking bull elk. “On the third day I decided to try to Roberts drew an elk tag for Zone 37 get ahead of where he always seemed to this fall so as soon as Duck Mountain take his herd after calling,” the hunter Provincial Park opened for hunting on explained. “Getting into his backyard, Sept. 10, he set out on a quest for an old so to speak, and challenging him with herd bull. Several bull elk responded to a bull call proved to be the key to get- his calls during the first two days, but ting this old bull’s attention.” One more Roberts bided his time and his patience bugle call brought the bull out to the paid off. edge of the slough and Roberts took his shot, gaining a trophy that would make others justifiably jealous. After field dressing the animal, which later dressed out at 505 pounds, Roberts walked out of the bush for help. He re- turned with his wife and a friend, but it took them more than five hours to drag the massive animal out of the swamp and thickly timbered area. Blair Mitchell, who is a Boone and Crockett official measurer, completed the Saskatchewan Wildlife Federation score sheet for the bull and the animal Help keep your community’s history alive. had a score of 421 5/8 gross for non-typ- ical elk. Mitchell said afterwards that 68%0,77('_*5$66/$1'61(:6 SUBSCRIBE TO YOUR LOCAL NEWSPAPER! it was an “honour and privilege to put Record bull elk the tape on the largest wild bull elk I’ve Clay Roberts from Grenfell shot a record-breaking, 505 pound bull elk near ever laid my eyes on.” The animal has Kamsack on Sept. 14. the largest mass of the 72 non-typical Call Toll Free: bulls in the Henry Kelsey Record Book. It will also be entered in the Boone and Crockett Record Book, under both typi- 1-844-GNG-NEWS cal and non-typical elk. Grenfell council addresses taxes Roberts intends to have the bull shoulder mounted for display. “It was [email protected] a crazy experience that I will never for- get,” he said. and assessment of Moon’s Café By Sarah Pacio the matter further as Council signed an Grasslands News well. MOU with the Grenfell During councilor re- Athletic Association www.borderlandcoop.crs ports, Constance MacK- (GAA) for the upcoming Borderland Grenfell town council enzie relayed an inquiry season at the Grefell Re- held its regular meeting from a resident who gional Park Arena. The in the council chambers wondered when the large town also approved the on Thursday, Sept. 17 “G” signs on the high- GAA’s COVID-19 Preven- at 7 p.m. Councilor Ken &DUHHU2SSRUWXQLW\ way will be painted. The tative Measures Plan. Hamnett was absent. project has been part of The 12-page document Gib Heinemann met Borderland Co-op is hiring a Yard Attendant at our Home Centre in Whitewood, SK. the town’s capital budget clearly outlines seating with council on behalf since 2018. CAO Brenna arrangements, traffic flow Who we are: of Moon Wei who owns Ackerman assured her patterns, and other guide- Co-op does business differently. As a co-operative, we believe in working together to Moon’s Café on Desmond that plans are in prog- lines that will be imple- serve Western Canadians, delivering profi ts back to our communities and investing in Street. In 2019, a build- ress. mented to reduce contact sustainable growth. To learn more about who we are and how you can help bring our ing inspector declared brand to life, visit us at www.borderlandcoop.com Council reviewed re- between program partic- the property unsafe and ports from town staff ipants. “I think they did What you’ll do: the establishment was and the fire department, a very good job on that,” The yard attendant is responsible for the following duties on a daily basis: closed for 172 days while which indicated that the Coun. Patty Cole stated, • Assist customers $120,000 of repairs were open house BBQ tradi- and others agreed. • Deliver product made to the building’s tionally held at the fire Council acknowledged • Clean and maintain the yard back wall. “I feel she’s hall during Fire Preven- the provincial govern- • Safely operate equipment and tools been treated unfairly; I tion Week in October, ment’s announcement Why it matters: don’t think she should has been cancelled due to that it will begin distrib- Our team provides a range of products and services to support our member-owners. pay full taxes, she should COVID-19. Council also uting funds to munic- Through the work that we do, we help to build, fuel, feed and grow Western Canadian get a credit,” Heinemann accepted the resignation ipalities from the Safe communities together. told council. The town of town clerk Suzette Restart Canada Plan. Who you are: typically applies a 5 per Stone, effective Dec. 11, The town is still waiting You are looking for a career in Home & Building Products and: cent discount to taxes and expressed appreci- for specific guidelines, • You have a basic understanding and knowledge of various building materials that are paid before Sept. ation for her five and a but anticipates the funds • You’re familiar with the operation of a forklift 30, so council agreed to half years of service to will be used for PPE and • You’re honest and trustworthy, are results-oriented and strive to be the best in what extend this discount to the community. cleaning supplies. you do. the end of December for • You believe in building relationships and collaborating to deliver solutions that Moon’s 2019 taxes. matter most, and you recognize the value that different perspectives bring to meet Heinemann also ex- shared objectives pressed concern that WHITEWOOD • Have a valid Class 5 drivers licence. Moon’s tax assessment increased significantly Our Team Members receive competitive salaries, a comprehensive benefi ts package LEGION and an employer-contributed pension plan. We encourage our Team Members to take from $155,000 in 2019 to advantage of learning opportunities, to grow and develop and to foster a culture of $259,200 in 2020, while BRANCH #87 teamwork and innovation. other businesses that had also completed ren- ISLOOKINGFOR At Co-op, we embrace diversity and inclusion, and we’re working to create a workplace ovations saw no change that is as diverse as the communities we serve. We support and provide an environment to their taxes. Council that allows all to bring their whole selves to work. responded that the Sas- 6XEPLVVLRQIRUZRUNWREHGRQHRQ katchewan Assessment WKH:KLWHZRRG/HJLRQH[WHULRU Apply via email or in person or contact us at [email protected] Management Agency or more information. (SAMA) is solely respon- FRQVLVWLQJRISDLQWLQJDQGPHWDOZRUN sible for tax assessments Apply early as recruitment for this position is ongoing. and the town has no Contact input. They encouraged Ray Giroux at 306-735-7165for We thank all candidates for their interest; however, only those selected Heinemann to address information to continue in the recruitment process will be contacted. his concerns to SAMA and agreed to investigate www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 5 Prairie Valley School Division reviews finances

By Elaine Ashfield ning Team and an operational structure, lars and multiple pallets of hand sani- had many accomplishments over the Grasslands News with representatives from sector part- tizer, sanitizer dispensers, disinfectant past few months. Mechanics have com- ners, have been working on developing wipes, gloves, masks, distancing and pleted various professional development the Provincial Education Plan for imple- directional signage, plexiglass barri- The Prairie Valley School Division courses and completed a check up on mentation by January 2021. As a result ers, disinfectant, spray bottles, cleaning Board of Education reviewed an updated each bus in preparation for September of the magnitude and priority of the cloths, etc. financial picture regarding COVID-19 start up. Driver trainers were able to Safe School Re-Opening due to COVID- • With August 31 marking the end of and also for the past year when they 19, all activity towards development of resume regular training with new driv- held a meeting on September 9 in a the fiscal year, finance staff will concen- the ten-year Provincial Education Plan trate their efforts in preparing financial ers at the end of June, while there were newly arranged board room (to accom- will be paused effective immediately. It restrictions from SGI for trainees to modate social distancing of the board). statements for the annual audit and for is anticipated that a resumption of the inclusion in the annual report conclud- complete exams, they have maintained Some of the highlights from the meet- planning work towards the Provincial ing include: ing their financial accountability report- a solid partnership with SGI Examiner Education Plan will occur in November ing for 2019-2020. offices to schedule people to obtain their 2020. More information on a resumption Financial Update • The Transportation Department has S endorsements. Administration prepared the fourth of this work will be shared at a later quarter financial update and supplemen- date. tary public accounts for the year ending • Prairie Valley School Division in- August 31, 2020. On an overall basis, the cludes two Hutterian Colonies; Arm Galenzoski nominated for NDP report stated both total revenues from River Colony and Lajord Colony. The regular operations and expenses are up students in these two schools are small Provincial Election 2020 an estimated $1.5M. The net result is cohorts of children who reside within an estimated deficit from operations of a communal setting where residents The Saskatchewan NDP nominated $4.536M for the year as per the budget. are more vulnerable to transmission of Bonnie Galenzoski to be the candidate The net savings from COVID-19 COVID-19 than in a typical community. for Melville-Saltcoats in the upcoming are estimated to be $2.2M, up approxi- As a result, the Hutterian Safety Coun- provincial election. mately $250,000 from the third quarter cil (HSC), Saskatchewan Health Author- “For many years, the Sask. Party estimate. Savings are offset by approxi- ity (SHA) and Chinook School Division government has been taking the peo- katchewan and has been employed for mately $345,000 for expenses incurred as have collaborated to create a plan that ple of rural Saskatchewan for granted,” the last four years with Saskatchewan a direct result of COVID-19 and include is a pragmatic and safe approach to re- Galenzoski said. “It’s time to put peo- Crop Insurance Corporation in Melville. salaries and benefits for employees of opening schools within the Hutterite ple first and elect a government that In 2018, she was a recipient of the Dep- school self-funded services, cleaning context during the COVID-19 pandemic. is committed to healthcare when and uty Minister’s Award for Value and In- supplies, personal protective equipment • Human Resources has created an where you need it, giving kids the best novation. and other consumables and technology. Employee FAQ to help address staff access to education, and having a grow- Bonnie, and her partner, Garth spend Estimated one-time COVID-19 savings specific questions in relation to the re- ing economy that keeps Saskatchewan their time between Yorkton and his fam- have been allocated to support various opening of schools and is working with people working.” ily farm. She has two children, one who initiatives including additional bus and school administrators and superinten- Galenzoski was raised on a farm in works in Regina and another who is fleet vehicle purchases, facility projects, dents to fill any start of year staffing rural Saskatchewan and has spent most working on completing a degree at the of her life living in rural communities. math and science resources, expansion changes. University of British Columbia. She has volunteered for community “People face a clear choice between a of FM systems in schools, targeted dis- • In response and support of COVID- clubs and assisted with fundraising and tired old government and an energized tance learning and more. 19 School Re-opening, Facilities and Di- hockey tournaments. NDP government that’s committed to Overall, the Division’s financial posi- vision Office staff have been working Bonnie has completed a Bachelor of investing in people,” said NDP Leader tion continues to be pressured with the on the logistics of ensuring the receipt Science in Geography and served as the Ryan Meili. “Bonnie’s extensive living costs and overall impact associated with and delivery of cleaning, disinfection student representative for the depart- and working experience in rural Sas- the pandemic. and PPE supplies was completed prior to the arrival of staff on August 24, 2020 ment of Geography. She has worked katchewan will make her an excellent Director’s Report and students on September 8, 2020. This at the Ministry of Environment, the MLA for the people of Melville-Salt- • A Provincial Education Plan Plan- included hundreds of thousands of dol- Ministry of Agriculture, Elections Sas- coats.” Town of Fort Qu’Appelle 136 Boundary Ave. S. - P.O. Box 309 S0G 1S0 Phone: 306-332-5266 Email: [email protected] Website: www.fortquappelle.com Council Meetings Council Comment The next Town of Fort Qu’Appelle Council meeting will be held on: Step up and take your turn on Council ... Thursday, September 24, 2020 at 7:00 p.m. Garbage Collection Requirements Nominations are open for your Council representatives, those who will be Just a friendly reminder to all residents that any accumulation of garbage will be overseeing our town initiatives for the next four years. It is an important role and addressed per Bylaw 458. Per the bylaw under Section 3 – Garbage being accumulated a great way to serve your community. and stored for the purpose of being collected and taken to a waste disposal ground for Give some thought to running for Municipal Council or, alternatively, disposal shall be kept in covered, À\SURRIDQGZDWHUWLJKWFRQWDLQHUV. Section 4 – Each encourage someone you feel would be a good candidate to step forward. dwelling is allowed a maximum of two 25 gallon closed containers and with contents There are several good sources of information available to help you not to exceed 50 pounds each. The containers shall be equipped with handles and shall QRWKDYHDFDSDFLW\JUHDWHUWKDQWZHQW\¿YHJDOORQVE\YROXPHDQGFRQWHQWVDUHQRWWR understand what is involved in this form of community leadership. The following exceed 50 pounds each. Failure to comply with any provisions of this bylaw will incur a are from the Provincial Government and Municipalities of Saskatchewan: $100.00 violation charge per week. • ‘Information for New Municipal Council Members’ as well as the ‘Council Members Handbook’ prepared by Advisory Services and Municipal Relations Property Tax Notices FDQ EH IRXQG DW ZZZVDVNDWFKHZDQFDJRYHUQPHQWPXQLFLSDODGPLQLVWUD  'XHWR&29,'&RXQFLOSDVVHGUHVROXWLRQVWDWLQJ7+$7&RXQ WLRQWRROVJXLGHVDQGUHVRXUFHV cil approve a mill rate of 6.1 and extend the early payment discount (5%) on the LQIRUPDWLRQIRUFRXQFLOPHPEHUV DQG municipal portion to September 30, 2020 for the 2020 tax year notice.” This is an www.saskatchewan.ca/government/ extension from the usual date of July 31. PXQLFLSDODGPLQLVWUDWLRQHOHFWLRQV UXQQLQJIRUPXQLFLSDORI¿FH Utility Billing  ‡µ(OHFWHG2I¿FLDOV+DQGERRN¶FDQ With careful deliberation, Council has decided to return to QUARTERLY be found at suma.org/publications >> UTILITY BILLING. You will receive a utility bill in July for the month on June. It is a great time to get involved. Then billing will return to: *LYHLWVRPHVHULRXVWKRXJKW1RPL Quarter 1 — Jan. 1 – March 31 Billed beginning of April nations close October 7th! Quarter 2 — April 1 – June 30 Billed beginning of July Quarter 3 — July 1 – Sept. 30 Billed beginning of October Quarter 4 — Oct. 1 – Dec. 31 Billed beginning of January “COVID-19… Keep up the good • Our E-Transfer email has changed to [email protected] Phone work in safe distancing, hand IRUDSDVVZRUG washing, masking, …!” • In an effort to be environmentally friendly, we are updating our accounts VRZHFDQHELOOXWLOLW\ELOOV3OHDVHSURYLGHDQXSGDWHGWHOHSKRQHQXPEHUDQG EMAIL address to: [email protected] 6 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

“For the cause that needs assistance; for the wrong that needs resistance; the future in the distance and the good that we can do.” Thanks for letting us be your messenger

As the municipal election date draws closer, the tion to the people of their community by being open and policies that they want decided upon before the days are fast approaching for you to submit your and accountable to the public. To those that cooper- election. Some of the council members may be mak- nomination for councilor or mayor. Nominations ate and provide all the information required for this ing motions to table matters so that the new council close October 7th. newspaper to share, you are doing a great job. Just members can vote on these matters. Hopefully there will be elections in most commu- like the information provided to a council member If a council member is passing motions only so nities. An election shows interest and that is what so they can make a decision, information must be they can have their opinion in place before they pos- keeps every community moving towards betterment shared with the ratepayers so they can voice their sibly are done at the council table, this shows who for themselves and their neighbors through a dem- opinions for council to hear, and yes, decide whom has the interest of themselves over their commu- ocratic system of governance. they may choose to vote for. nity on their agenda. If council members are tabling Some nominees are anxious to get their name out If your council members want to withhold infor- decisions as they feel the newly elected members to the voters, and others are withholding their deci- mation regarding their decisions, these are possi- should be involved in the decisions, they are work- sion. We wish we could provide more information bly the council members you may need to question ing for your community and deserve your vote. to the public but we can only pass on to our readers prior to marking your ballot. Grasslands News would like to encourage people what is reported to us. It would be nice to know if Administration is a also huge part of the flow of to submit their nominations. You do not have to there will be enough names to create an election municipal governance. As a councilor and also as a answer to past council decisions; you are elected but we cannot report on hearsay. Last minute an- citizen, you are entitled to all correspondence and nouncements of nominations are often part of the communication regarding questions asked. to deal with the matters at present. This may mean world of politics. Being a part of your community by taking an in- changes to past decisions but sometimes change is As your community newspaper, it is our job to terest, asking questions and voicing your opinions, needed. An election is a privilege to keep our de- report on the happenings and decisions in your com- means everyone is working together and it usually mocracy. munity and also of your council. Sometimes people becomes quite evident with a healthy and prosper- Take some time to encourage people to put their don’t agree with decisions and sometimes people ous community. names forward if you may feel they are worthy to react – maybe in a positive or maybe a negative way. Some of your council members may soon be done be nominated. Then when you see the nominations, We are only the messenger. Negative comments usu- their terms, either by choice to not submit their take some time to seriously communicate with the ally mean lack of information or communication. name through nominations or by another individ- nominees before you make your decision on who We can only report from what is given to us. ual being voted in to replace them. Some of the you may vote for. At this time, I want to thank the council members members on present councils may be loading their - Elaine Ashfield, and town officials that want to share their informa- agendas in the last couple of meetings with items Grasslands News Grain drying costs caught up in politics By Murray Mandryk solutions. Grasslands News If last week’s Supreme Court of Canada ruling overturns the May 2019 federal Saskatchewan The problem with politics is Court of Appeal that upheld … well … the politics. federal carbon pricing, then the Or so we are again reminded carbon tax would immediately as we head into another pro- be removed. Unfortunately, vincial election and, possibly, a there is no guarantee that the federal election. high court will rule in that way Caught in the middle are Sas- – especially given the lower katchewan farmers struggling court loss. Moreover, it may to get through harvest. And not take months for the court to re- even the prospects of a ruling view all the factors in the case, by the highest court on the va- which is of no immediate help lidity of the federal carbon tax to stressed out farmers. can offer them much solace. Of course, there are more im- Harvest is generally going mediate political solutions: well in what’s been a reason- The Saskatchewan Party ably warm and dry fall, but that government could play ball and doesn’t mean that grain dryers refund this specific tax to farm- aren’t necessary. Those dryers ers for their propane. In fact, are powered by propane, which, all Saskatchewan governments and uselessness of applying reductions, one supposes it ers if it’s also one that would of course has been subjected to have long removed the provin- carbon pricing to propane for would heavily tax cars in cit- help Trudeau and his policies. the carbon tax for a year and a cial sales taxes on input cost grain drying and order the fed- ies, airports and airline travel There is an age-old tradition half now. like fuel, fertilizers and chem- eral government to not apply in cities … or the vast amount of Saskatchewan governments Those in rural Saskatchewan icals. To refund the carbon tax the tax. of cement in cities that all ac- fighting with Ottawa – some- need not be told about the stress to farmers would just be a logi- Propane and natural gas count far more to global warm- times, more for their own po- that accompanies harvest’s de- cal extension of what’s already are unlike gasoline and diesel ing than your cows flatulating litical benefit than the people’s mands to get the crops off the done. when it comes to greenhouse in the pasture. benefit. field as quickly and efficiently Moreover, the revenue col- gas emissions anyway. (Remem- But more people vote in cit- And Trudeau – also possibly as possible before moisture lected by the federal govern- ber? The intent of all this is to ies, so no government is inter- heading to the polls soon in the downgrades value. ment for carbon pricing is supposedly reduced GHGs?) ested in doing that. hopes of turning his minority It is a business where the returned to the province (or One could go on at great There again, it sure does into a majority – sure doesn’t profit margins begin to signifi- directly returned to provincial length how the overall concept seem that Premier Scott Moe want a co-operative solution cantly narrow at this time of residents through income tax and structure of this particular – who is now running a pro- that looks like it’s a concession year. Adding unnecessary tax rebates). Revenue neutrality is brand of federal carbon pricing vincial re-election campaign to Western premiers. costs to the need to grain dry supposedly part of this tax. does not effectively discourage that seems more about running Caught in the middle are is just one of those things that Or Prime Minister Justin CO2 emissions anyway. against Justin Trudeau than farmers who are just trying to seems particularly unfair. Trudeau could simply recog- If the federal government NDP leader Ryan Meili – wants get through harvest. Of course, there are easy nize the inherent unfairness were truly serious about GHG a solution that would help farm- Ain’t politics grand?

SUBSCRIPTION RATES: All subscription expire Dec. 31. Pick-Up Boxes: Prices shown are based on one full year. $37.80 per year Subsciptions will be pro-rated. Mailed in Saskatchewan: Melville Advance, Whitewood Grenfell Herald Sun, Fort Qu’Appelle Times Chris Ashfi eld Tammy Oryschak Michelle Walz Lloyd Schmidt Pat Gattinger Prices include GST. Publisher Accounts Advertising Production Classifi eds $50.40 per year Issued Fridays by Grasslands News Group from the office Make cheques payable to Grasslands News Group at 218 - 3rd Ave. West, P.O. Box 1420 Melville, SK., S0A 2P0 Send e-transfers to [email protected] Mailed in Canada: Ph: 306-728-5448 • Fax 306-728-4004 • Whitewood: 306-735-2230 $70.00 per year

Toll Free: 1-844-GNG-NEWS Electronic Edition: www.grasslandsnews.ca • [email protected] $37.80 per year

Wendy Krobath Emily Fulford Elaine Ashfi eld Sarah Pacio Alan Hustak © Copyright (c) News and advertising content of this newspaper are protected by copyright. Offi ce Assistant Melville Whitewood Grenfell Fort Qu’Appelle 2020 There may be no reproduction of content without permission of the publisher. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 7 Sask. Métis takes province to court

By Elaine Ashfield at a press conference last The Saskatchewan make of his Métis card. Grasslands News Thursday outside the Sas- government appealed the “It was very confusing katchewan legislature. decision, but withdrew … and they don’t know An article by Global that appeal in 2015. Chart- what they’re doing either. Métis residents want News stated that during ier said despite that, the And it was obvious,” he hunting and fishing this press conference, province has continued to said. “The minute that rights recognized in the the foundation pointed to ignore the extended juris- my status family mem- Qu’Appelle Valley and the 2002 case of Donald dictions for Métis hunters bers (returned), things area, which extends to Belhumeur, a Métis man and fishers. changed.” the city of Regina. The living in Regina who was Chartier also pointed Morin said at that Saskatchewan Métis Na- fined for fishing without a to the Saskatchewan point, the officers released tion is suing the province licence at Katepwa Lake Department of Environ- his gun and the meat be- over repeated failure to in the Qu’Appelle Valley. ment’s Treaty and Aborig- fore receiving two fines, EASTERN REGION lll consult on land rights. Belhumeur had shown inal Rights for Hunting totalling $4,000. “We believe it doesn’t conservation officers his and Fishing Guide dated The entirety of south- LOCAL 48 matter which part of our Métis Nation - Saskatche- December 2018, the most ern Saskatchewan falls homeland you live in, as wan (MN-S) membership up-to-date guide. within Treaty 4, and a LEBRET, ABERNETHY & AREA a Métis person you have card at the time. That guide currently portion of Treaty 2 ter- those (constitutional) In October 2007, pro- recognizes Métis Aborig- ritory. Both territories ANNUAL GENERAL MEETING rights, and governments vincial court Judge Diane inal rights in northern include the traditional and their courts must Morris found Belhumeur Saskatchewan, within homeland of the Métis Sunday, October 18, 2020 at 10:30 a.m. begin recognizing that,” not guilty of illegal an- specified harvesting people. the foundation chair, law- gling, recognizing his zones. Morin said he plans to Lebret Village Office, TGTBT Lunchroom yer and former Métis Na- right to fish for food pur- It also states, “recog- fight the fines, and knows Masks & Hand Sanitizer Provided tional Council president suant to section 35 of the nized individuals may of other Métis hunters Clement Chartier stated Constitution Act. exercise Métis Aboriginal and fishers across Sas- Physical Distancing In Effect rights within the Métis katchewan with similar Harvesting Zone(s) in claims. We look forward to seeing you there! Town of Fort Qu’Appelle which their historic Métis Chartier had sent a community is located.” letter to the Saskatche- 136 Boundary Avenue. - P.O. Box 309 S0G 1S0 Phone: 306-332-5266 According to the guide, wan minister of justice Email: [email protected] Website: www.fortquappelle.com in all other areas of the and attorney general Don province, “Métis Aborig- Morgan on behalf of the inal rights are not cur- foundation urging Mor- Notice of Intention to Designate rently recognized.” gan to “rectify this most Chartier continued by egregious injustice.” Municipal Heritage Property stating “You can’t paint In an email statement a First Nations man dif- to Global News, the Sas- The Heritage Property Act S.S. 1979-80, c.H-2.2 s. 11(2)(b) ferently than a self-iden- katchewan Ministry of tified Métis citizen. We’re Justice said the govern-  1RWLFH LV KHUHE\ JLYHQ WKDW QRW OHVV WKDQ WKLUW\ together on this.” ment respects and hon- Proudly presents   GD\V IURP WKH GDWH RI VHUYLFH RI WKLV QRWLFH Brendan Morin, a ours the decisions of the WKH&RXQFLORIWKH7RZQRI)RUW4X·$SSHOOHLQWHQGV self-identified Métis cit- courts in the province WRSDVVD%\ODZSXUVXDQWWRWKHSURYLVLRQVRIThe izen living in Regina, with respect to all mat- HAUL-R-DAZE! called the current lan- ters. Heritage Property Act WRGHVLJQDWHDV0XQLFLSDO guage “vague,” adding it’s It noted the govern- ONE DAY ONLY +HULWDJH3URSHUW\WKHIROORZLQJUHDOSURSHUW\NQRZQ confusing for hunters and ment is “not aware of the DV conservation officers. prosecution of any hunter Sunday, September 27 D.H. McDonald Bank Building Morin stated he was or fisherman asserting 10 a.m. to 4 p.m. out hunting in the Keno- Métis rights in the Qu’Ap- Civic Address: 160 Company Avenue South, see Lake area, which falls pelle Valley region since )RUW4X·$SSHOOH6. within the Qu’Appelle the Belhumeur decision. FEE-FREE DAY! Legal Description: Lot 24 Parcel 4 Plan 1867 Valley, on Sept. 12 when The province has re- Exclusively for Member Municipalities For residential (not commercial) refuse that includes everything  $Q\ SHUVRQ ZLVKLQJ WR REMHFW WR WKH SURSRVHG he was stopped by conser- cently embarked on ne- vation officers. gotiations with the Métis but tires and railroad ties. GHVLJQDWLRQ PXVW VHUYH &RXQFLO ZLWK D ZULWWHQ “Given my Métis an- Nation–Saskatchewan Loads must be covered & tied down to prevent littering. Pre-sort into: Metal, compost, trees, other REMHFWLRQVWDWLQJWKHUHDVRQVIRUWKHREMHFWLRQDQG cestry, I gave him my with respect to Métis (or sorting fee will be charged) DOOUHOHYDQWIDFWVQRWOHVVWKDQWKUHH  GD\VSULRU Métis citizenship card harvesting rights in Sas- WRFRQVLGHUDWLRQRIWKH%\ODZZKLFKVKDOOEHDWD and told them that I was katchewan.” out hunting with family In closing, the min- IXWXUH5HJXODU0HHWLQJRI&RXQFLO4XHVWLRQVFDQ members and we wanted istry states these are is- EH GLUHFWHG WR WKH 7RZQ RI )RUW 4X·$SSHOOH &KLHI to just get our food,” he sues that can and will be $GPLQLVWUDWLYH2IILFHU said. dealt with in a coopera-  'DWHGWKLVWKGD\RI6HSWHPEHU Morin said the officers tive spirit with the Métis seized his gun and the elk Nation–Saskatchewan, 9*RRGPDQ he had killed to feed his “which we look forward www.4callinglakes.ca/regional/our-communities &KLHI$GPLQLVWUDWLYH2IILFHU family. However, the offi- to pursuing.” NP1RUWKRI)RUW4X·$SSHOOHRQ+Z\ cers didn’t know what to 25-2c Join Grasslands News 12,000 weekly readers

SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun

Name:

Address:

Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone:

Email Address: WHY SUBSCRIBE? • Stay informed about your community. Payment by: ❑ Visa ❑ Mastercard Expiry • You support local businesses who support you back. ❑ Cheque or Money Order (enclosed) Signature • The newspaper is the community’s only historical record. Please make cheques out to Grasslands News Group Telephone Orders: 306-728-5448 (ext. 227) • A viable newspaper shows a strong community. • It’s less than buying one cup of coffee per week Forms should be mailed to Grasslands News Group, Box 1420, Melville, SK., S0A 2P0

-$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! ‚ŽW‹Œ ‚ˆ‰W¤‡ ‚ˆW‹‰

CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-2$;3#'8T‰‡‰‡;,3<+,;3'$WŠˆT‰‡‰‡W  2$£<&'&W 8 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News 2020 48th Annual – Melville and District 2020 Donors Choice Appeal 2020 Participating Agencies October 1 - 15 ALZHEIMER SOCIETY SASKATCHEWAN MELVILLE & DISTRICT DONORS CHOICE APPEAL (YHU\  KRXUV  RU PRUH SHRSOH LQ 6DVNDWFKHZDQ GHYHORS GHPHQWLD 7RGD\ RYHU  SHRSOH LQ 6DVNDWFKHZDQ DUH 48th Annual Campaign 2020 (Revenue Canada #0391357-03) OLYLQJZLWKGHPHQWLD7KH$O]KHLPHU6RFLHW\RI6DVNDWFKHZDQ HPSRZHUVSHRSOHWROLYHZHOOZLWKGHPHQWLD/DVW\HDUZHSUR YLGHGVHUYLFHVDQGSURJUDPVWRRYHUSHRSOHIURPGLIIHUHQW6DVNDWFKHZDQFRPPXQLWLHV 'RQRUBBBBBBBBBBBBBBBBBBBBBBBBBB$GGUHVVBBBBBBBBBBBBBBBBBBBBBBBBBBBB :HDUH6DVNDWFKHZDQ·VOHDGLQJQRQSURILWRUJDQL]DWLRQSURYLGLQJVXSSRUWHGXFDWLRQDQGSURJUDPPLQJIRU (PDLO$GGUHVVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB SHRSOHOLYLQJZLWKGHPHQWLDDQGWKHLUFDUHSDUWQHUVZKLOHLQYHVWLQJLQUHVHDUFKDQGEXLOGLQJDZDUHQHVV DERXWGHPHQWLDWRUHGXFHVWLJPDDQGLQFUHDVHLQFOXVLRQLQRXUFRPPXQLWLHV  ,ZLVKWRGRQDWHWKHIROORZLQJDPRXQWVWR 2XUVHUYLFHVIRUSHRSOHZLWKGHPHQWLDDUHIUHHRIFKDUJH

DIABETES CANADA – MELVILLE & DISTRICT BRANCH MULTIPLE SCLEROSIS SOCIETY OF CANADA (SASK. DIVISION) 7KH 06 6RFLHW\·V PLVVLRQ LV ´7R EH D OHDGHU LQ ILQGLQJ D FXUH IRU PXOWLSOH 3URYLGHVLQIRUPDWLRQWKURXJKHGXFDWLRQDOOLWHUDWXUHDQGSDPSKOHWV VFOHURVLV DQG HQDEOLQJ SHRSOH DIIHFWHG E\ 06 WR HQKDQFH WKHLU TXDOLW\ RI ELPRQWKO\ PHHWLQJV DW WKH 6HQLRU &LWL]HQV +DOO 7KURXJK GRQD OLIHµ2XUPLVVLRQUHIOHFWVDVKDUHGYLVLRQRIDIXWXUHIUHHIURP06DQGRXU WLRQVDQGPRQLHVUDLVHGWKHDVVRFLDWLRQLVDEOHWRVXSSRUWQDWLRQDO FRPPLWPHQWWRHQDEOHWKRVHWRXFKHGE\06WRGD\WRHQKDQFHWKHLUTXDOLW\ UHVHDUFK FKLOGUHQ DQG \RXWK FDPSV DQG HGXFDWLRQDO SURJUDPV Saskatchewan Division RI OLIH 2XU ZRUN LQFOXGHV IXQGLQJ 06 UHVHDUFK JRYHUQPHQW DGYRFDF\ RQ ,W GLVWULEXWHV LQIRUPDWLRQ WR WKH SXEOLF HGXFDWLRQ FHQWUHV GRFWRUV EHKDOIRIWKH06FRPPXQLW\DQGSURYLGLQJVHUYLFHVDQGSURJUDPVIRUWKRVH GLHWLFLDQVDQGQXUVHV'LDEHWHVLVDGLVHDVHWKDWDIIHFWV LPSDFWHGE\06 &DQDGLDQV³RURQHLQHYHU\SHRSOH,WVFRPSOLFDWLRQVNLGQH\DQGKHDUWGLVHDVHJDQJUHQHEOLQG RAIL CITY INDUSTRIES – QHVVDQGVWURNHPDNHLWWKHPDMRUFDXVHRIGHDWKWKLUGRQO\WRFDQFHUDQGFDUGLRYDVFXODU KHDUWDQG 2XUPLVVLRQLVWRSURYLGHLQGLYLGXDOL]HGVXSSRUWVHUYLFHV WRSHUVRQVZLWKGLVDELOLWLHVWROLYHDVLQFOXVLYHYDOXHGDQGFRQWULEXWLQJPHPEHUVRI EORRGYHVVHO GLVHDVH WKHFRPPXQLW\:HDUHDQRQSURILWRUJDQL]DWLRQWKDWRIIHUVUHVLGHQWLDODQGYRFDWLRQDO KINSMEN FOUNDATION (TELEMIRACLE) – MELVILLE KINETTES VHUYLFHV PDLQWDLQLQJ IRXU JURXS KRPHV DQ DFWLYLW\ FHQWHU DQG D VXSSRUWHG OLYLQJ 7KH .LQVPHQ )RXQGDWLRQ ZDV HVWDEOLVKHG LQ  WR PDQDJH WKH PRQH\ UDLVHG E\ SURJUDP 5DLO &LW\ VXSSRUWV YRFDWLRQDO RSSRUWXQLW\ WKURXJK LWV FRPPHUFLDO NLWFKHQ 6DVNDWFKHZDQ.LQVPHQDQG.LQHWWHFOXEV,WTXLFNO\EHFDPHDSSDUHQWWKDWWKHGHPDQGIRU DQGUHVWDXUDQWDQGWKURXJK6$5&$1SDSHU RLOUHF\FOLQJVHUYLFHV5&,DOVRPDNHV GROODUVH[FHHGHGWKHGROODUVWKDWZHUHDYDLODEOH$VDUHVXOWWKHILUVW7HOHPLUDFOHWHOHWKRQ DYDLODEOHWRVWXGHQWVHQWHULQJLQWRWKHFDUHJLYLQJILHOGWKH5&,0HPRULDO6FKRODUVKLS ZDVDLUHGLQWRHQDEOHWKH.LQVPHQDQG.LQHWWHVWRVHUYHHYHQPRUHRIWKHLUFRP VHWXSLQPHPRU\RISDVWHPSOR\HHV PXQLWLHV·JUHDWHVWQHHGV 7RGD\WKH.LQVPHQ)RXQGDWLRQFRQWLQXHVWREHWKHIXQGHURIODVWUHVRUWIRUKXQGUHGVRI ST. PAUL LUTHERAN HOME FOUNDATION 6DVNDWFKHZDQLQGLYLGXDOVDQGRUJDQL]DWLRQVZKRDSSO\IRUIXQGLQJHDFK\HDU7KH.LQVPHQ)RXQGDWLRQKHOSV A charity under the Non-profit Corporation Act of Sask. WR SURPRWH ILQDQFH DQG WKRVHZKRUHTXLUHILQDQFLDODVVLVWDQFHIRUVSHFLDOQHHGVHTXLSPHQWPRELOLW\HTXLSPHQWRUWUDYHODVVLVWDQFHWR SURYLGHFDUHDQGFRPIRUWWRWKHDJHGWKHLOODQGWKHLQILUP DFFHVV PHGLFDO WUHDWPHQW 'ROODUV UDLVHG DW 7HOHPLUDFOH DOORZ WKH .LQVPHQ )RXQGDWLRQ WR FRQWLQXH ´+HOSLQJ 7KHPRQH\UDLVHGZLOOEHVSHQWORFDOO\WRILQDQFHWKHZLVKHVDQGVSHFLILFUHTXHVWV 3HRSOH(YHU\'D\µ RIWKHUHVLGHQWVDQGVWDIIRI6W3DXO/XWKHUDQ+RPHRYHUDQGDERYHWKHEXGJHWHG PRQH\UHFHLYHGE\63/+IURP6XQULVH+HDOWK5HJLRQ7KHIXQGVUHFHLYHGZLOOEH KIDNEY FOUNDATION OF CANADA (Saskatchewan) XVHGWRSURYLGHFRPIRUWUHOD[DWLRQVWLPXODWLRQFUHDWLYLW\DQGIXQIRUWKHUHVLGHQWV )XQGV GRQDWHG JR WRZDUGV PHGLFDO UHVHDUFK SXEOLF DQG SURIHVVLRQDO HGXFDWLRQ RI6W3DXO/XWKHUDQ+RPH SDWLHQWVHUYLFHV PRELOHKRPHVZLWKGLDO\VLVPDFKLQHV VXPPHUFDPSVOLEUDULHVDQG DOVRWRSURPRWHWKH2UJDQ'RQRU3URJUDPUHJDUGLQJGRQDWLRQDQGWUDQVSODQWDWLRQ 673(7(5·6+263,7$/)281'$7,21+($/7+&$5(,1<285+$1'6 7KHSULQFLSDOSXUSRVHRIWKH)RXQGDWLRQLVWRDGYDQFHWKHZHOIDUHDQGJRRGRI6W 3HWHU·V+RVSLWDOE\ 0DLQWDLQLQJDVWURQJIHHOLQJRIJRRGZLOOWRZDUGV6W3HWHU·V+RVSLWDO LUNG ASSOCIATION OF SASKATCHEWAN 5DLVLQJIXQGVSULPDULO\IRUWKHSXUSRVHVRI6W3HWHU·V+RVSLWDO $V6DVNDWFKHZDQ·VROGHVWKHDOWKFKDULW\7KH/XQJ$VVRFLDWLRQ 5HFRJQL]LQJWKDWKHDOWKFDUHSDUWQHUVKLSVFRRSHUDWLRQDQGLQWHJUDWLRQRIVHU RI6DVNDWFKHZDQKDVOHGWKHILJKWIRUKHDOWK\OXQJVIRURYHU YLFHVDUHDQLQFUHDVLQJUHDOLW\DQGZLOOHQKDQFHWKHPLVVLRQRI6W3HWHU·V+RVSLWDO \HDUV 2XU VHUYLFHV EHJDQ LQ  EDWWOLQJ WKH WXEHUFXORVLV HSLGHPLFWKDWVZHSWDFURVVWKHSURYLQFHDQG&DQDGD7RGD\ZHILJKWIRUWKHLQSHRSOHLQ&DQDGD SASKABILITIES (Yorkton) DIIHFWHGE\OXQJGLVHDVHVVXFKDVDVWKPD&23'SXOPRQDU\ILEURVLVDQGOXQJFDQFHU7KDQNVWRRXU 6DVN$ELOLWLHV VXSSRUWV SHRSOH H[SHULHQF ZRUN6DVNDWFKHZDQKDVVHHQWUHPHQGRXVVWULGHVLQOXQJKHDOWKSROLFLHVUHVHDUFKHGXFDWLRQDQG LQJ GLVDELOLW\ ZLWK SURJUDPV DQG VHUYLFHV VXSSRUW$OOIXQGVUDLVHGVXSSRUWYLWDOUHVHDUFKDGYRFDF\HGXFDWLRQDQGSDWLHQWVXSSRUWSURJUDPV WR HQKDQFH WKHLU OLYHV  6DVN$ELOLWLHV LV KHUHLQ6DVNDWFKHZDQ D SURYLQFLDO RUJDQL]DWLRQ WKDW VXSSRUWV 7KH /XQJ $VVRFLDWLRQ RI 6DVNDWFKHZDQ EHOLHYHV WKDW JRRG OXQJ KHDOWK LV HVVHQWLDO IRU HYHU\RQH·V ZHOOEHLQJDQGTXDOLW\RIOLIH2XUSURJUDPVDQGVHUYLFHVIRFXVRQSURWHFWLQJOXQJKHDOWKSUHYHQWLQJ RI  DQQXDOO\ LQ 6DVNDWFKHZDQ OXQJGLVHDVHDQGHQVXULQJWKDWWKHULJKWUHVRXUFHVDUHDYDLODEOHIRUWKRVHZKRQHHGWKHP:KHWKHULW·V 3DUWQHUV LQ (PSOR\PHQW (PSOR\PHQW ILJKWLQJIRUFOHDQDLUIRUHYHU\RQHRUSURYLGLQJVXSSRUWDQGFDUHWRWKRVHVWUXJJOLQJZLWKOXQJGLVHDVH 2SSRUWXQLWLHV  6NLOOV 'HYHORSPHQW 4XDOLW\ RI /LIH 7UDQVLW  5HKDELOLWDWLRQ 6HUYLFHV 6SHFLDO ZHDUHKHUHWRKHOS6DVNDWFKHZDQEUHDWKH%HFDXVHZKHQ\RXFDQ·WEUHDWKHQRWKLQJHOVHPDWWHUV 1HHGV(TXLSPHQW5HF\FOLQJDQG&RPPXQLW\5HODWLRQVDUHDOOVHUYLFHVSURYLGHGWRPHHWWKH QHHGVRIFRPPXQLW\PHPEHUVH[SHULHQFLQJGLVDELOLWLHV

MELVILLE & DISTRICT COMMUNITY FOUNDATION SOCIETY FOR THE PREVENTION OF CRUELTY TO ANIMALS – Yorkton “Give Where You Live” 7KH 0HOYLOOH DQG 'LVWULFW &RPPXQLW\ )RXQGDWLRQ

Sgt. Travis Adams investigate. move these items from vehicles at all a crossing, or the gates and warning Melville-Ituna Detachment RCMP are investigating a report that times. signals are activated, how far away sometime over the weekend about 300 If you have information related to from the tracks should you wait in Sept. 16 - Sept. 23 litres of diesel fuel stolen from three these mischiefs, thefts, please contact order to stay safe? units parked on the north side of High- your local RCMP Detachment, call 310- Stop behind any gates or stop lines Traffic way #247. A grader also had a lock and RCMP for immediate response, or you — or no closer than 5 metres from the During this time, Melville and Ituna door broken to gain access. RCMP will can call Crime Stoppers at 1-800-222- nearest rail — and wait for the train to detachment responded to 36 reported oc- continue to investigate. TIPS (8477). pass. Cross only after the warning sig- currences or traffic stops that resulted nals have stopped and you are certain in 21 Charges and 12 Warnings. Crimes Against Person/Property Sept. 21-27 is Railway Safety Week no other trains are approaching, from RCMP charged one individual for re- A report to RCMP that someone had FAQ: either direction, on any track. fusal to provide a breath sample. The smashed the windows on their RV at 1. How many Canadians are killed same individual assaulted an officer, Crooked Lake. RCMP continue to inves- or injured in railway crossing or 7. Is it safe to walk, hike, cycle, uttered threats towards officers and tigate. trespassing incidents each year? ATV or snowmobile alongside tracks? charged with mischief to the police ve- RCMP investigate a report semi trail- Every year, more than 100 Canadians No. Never walk or ride on the gravel hicle. ers and farm equipment parked on a are seriously injured or killed as the re- service roads or green spaces alongside RCMP attended a motor vehicle colli- street in Ituna impeding traffic. sult of railway crossing or trespassing tracks — it is both illegal and danger- sion. One vehicle going through uncon- A call to RCMP reported that a group incidents. Almost every one of these in- ous. trolled intersection failed to yield the of young males causing problems at cidents is preventable. 8. What should I do if a crossing right of way causing T-bone Collison. Independent Grocers parking lot in 2. What simple steps can people light is not working or if I see some- Both vehicles not driveable, no injuries, Melville. The youth were located and ac- take to stay safe around trains and thing unsafe at a railway crossing? both vehicles towed. Driver charged knowledged their mistakes and damage railway property? Call 911 or look for the railway com- along Queen Street. RCMP escorted sus- under Traffic Safety Act 219(1). Stay at a safe distance from trains pany’s emergency number posted on the pects along Queen Street to show what and off railway property and tracks. Do back of the crossbuck, or on the signal Mischief / Theft else damage done to ensure they clean not use train tracks as a shortcut. More- house. A person contacted RCMP to report up their mess along way. over, always obey railway signs and sig- he had left his business and an I-Phone Melville/Ituna RCMP continue to 9. How much does a train weigh? nals. Look. Listen. Live. The average locomotive alone weighs and Acer laptop were stolen. RCMP con- complete Operation Secure checks. 3. What is the likelihood that a col- tinue to investigate. During this time, RCMP checked ran- 110 tonnes, but a train can weigh tens of lision between a car and a train will thousands of tonnes. A person or a car RCMP were contacted to report a dom vehicles and then left a business be a fatal one? break and enter to the Bargain Hunter is no match for it: a train hitting a car card to indicate, the check was com- A motorist is 40 times more likely to in Melville. A black I-Pod and grey is like a car hitting a pop can. pleted. During this time, 22 vehicles die in a collision involving a train than Dyson Vacuum and undisclosed amount checked, nine were secure and thirteen 10. Where do most collisions be- in one with another motor vehicle. of money stolen. RCMP continue to in- were unsecure resulting in 59 per cent tween trains and cars occur? 4. What should I do if my car stalls vestigate. of vehicles being unsecure. It is still or is stuck on railway tracks? Most collisions between vehicles and A farmer contacted RCMP to report quite surprising that vehicle doors are Get out of your vehicle and move at trains happen within 40 km of the mo- someone had stolen 100 gallons of diesel unlocked, keys inside, wallets and other least 30 m from the tracks. Call 911 or torist’s home—and 66 per cent happen at from their combine while parked in a valuables left, inside these vehicles. look for the railway company’s emer- crossings with active warning devices field near Goodeve. RCMP continue to RCMP are reminding the public to re- gency number posted on the back of the (gates, lights, bells). crossbuck, or on the signal house. 11. How quickly can a train stop? Help keep your community’s history alive. 5. How fast can a train travel? Trains cannot stop quickly. The aver- SUBSCRIBE TO YOUR LOCAL NEWSPAPER! Some trains can go as fast as 160 age freight train travelling at 100 km/h km/h. However, because of their large —or passenger train travelling at 160 Call Toll Free: 1-844-GNG-NEWS size, it can be hard to accurately judge a km/h — requires about 2 km to stop. train’s speed or how far away it is. That is the equivalent of the length of [email protected] 6. When a train is passing through 18 football fields.

Good Spirit School Division NOTICE OF CALL FOR Notice of Call for Nominations NOMINATIONS )RUP+ PUBLIC NOTICELVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHVIRUWKHRIÀFH V RI (Section 66 of the Act) Board Members:*RRG6SLULW6FKRRO'LYLVLRQ1R CHRIST THE TEACHER RCSSD NO. 212 1XPEHURI%RDUG0HPEHUVWREHHOHFWHG²PHPEHUSHUVXEGLYLVLRQ SCHOOL DIVISION ELECTIONS

Sub-Division No. 1 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI$UUDQ3HOO\ 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHVIRUWKHRIÀFHRI  DQG7RJRWKH7RZQVRI.DPVDFNDQG1RUTXD\DQGDVVRFLDWHGUXUDODUHDV BOARD MEMBER: CHRIST THE TEACHER ROMAN CATHOLIC Sub-Division No. 2 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI(QGHDYRXU+\DVDQG SEPARATE SCHOOL DIVISION NO. 212  6WHQHQWKH7RZQVRI3UHHFHYLOOHDQG6WXUJLVDQGDVVRFLDWHGUXUDODUHDV Sub-Division No. 3 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI%XFKDQDQ,QYHUPD\  1XPEHUWREH  DQG5DPDWKH7RZQRI&DQRUDDQGDVVRFLDWHGUXUDODUHDV  (OHFWHG Sub-Division No. 4 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI&DOGHU(EHQH]HU ߦMelville – City at Large 2  0DF1XWW5KHLQDQG7KHRGRUHWKH7RZQRI6SULQJVLGHDQGDVVRFLDWHG ߦSub-division No. 1 (Theodore and surrounding rural area) 1  UXUDODUHDV Sub-Division No. 5 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI$WZDWHU%DQJRUDQG ߦ Sub-division No. 2 (Geographic area surrounding Melville) 1  :DOGURQ7KH7RZQVRI%UHGHQEXU\&KXUFKEULGJH/DQJHQEXUJDQG ߦ Sub-division No. 3 (Rural area surrounding Yorkton) 1  6DOWFRDWVDQGDVVRFLDWHGUXUDODUHDV ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHGGXULQJUHJXODUEXVLQHVVKRXUV DPWR Sub-Division No. 6 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI'XII*RRGHYH  *UD\VRQDQG.LOODO\WKH&LW\RI0HOYLOOHDQGDVVRFLDWHGUXUDODUHDV SP FRPPHQFLQJWKHVWGD\RI6HSWHPEHUWRWKHWKGD\RI2FWREHU Sub-Division No. 7 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI%LUG·V3RLQW*HUDOG DQGIURPDPWRSPRQ2FWREHU FORVHRIQRPLQDWLRQV   6WRFNKROP7DQWDOORQ:HVWHQGDQGSaskatoon Trades The provincial colleges rick Stoddart said. denbagh also commented. this funding, from basic two mobile job connec- and Skills Centre is a deliver education and Southeast College “This is wonderful news skills programs to lan- tion units, and more than not-for-profit organiza- skills training programs serves a region that for Parkland College, guage training, will sup- 35 community learning tion that helps to equip including Adult Basic encompasses over 70 given the operational port individuals as they sites. employers with skilled Education (ABE), both communities spread pressures resulting from pursue further education Also announced was workers and equip adults off and on-reserve, Essen- throughout 20,000 square the pandemic and the and move into employ- the annual funding of $1.9 with the skills for jobs tial Skills for the Work- kilometers in southeast fiscal pressures on the ment opportunities in million to the Regina and they need to start a re- place (ESWP), as well as Saskatchewan. Government of Saskatch- Saskatchewan.” Saskatoon Trades and warding career. the Skills Training Allo- Campuses operate in ewan. “We thank the gov- Funding to the other cation. ABE and ESWP six communities, includ- ernment for this funding colleges included $1.9 programs provide adult ing: Assiniboia, Estevan, which supports our adult million to Carlton Trail Planning on Selling learners with basic em- Indian Head, Moosomin, learners as they further College, $2.4 million to ployment skills and work- Weyburn, and White- their education and en- Cumberland College, $2.8 Some Equipment or place experience that wood. Through partner- hance their employability million to Great Plains leads to either further ships with post-secondary skills.” College, $1.1 million to having a Farm Auction? training or attachment to institutions, the college Parkland College’s Lakeland College, $4.5 the labour market. delivers a wide variety mission is to provide high million to North West The Skills Training Need an apprasial of career, vocational, and quality, learner centred College and $6 million to academic programming education and training as Northlands College. on assets? to meet the educational, a foundation for lifelong The Government of Give our economic and labour success with a vision to Saskatchewan made an- LANDFILL force demands of south- be Saskatchewan’s leader other announcement for Sales Manager, )25748·$33(//( eastern Saskatchewan. in delivering high quality annual funding of $4.3 Trent Guenther, SUMMER HOURS Additionally, the College education and training. million to Saskatchewan • May 1 to October 31 • serves many business Parkland College has Indian Institute of Tech- a call today Monday to Saturday and industry stakehold- training locations at 8:00 a.m. - 5:00 p.m. ers by offering numer- Canora, Esterhazy, Fort 1-306-621-4739 Sunday 10:00 a.m. - 4:00 p.m. ous business, safety, and Qu’Appelle, Kamsack, Dale’s Painting Closed Statutory Holidays industrial programs and Melville and Yorkton. Minimum Load Charge is $10 courses at their six cam- “The Government of 306-728-4392 We now Accept: 602 - 8th Ave. W. Lic 325025

&='8ধ9-2+'!&£-2'9<'9&!@ˆ‰332gˆf¥‹‹f  f  Melville tfn/2nd www.yacauctions.com 9-26c - Odd

Directory

Fisher & Schmidt Miller Moar Grodecki Kreklewich & Chorney CHARTERED PROFESSIONAL ACCOUNTANTS – www.millerandco.ca Phyllis Armstrong CPA, CGA /DZ2IÀFH MELVILLE OFFICE – 306-728-4525 FORT QU’APPELLE OFFICE – 306-332-6651 ˆ‰¥f‹;,='W !9;T'£=-££'T 32&!@;3 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WTˆŒŒfŠ8&='W W '&2'9&!@ŽVŠ‡!W1W;3ˆ‰332Tˆ‰‰316!2@='WW Chartered Professional Accountant !=-&W 83&'$0-TT-2!ħ'2&!2$' 0LFKDHO)LVKHU4& For your٘ ESTERHAZY OFFICE – 306-745-6611 INDIAN HEAD OFFICE – 306-695-2303 8!2&='W Accounting Š‰Œ'&2'9&!@ˆVŠ‡6W1W;3‹VŠ‡6W1WT 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WT‹‰‡!-2;W +RQV 32&!@;3 DUQHW)LVKHU%$* ٘ //%&ROODERUDWLYH/DZ\HU GRENFELL OFFICE – 306-697-3558 !=-&W 83&'$0-TT-2!ħ'2&!2$' TAXATION Needs 32&!@;3 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WTˆ¤'9132&;W BALCARRES OFFICE – 306-334-2923

'$'&2'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT!£$!88'93>2ă -2!ħ'2&!2$' UDQW6FKPLGW//% !88@W-££'8TTT* ٘ Wednesday and Thursday £!-8W!2!'9''£'TTT-2!ħ'2&!2$' Michael Fisher & Garnet Fisher Grant Schmidt 306-735-2284 Summer Hours 306-728-4581 306-728-5481 WHITEWOOD OFFICE – 306-735-2385 ITUNA OFFICE – 306-795-3190 ,<89&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT2&8'>+'2$-'9<-£&-2+ <'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT3( ;<2!ă$' 707 Lalonde St. Tuesday to Friday Melville and Esterhazy Melville !8@W8'0£'>-$,TTT-2!ħ'2&!2$' )9,'8£!>|9!90;'£W2'; 93£!>|9!90;'£W2'; !=-&W,382'@TT-2!ħ'2&!2$' Whitewood, SK 10 a.m. to 4 p.m.

BOCK & COMPANY Balcarres LAW OFFICE DIRECTORY LYNNETTE BOCK, B.A., J.D. Agencies Ltd. Phone 306-332-4666 1-800-563-4608 ADVERTISING 122 Company Ave. S., Fort Qu’Appelle, SK 0DSOH6WUHHW32%R[ Off ering a wide selection of products and expertise $ (VWHUKD]\6.6$; • Personal Insurance • Commercial Insurance For all your Insurance needs! for only 10* / week PHONE: (306) 745-3952 • Specialty Products • Agri-Business Representing: • SGI Canada 0XVWEHSUHSDLGSOXV*67 • Wawanesa • SMI • Wynward Insurance Company 5HJXODUUDWHLVSOXV*67SHU\HDU FAX: (306) 745-6119 216 Main St. Balcarres, SK • Germania Mutual • Aviva • Oasis • Intact (PDLOERFNODZ#VDVNWHOQHW Phone: 306-334-2401 Fax: 306-334-2705 • HUB Life and Financial Services Grasslands News Group Email: [email protected] • Portage Mutual • Group Medical Services %UDQFK2IÀFH • Red River Mutual and Many More. Rocanvile, Friday Afternoons www.balcarresagencies.saskbrokers.com • Saskatchewan Blue Cross 1-844-464-6397 • SGI Motor License Issuer Phone: (306) 645-4552 ext 230 GARY MOORE LL.B. Buying a newly Barrister, Solicitor, Notary Public Box 610, 616 Main St., PATTY WELCH built home? 306-728-4358 | 148-3rd Ave. E., Melville &RQVXOWDQW Broadview, SK S0G 0K0 306-745-6450 | 513 Main St., Esterhazy Phone: (306) 728-4998 Contact me today. 0RQGD\)ULGD\DIWHUKRXUVE\DSSRLQWPHQW It’s just another part of the H&R Block Advantage. WK$YH(DVW0HOYLOOH EDFNGRRUHQWUDQFH Laura Wittig SUB-OFFICE: Get Whats Yours™ SDWW\ZHOFK#LQYHVWRUVJURXSFRP :KLWHZRRG7KXUVGD\DIWHUQRRQ Click, call or come over. Time... to think about keeping the family dream home, Mobile Mortgage Advisor no matter what )ODWODQG3OXPELQJ%XLOGLQJ hrblock.ca 800-HRBLOCK 306 531-3346 from simple to complex 7UDGLWLRQDOPRUWJDJHOLIHLQVXUDQFHLVGHVLJQHGVSHFLÀFDOO\WRUHWLUHRQO\WKHEDODQFH RZLQJWRWKHPRUWJDJHOHQGHULIVRPHWKLQJKDSSHQVWR\RX,QYHVWRUV*URXSFDQVKRZ 1 866 293-3616 CALL FOR APPOINTMENTS: No matter how complicated your situation is, we can provide you with: \RXKRZDQLQGLYLGXDOSODQWKDWSXWV\RXLQFRQWUROFDQKHOSHQVXUHWKDWLQWKHHYHQW Q tax planning strategies. GHDWKGLVDELOLW\RUFULWLFDOLOOQHVV\RXUIDPLO\FDQVWLOOOLYHLQWKHLUKRPH [email protected] Q audit assistance. /HWXVVKRZ\RXKRZEXLOGLQJLQVXUDQFHLQWR\RXUSODQFDQSUHVHUYHÀQDQFLDOVHFXULW\ 306-696-2454 or 306-696-6704 Q complex return preparation including the areas of: All mortgages are subject to credit approval. Certain conditions Q small business Q rental Q corporate Q trust and estate Q U.S. Œ7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV and restrictions apply. The CIBC logo is a trademark of CIBC. 12 September 25, 2020 )RUW4X·$SSHOOH7LPHV Grasslands News McMorris running to keep Indian Head-Milestone as MLA Provincial Election 2020

By Alan Hustak try. “If you ask the agricultural community how Grasslands News COVID has changed their lives, it hasn’t,” he insists. “I think people are feeling comfortable with the way Premier Moe has handled this. There will always be Don McMorris goes into the October 26th pro- issues. Education is one of them. People sending kids vincial election as one of back to school is a real concern, but some of those the longest serving mem- concerns are being alleviated. Most people aren’t that bers of the Saskatchewan COVID scared anymore.” legislature. Even though After 21 years in the legislature, McMorris says his he has represented In- experience counts for something. “I am one of the few dian Head-Milestone for senior hockey and baseball. He turned to farming and who have served in both opposition and in govern- 21 years, and is now vice- was also a driving instructor with the Prairie Valley ment. I think I have a lot to add and to still give to the chair of Saskatchewan’s School Division. His parents had a cottage on Echo party and to the province.” He says the real challenge Public Accounts com- Lake and since he was two years old he has spent is to balance government spending. “We’re back to a mittee, McMorris takes his summers in the Fort. He became involved in poli- deficit, and we have to deal with that.” nothing for granted when tics when the Saskatchewan Party was getting off the Four months after winning the last election, Mc- it comes to politics. SP CANDIDATE ground. “Agriculture was struggling under the NDP. Morris stepped down from cabinet after pleading “Elections are always DON MCMORRIS I was farming; the Liberals imploded and I thought I guilty to a charge of impaired driving. “I wish it never nerve-wracking,” he says. could make a contribution. The party had no money in happened,” he said. “But it did. Everything happens “You hope you’ve done a good job, and that people the bank and four people in the room at that first meet- for a reason. And I can tell you, so many people I have support you. Because of COVID this is going to be a ing I attended. I got the nomination by acclamation.” met in the riding have been supportive, even people different year.” He says the pandemic hasn’t affected rural Sas- who I didn’t think would understand. If that is still an First elected to the opposition in 1999 when Roy Ro- katchewan as much as it has other parts of the coun- issue it is because the media makes it one.” manow was premier, McMorris was re-elected in 2003, and named to cabinet by Brad Wall. He held several cabinet portfolios under Wall, and was seen by some political observers as Wall’s successor. He was Min- Yorkton RCMP launch investigation into death ister of Health, Minister of Highways and Infrastruc- ture, and Minister responsible for the Saskatchewan Yorkton RCMP The body of an adult tachment. 786-2400. Information can Liquour and Gaming Authority. His name recognition Grasslands News male was located a short Anyone with informa- also be submitted anony- alone makes him the odds on favourite to win again. distance off the highway. tion about the activities of mously to Saskatchewan And the fact that his snowboarding son, Mark, is an A forensic autopsy was Darwin Keith Whitehawk Crime Stoppers by calling On Sept. 16, officers Olympic gold medallist doesn’t hurt either. conducted on Sept. 21 in leading up to his disap- 1-800-222-TIPS (8477) or from the Yorkton RCMP But McMorris concedes the pandemic has inter- Saskatoon. A Saskatche- pearance in late July submitting a tip online at Detachment, Yorkton fered with the way a campaign is normally run. “I wan RCMP Forensic An- 2020, is asked to contact www.saskcrimestoppers. RCMP Forensic Identi- haven’t been able to go to one public event, no parades, thropologist, Dr. Ernie the Yorkton RCMP at 306- com fication Section and the no sports days, no games; I miss that. It seems weird Walker, assisted in identi- Saskatchewan RCMP not to be able to get to fowl suppers at this time of the fying the human remains, Major Crimes Unit-South year. The normal way of talking to people isn’t there which were determined (MCU-S) investigated the Send us your anymore.” to be 40-year-old Darwin report of human remains McMorrs, 59, the son of a Lewvan elevator agent, Keith Whitehawk. He was CONFIDENTIAL located near Highway 16, grew up “in a ghost town” between Weyburn and Re- reported missing to the approximately eight ki- gina that has disappeared from the map. He went to Yorkton RCMP Detach- NEWS TIPS lometres west of Spring- school in Milestone. As an athletic teenager he made ment in late July 2020. side, SK. a name for himself playing “tons of sports” including The circumstances [email protected] surrounding the death of Darwin Keith Whitehawk continues to be investi- gated by the Saskatche- wan RCMP MCU-S and SAFETY CLASSES the Yorkton RCMP De- in October at the Had Enough? Let’s gget to work! Whitewood Campus VICTOR TEECE Last Mountain - Touchwood GROUND DISTURBANCE October 13, 2020

FIRST AID/CRP/AED RECERTIFICATION October 14, 2020 Web: www.pcsask.ca | E-Mail:Mil [email protected]@ H2S ALIVE October 20, 2020 The SaskParty has grown too large, too arrogant and too out of touch. Saskatchewan's NDP opposition is ineffective FIRST AID/CPR/AED and fails to hold the SaskParty mega spending in check. October 21 & 22, 2020 There is another option.p

- We will keep jobs in Saskatchewan by eliminating the North West Please call 1-866-999-7372 for more info or to register Trade Partnership Agreement; OR you can register online at www.southeastcollege.org - We will reign in government spending on vanity projects; - We will lower PST and eliminate double taxation; - We will introduce the Property Owners Right to Access and Protect Property Act. We are the True Conservative Party
1.866.999.7372 of Saskatchewan. southeastcollege.org Approved by the business manager of Victor Teece www.grasslandsnews.ca )RUW4X·$SSHOOH7LPHV September 25, 2020 13 Companies partner to raise funds for Fort Qu’Appelle Food Bank Len Thompson Lures #FishingForFoodBanks2020 fundraiser hooks $1,000 food bank donation

When the owners of Al- The response really did supporter not only of our The response from the make the campaign last company’s online web- berta based Len Thomp- take us by surprise,” said brands, but of the out- anglers and the commu- until September 30. The store, or while available son Lures realized the Jessica Pallister-Dew, the doors and conservation nity has been so positive, Fishing for Food Banks at RoBo Sales Husky Sta- depth of the COVID-19 company’s Marketing in general. Furthermore, the company decided to Lures are available on the tion in Fort Qu’Appelle. Pandemic, they wanted Manager. “The very next the village of Abernethy to do their small part to week, we loaded Brad’s is where Len Thompson, help. truck up with groceries my great grandfather, “As with so many busi- and delivered them to our started the company in nesses, we were very slow food banks in Lacombe 1929. Our roots run deep during the spring. But and Blackfalds.” in this area.” said Pallis- we wanted to keep our So far, twenty-three ter. “We are so excited staff not only physically communities have been to contribute in our own healthy, but mentally and aided and nearly $19,350 modest way to the import- financially healthy as has been raised on behalf ant work the Fort Qu’Ap- well,” said company Pres- of the campaign. Smaller pelle Food Bank does for ident Brad Pallister. “My to mid sized communi- our home community.” sister and I wondered ties with a rich history Not only were funds how we could keep people of fishing, hunting, the provided by Len Thomp- busy while also helping outdoor conservation ac- son Lures, but local re- families struggling with tivities have generally tailer RoBo Sales (Husky the economic impacts of been the recipients of the Station) also helped to this unprecedented time.” donations. The siblings double the donation from The Pallister siblings are currently on an eight $500 to $1,000 by pur- thought that their na- day, nine community chasing 144 of the lim- tionally distributed fish- and ten food banks tour ited edition lures. “Len ing lure products could through Northern Al- Thompson Lures is origi- generate interest across berta and Saskatchewan. nally from the Qu’Appelle the country. Six unique, On this trip, they per- Valley,” said Robo owner limited edition lures sonally made a donation Rodney Ulvild. “When Food bank catches donation 68%0,77('_*5$66/$1'61(:6 were created and 50 per at the Qu’Appelle Valley we found out about the Homelessness Coordinator Patsy Pritchard and Executive Assistant Joseph cent of the sales of these Friendship Centre and limited edition lures that items were to be donated Food Bank on the morn- look great, and helps %HDUIURPWKH4X·$SSHOOH9DOOH\)ULHQGVKLS&HQWUHDQG)RRG%DQNUHFHLYH to community food banks. ing of Sept. 22. to support a local food a cheque for $750 and $250 worth of food from President Brad Pallister and “In the first weekend, “Saskatchewan has al- bank…it was an easy de- Marketing Manager Jessica Pallister-Dew from the Thompson-Pallister Bait we sold almost 700 lures. ways been such a huge cision to bring them in.” Co. Ltd. Clarke ready to represent Indian Head-Milestone as MLA Provincial Election 2020

By Alan Hustak could be either a blessing or a curse to Clarke’s cam- Grasslands News paign come voting day. The normal process can’t play out and the chance for candidates to debate the issues in person has been curtailed. It is a formidable chal- “A lot of people feel let down by McMorris,” says lenge, but Jared Clarke Clark. “At the very least, I hope to take him on virtu- believes he’s up to it. ally. Debates or town hall meetings are usually orga- Clarke is the New constituents.” nized by third parties; I’ll take whatever offers are out Democratic Party can- Clarke, 34, is a biologist, an avid bird watcher who there to take him on, whatever people are comfortable didate out to unseat vet- farms near Edenwold. He’s also an elementary school with. I’m passionate about getting elected. People have eran Saskatchewan Party teacher in Regina. He worked with the Wascana Cen- been putting their trust in me. If I’m an MLA, I won’t founder Don McMorris tre Authority for five years after getting his biology de- let them down.” who has represented In- gree before he obtained his education degree from the dian Head-Milestone in University of Regina. His entry into politics was trig- the legislature for the gered when he fought successfully to keep the school past 21 years. But since in Edenwold open. Clarke won the NDP “Education got cut by this government, and I helped nomination in the riding NDP CANDIDATE save the school,” he says. Clarke believes that the Sas- 15 months ago, he’s been JARED CLARKE katchewan Party badly mishandled the education file Thera hard at work to put a during the COVID-19 pandemic and that its indecisive dent in McMorris’ armor. And while the polls among Back to School plan caused parents and teachers un- Nordal committed voters favour the Saskatchewan Party to imaginable stress. Last Mountain-Touchwood win the Oct. 26 election, Clarke is heartened by the “They had no back to school plan all summer. Then growing number of undecided voters - the 35 per cent two weeks before schools opened, they came up with Authorized by the business manager for the candidate. who claim they still don’t know who they plan to vote $40-million dollars. But money that’s been promised is saskndp.ca/nordal [email protected] for. still not in the system. Teachers and principals have “I’m out there knocking on doors in every town, been stepping up, but without additional resources the  village and community in the riding. And people have, plan can only be so good.” for the most part, been grateful to see a politician show If there is a spike in COVID cases, the pandemic up on their doorstep. I’ve had incredibly personal, heart to heart conversations with people. I can tell you 32!2&-&!;'9 they are not happy, not happy with this government. ‰‡‰‡ £'$ধ They tell me that in the areas of health, education and affordability, the Saskatchewan Party is letting them Let VOTERS know who you are down.” If Clarke is to unseat the incumbent, he needs to Kickstart your campaign with a newspaper sway at least 2,000 voters away from McMorris. The riding has a high number of Indigenous voters who 683)£'('!;<8'!8ধ$£'T!&='8ধ9-2+!2&68-2ধ2+R Clarke says, have largely been ignored by the govern- ment. “I am committed to being an MLA who works      V for all people in the riding, not just those who are well 20 (18” x 20”) Lawn Signs ORˆ‡‡‡lŒWŒ\?¥WŒm £399 £@'89T connected. My work in the community even before I ‰lˆc¥6!+'m'>96!6'8&9!2& was a candidate shows how hard I can work for my !'>96!6'883)£' '!;<8'8ধ$£' $ 00 !££(38 395 8$32;!$;<9;3!+';  $<9;316!$0!+'  9ধ1!;'3&!@R '68-2;!>2-+29T39;'89T £@'89c83$,<8'9T<9-2'99!8&9T 338 !2+'89!2& R 14 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

Melville Minor Ball is gearing up for 2021

By Emily Jane Fulford “We tried to keep people there had to be social dis- Grasslands News informed as information tance and cleaning pro- came in to us through tocols in place. We were our website and Facebook notified that the 30 people This spring many page.” limit would be strictly en- sports took a hit as Covid- When the Re-Open forced, for the safety of all 19 forced a shut down. plan eventually took ef- involved.” Minor baseball was no fect, it was simply too With the average size exception to that. late to make a season out for a minor baseball team In early spring, or- of the remaining time on being between 20 and 30 ganizations and leagues the calendar. On top of players and games always across the province were this, the new rules for being between two teams, notified through Saskball sanitization and social the restrictions simply and Saskatchewan Soft- distancing would stand to would mathematically ball that the season would make a season extremely not allow for baseball or not be moving forward. difficult. sports with similar sized “We had already held a “As parks reopened, teams to realistically take registration night as well we realized it would be place. While some leagues as receiving registrations challenging as there were attempted to go forward online through our web- many restrictions such with a limited season, site. We had also received as a limit of 30 people/ Melville Minor Ball As- many registrations to our diamond. With players, sociation listened to the annual triple A baseball coaches and umpires, it requests from families to tournament in July,” would be challenging to put safety first and issued said Melinda Henderson keep under 30,” explains refunds to all those play- of Melville Minor Ball. Henderson. “As well ers who had registered

for 2020. ELAINE ASHFIELD | GRASSLANDS NEWS “Unanimously as a Looks like new board, we made the deci- :RUNHUVIURP&RPPHUFLDO3RROSXWWKHÀQLVKLQJWRXFKHVRQWKHQHZSRROOLQHU sion that the best option LQVWDOOHGODVWZHHNDW:KLWHZRRG·VRXWGRRUSRRO7KHOLQHUFRYHUVWKHFUDFNV - SEE MINOR BALL, 16 WKDWZHUHVHDOHGDQGZLOOJLYHPDQ\PRUH\HDUVRIOLIHWRWKHSRRO New swimming pool liner installed By Elaine Ashfield pare the pool floor and walls and a closure due to the pandemic was Grasslands News new liner was installed. renovations to the town office. “The liner is 60 mm thick and The project began initially when will probably give another 20 to 25 leakage was discovered in the roof Whitewood’s outdoor swimming years of life to the pool for the com- due to the library addition that had pool received its new liner last munity,” one of the workers told been added years ago and developed week, summing up another project Grasslands News. into a mold issue. The old ceiling done by the Town of Whitewood for “We’ve been here all week (since tile, roof in the library and lighting this summer. Monday) and today (Thursday) we were removed so the problem could The pool was deteriorating from are just finishing up. Looks great, be corrected. New lighting was in- cracks in the cement in the body doesn’t it!” stalled in the new ceiling at the li- of the pool and several fundraisers And it definitely does look great. brary during the renovation. were initiated over the past few Recreation director Ryan Dale Interior renovations including years to raise funds for renovations confirmed that the project is done an addition of a wall to the front at the pool. Although the total cost for this summer and next year, office, new flooring throughout the will be more than the fundraisers work will continue to complete the front office, hallway and library, had accumulated, the Town Coun- change rooms and the walkways painting, new windows, a mail slot cil agreed to cover costs so the ren- (the pool deck) surrounding the and new security were also done. ovations could be completed this pool will be completed as well. “We still have contractors com- summer when the pool would see Dale could not give the finalized ing and finishing work and hav- 68%0,77('_*5$66/$1'61(:6 limited usage due to the COVID-19 costs of the renovations until in- en’t been invoiced for everything 6HQLRUV·JROI pandemic. voicing was received from the com- to date,” CAO Cindy Baumgartner 7KH (FKR 5LGJH 6HQLRU 0HQ·V *ROI &OXE A new pump replaced the old pany doing the work. told Grasslands News last week. FURZQHGWKHLU&OXE&KDPSLRQV6HSW one which had been utilized for nu- The recreation department will Since the project has been tak- DWWKH(FKR5LGJH*ROI&RXUVH&DP&KDUWLHU merous years, possibly even from be winterizing all equipment before ing place since April, Grasslands 5 UHFHLYHGWKHWURSK\IRU/RZ*URVVZKLOH the origin of the pool, and new pip- winter sets in and they then will News requested the cost to date and 5RQ 5REE /  ZRQ /RZ 1HW$QRWKHU JUHDW ing and skimmers were installed. turn their attention to the respon- what was not completed that would \HDUZDVHQMR\HGE\WKH6HQLRUPHPEHUV An installation crew from a sibilities for that season. be invoiced at a later date. As of company, Commercial Pool in Win- The other project taken on over yet, these figures have not been re- nipeg, MB., came last week to pre- the summer that took advantage of ceived. MORE LOCAL COVERAGE than any other newspaper in Southeast and Central Saskatchewan!

Melville Advance | Fort Qu’Appelle Times | Whitewood Grenfell Herald Sun www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 15 Sports Column – Darcy Gross Gross Misconduct Coaches celebrated in Sask. By Elaine Ashfield celebrates the dedication ewan on 6,000 different Bob Dylan, back when he was a revolutionary Grasslands News coaches have to their role local teams, clubs and and probably one of the most prolific songwriters and promotes the positive leagues. Across Canada, of all time, warbled the phrase, “The times, they impact they have on ath- more than 1.5 million Sporting events may are a changin’” speaking about how America was letes and communities. Canadians have received have been put on hold for coming of age. With many coaches op- coach training and one a few months but there Over the years, few things have changed as much erating as volunteers and in seven Canadians will are still lots and lots of as sports, especially in regard to how the games are committing an average of coach at some point in athletes patiently waiting played and the way we as fans watch them. more than 120 hours each their lives. The same goes for the athletes who we revere for to get back to the game year to Canadian sport, “Coaches are leaders their stellar play. We older folks know who we think – whatever it may be in the week provides a sim- who work at all levels of are the best players in any given sport, but those this ‘new normal’ we are ple way to say thanks to sport and with athletes people a generation behind or ahead, certainly have experiencing from the these integral leaders. of all abilities to foster a different take on who might be the best of all time. pandemic. “There are few acco- safe and quality environ- Is it ridiculous to compare a portly Babe Ruth The interest that has lades as natural, joyfully ments while encourag- to some of the bigger baseball stars of today? Most developed over the years respectful and heartfelt as ing respect, inclusivity, Gene Makowsky youngsters would take one look at Ruth and think for many players or the ‘Thanks Coach,’” Parks, communication, dedica- he’d have a better chance of beating Kobayashi in excitement of joining for Culture and Sport Minis- tion and teamwork,” said ation of Saskatchewan a hotdog eating contest than he would of hitting a the first time as part of ter Gene Makowsky said. Doug Hillis, Chairperson (CAS) is a not-for-profit home run, let alone clubbing over 700 circuit clouts a team can largely be at- “I don’t think we can of the Coaches Associ- provincial organization during his illustrious career. tributed to the coaches in overestimate the positive ation of Saskatchewan. that represents the in- If you took one look at a jacked up Barry Bonds our communities. effects that good coach- “They are everyday role terests of coaching in the or Albert Pujols, you’d think they’d be much better It’s time to say ing and good coaches can models that inspire those province. CAS is a mem- ballplayers than the Babe, and I’m not so certain “Thanks Coach” in Sas- that they’d be wrong, despite all the records Ruth have on the individual they work with and that ber of Sask Sport, and katchewan. had set. community — contribut- can influence how peo- strives to enhance the The Government of Bonds, who has yet to be voted into baseball’s ing to a legacy by helping ple view sport, physical development and recogni- Saskatchewan has pro- Hall of Fame – and may never be – seemed to play guide the next generation activity and themselves. tion of coaches at all lev- claimed September 19 to the part of the athlete better than Babe, also hit as they move forward to Through that leadership els in all sports. 27, 2020 Coaches Week in more homers than the Yankee legend. become leaders and con- they are building health- So from all of the citi- the province in support of Because of Bonds’ extreme unlikability and alle- tributing citizens.” ier, active communities zens, sports fans and team the Coaches Association gations that he used performance enhancing drugs, Today more than 27,000 that will benefit future participants in our many of Saskatchewan and Na- fans and sportswriters have had little difficulty trained coaches work generations in our prov- communities – we join in tional Coaches Week. overlooking his accomplishments in the sport. with 320,000 registered ince. saying “Thanks Coach” This week-long event Is it fair? Perhaps, but who is to say? participants in Saskatch- The Coaches Associ- for your dedication. Take football as another example. Tom Brady has been called the greatest quar- terback of all time, and it is almost impossible to ignore his records and his wins over the years, but what happens to the other guys who have held on to that mantel? Melville bowling scores, standings Is Brady a better pivot than Johnny Unitas, or Team Pts. Bart Starr, Joe Montana or Terry Bradshaw? Melville Bowl Arena  7HDP +LJK 6LQJOH DQG 7ULSOH (O\VVD7KRPSVRQ*LUOV·+LJK Brady did flourish in the system created by New &XU\OR  +ROOLQJHU 7ULSOH(PPL+ROOLQJHU Scores/Standings =ZLUVN\  Team Pts.  %R\V+LJK6LQJOHDQG'RXEOH5HLG England Patriots coach Bill Belichik, but Montana +DOO  +ROOLQJHU  0RUJDQ   %R\V +LJK 7ULSOH was pretty darn good under Bill Walsh, creator of MONDAY A.M. THURSDAY YBC .RKOHQEHUJ  &DUOLQ7KRPSVRQ Sept. 14 the West Coast Offence. Sept. 17 .RYDO   7HDP +LJK 6LQJOH DQG 7ULSOH LDGLHV· +LJK 6LQJOH 7ULSOH DQG GLUOV· +LJK 6LQJOH DQG 7ULSOH /DF\ 7KRPSVRQ Players now are bigger, stronger and faster than $YHUDJH0DUJR-RUGHQV 6WHYHQV SATURDAY YBC Team Pts. they were in the days of Unitas and Starr, and the  0HQ·V +LJK 6LLQJOH 7ULSOH DQG  %R\V+LJK6LQJOHDQG7ULSOH3DUNHU Sept. 12 7KRPSVRQ  $YHUDJH *RUGRQ 2VWOXQG   .RYDO GLUOV· +LJK 6LQJOH DQG 'RXEOH +ROOLQJHU  rules have been changed to inject more offence into  the games, because touchdowns sell tickets.  7HDP +LJK 6LQJOH DQG 7ULSOH 2VWOXQG To be honest, it’s not even the same game as it Team Pts. was 10 short years ago, never mind half a century '(:  ago. 2VWOXQG  'REVRQ=RUQ  Automotive and Service Players in all sports now have the benefit of the best coaching, the best training and the best equip- MONDAY COMMERCIAL ment, but could you plug these same guys into the Sept. 14 1970s and expect them to run away with the leagues LDGLHV· +LJK 6LQJOH 7ULSOH DQG Directory $YHUDJH %UDQG\ /HFKQHU   in which they play?  In Canada, most fans prefer to argue about  0HQ·V +LJK 6LQJOH 7ULSOH DQG $YHUDJH/XFDV/LW]HQEHUJHU Swathers, Combines, Haybines: Cutting Parts hockey and no matter what, the name that always  Sulberg Guards and imports made in Germany ends up on the top of the heap is Wayne Gretzky,  7HDP +LJK 6LQJOH DQG 7ULSOH and with good reason. 3URIHVVLRQDO$PDWHXUV GUARDS - ALL MAKES *V Belts (A, B, C, D) all sizes Team Pts. Macdon, IHC, Hesston, MF, prices on request *Swather and Haybine The Great One holds or shares a total of 61 NHL 3LQ+HDGV  Versatile, Honeybee records, far and away the most by any hockey PRICES: $10 - $23 Knives (sickles) 0Q0·V  *Roller Chains player. %OLQG&KLFNHQV  *Used Canvas *Baler Belting 4” - 14” for splicing No. 40, 50, 60, 80 Ervin Wolfe 2GG%DOOV  *Kondex Bolts & Sections But what of Gordie Howe, Bobby Orr or even the *New & Econ Batteries *Boss Oil 3URIHVVLRQDO$PDWHXUV  - all makes Product Advisor often overlooked Bobby Hull? 1RW*XLOW\  We Also BUY Scrap Batteries prices from $15 - $22.50 Do they just fall down a notch because so many [email protected] people have elevated Gretzky to the top? 67+(15<·6 Eric Sagan Sept. 15 Cell 306-533-5945 Mark Messier and Bryan Trottier both won more LDGLHV· +LJK 6LQJOH 7ULSOH DQG 306-728-2580 Mon-Fri 8:30 - 5:00 Stanley Cups, as did most of the members of the $YHUDJH&U\VWDO6FKRIHU Hwy. #15 West, 655 Broad Street, Regina, Sask Montreal Canadiens during their own glory years.  0HQ·V +LJK 6LQJOH 7ULSOH DQG $YHUDJH5DQG\2VWOXQG Melville, SK 1-800-667-9976 – taylorautogroup.ca For a short time in 1972, was there a better  7HDP +LJK 6LQJOH 2VWOXQG  hockey player on the planet than Paul Henderson? 7HDP+LJK7ULSOH'ULIWHUV It’s difficult to choose who the best in any sport Team Pts. $7HDP  OW TOWING SERVICES Wholesale Transmission was. 'ULIWHUV  Was Jack Nicklaus better than Tiger Woods? Is 2VWOXQG  24 Hour Service & Differential Roger Federer a better tennis player than Bjorn WEDNESDAY LADIES Sept. 16 Cell: 306-331-8833 Wholesale Prices Borg? LDGLHV· +LJK 6LQJOH -HDQHWWH +HLO ,PSRUWV 'RPHVWLFV2YHUKDXOV)UHH5RDG7HVWV The way we have to think of athletes from the DQG )UDQFLQH 6WXFNH\  /DGLHV· :UHFNPDVWHU&HUWLÀHG All Makes & Models Rebuilt in Our Own Shop past is how they played in the times they played +LJK 7ULSOH DQG $YHUDJH 0DU\ORX 6*,6WRUDJH&RPSRXQG -DQLVNHZLFK )UHH8QZDQWHG&DU5HPRYDO + Differential +CVA Joints + Clutches + with the opposition they faced and the teammates  7HDP+LJK6LQJOH%LUR7HDP /RFNRXWVERRVWLQJDQGZLQFKLQJ + Universal Joints + Drive Shafts + 4X4 Transfer Cases + they had. +LJK7ULSOH.RQHFKQ\ Team Pts. ´7KH3ULFH:H4XRWH··LVWKH3ULFH

What has happened to Jordan Spieth? me,” Spieth told GolfWeek. “I’ve worked my butt off across North America grounded their kids indefinitely In his personal life, the 27-year-old Texan is in a over the last year mentally, physically and mechani- for putting baseball cards in the spokes of their bike good place. He was recently married to his longtime cally. Things will start to come together.” wheels.”” girlfriend, Annie, and he’s pulling down a couple of Ranked first or second in the world for most of 2015 • From fark.com: “Gardner Minshew unaware that million dollars a year, at least, from on-course earn- and 2016, Spieth ended the 2019 calendar year ranked Jaguars are tanking because all the scrubs the team ings and endorsement revenue. His net worth is re- 44th. He had fallen to 67th when the U.S. Open started has retained are trying really hard.” portedly $100 million. and likely a few places lower based on his inept per- • Greg Cote of the MiamiHerald, on a retired base- Professionally, however, Spieth’s golf game — as formance. ball broadcasting legend opening a Twitter account: the kids would say — sucks Spieth is only 27 “Welcome to Twitter, Vin Scully! Social media does In his first four years on the PGA Tour, Spieth years old and some not deserve but dearly needs your civility.” played as if he were going to be the next Tiger Woods, believe the biggest Sports Column • Michael Corcoran of golf.com, on the 1974 course or at least the next Rory McIlroy. He won three major problem he’s having By Bruce Penton setup at Winged Foot, site of this year’s U.S. Open: championships by age 23, and fumbled away a fourth isn’t with his swing “… Rough higher than Snoop Dogg and greens harder by messing up the par-3 12th at Augusta in 2016. He or his putting, but than a frozen Snickers.” was a favourite to contend in almost every tournament between his ears. Per- • Bob Molinaro of pilotonline.com: “Last week, the he entered. He had 11 PGA Tour victories by the age haps spending a few University of Colorado became the first college to sign of 24. When he won the Open Championship at Royal hours on a psychoan- a sponsorship deal with an online gambling operation. Birkdale in July, 2017, the golf world was in agreement alyst’s couch instead The alumni must be so proud.” that the sky was the limit. Since then, however, the of banging balls eight • RJ Currie of sportsdeke.com: “I heard Toronto sky has fallen. hours a day might get lost a game last week 20-6. Did the CFL season start His driver became his worst enemy. His short game, him back on track. while I wasn’t looking?” long the model for youngsters to emulate, got loose. • Dan Daly of Pro- Too loose. He scuffed chips. He missed many makeable FootballDaly.com, • Headline at theonion.com: “Scientists Study putts. He started missing cuts regularly. He stopped via Twitter, on owner Daniel Snyder’s legacy with Brains Of Baseball Fans To Find Out How They Stay winning. He stopped even contending. the Washington Football Team: “Snyder bought Saks Interested During First 7 Innings” So how long would this slump last? ‘He’ll be back’ Fifth Avenue and in 20 years turned it into the Dollar • Another headline at TheOnion.com: “Mariners was the common theme among Golf Channel analysts, Store.” place Kyle Lewis on IL after losing him in thick out- who spent hours trying to pinpoint Spieth’s problems • Janice Hough of leftcoastsportsbabe.com, with an field smog.” — and possible solutions. MLB who-woulda-thunk-it: “Pretty sure absolutely, • Headline in the New York Daily News: “Normalcy The height of Spieth’s woes may have happened positively NO ONE had the best 2020 team in the state in 2020 at last ... Jets remain Jets!” at the recent U.S. Open at Winged Foot in New of New York being the Blue Jays.” • Sign of the times, from Dwight Perry of the Seat- York, where Spieth shot 73-81. Only 12 golfers in the • Nick Canepa of the San Diego Union-Tribune, on tle Times:: “Banner towed behind an airplane above 144-player field were worse. The second round featured Mavericks wunderkind Luka Doncic: “I love Doncic’s Dodger Stadium when Houston paid a recent visit: nine bogeys, one double bogey and eight pars. game, but at least let him shave before comparing him “Hey, Astr*s, try stealing this sign!” An NBC broadcaster said Spieth admitted he was to Larry Bird.” Nick Canepa again, after the Braves put up an “lost.” • Patti Dawn Swansson, the River City Renegade, NL-record 29 runs on the Marlins: “They violated Still, he hasn’t given up. “I’ve got a lot of years in after a Mike Trout rookie card fetched a record $3.936 every one of baseball’s 1,212 unwritten rules.” front of me and hopefully the best years in front of million: “Scant seconds later, millions of parents Care to comment? Email [email protected] Minor ball plans are in the works - continued from page 14 was to cancel the season and tournament.” said Hen- derson. “We already had several families requesting refunds as they made the decision on their own to opt out of group sport.” With high hopes for the future, Melville Minor Ball is being proactive and positive in their preparations for next year. “We are already planning for our 2021 season as we will be going forward next season! As is always challenging, we are looking for new board members. We currently have openings for Pres- ident and Registrar. New people are always welcome!” said Henderson. “We will follow guidelines and rules set forth by Saskball and Saskatchewan Softball. I have faith that things will return to “normal” and the kids can play. After all, it’s all about the kids and we will do what’s necessary to get them back on the dia- monds!”

Box 129 – 731 Lalonde Street Phone (306) 735-2210 NOTICE FOR CALL FOR NOMINATIONS 2020 MUNICIPAL ELECTION

 l'$ধ32¤¤3(;,'$;m

    -9,'8'#@+-='2;,!;231-2!ধ329 3($!2&-&!;'9(38;,'3ă$'l9m3(V

1. MAYOR of the Town of Whitewood 2. COUNCILLOR for the Town of Whitewood l<1#'8;3#' £'$;'&g¤m

-££#'8'$'-='&#@;,'<2&'89-+2'&32;,';,&!@ 3($;3#'8T‰‡‰‡(831Ž!W1W;3‹6W1W!;;,'ă$' 3( ;,' 3>2 3( ,-;'>33&T Šˆ !£32&' ;8''; !2&&<8-2+8'+<£!8#<9-2'99,3<89(831Ž!W1W;3‹ 6W1W $311'2$-2+ 8-&!@T '6;'1#'8 ˆ¥T ‰‡‰‡ ;3 '&2'9&!@T$;3#'8T‰‡‰‡W

31-2!ধ32(38191!@#'3#;!-2'&!;;,'(3££3>-2+ £3$!ধ32V ă$'3(;,'3>23(,-;'>33&T 731 Lalonde Street

!;'&;,-9ˆ¥;,&!@3('6;'1#'8T‰‡‰‡W

-2&@!<1+!8;2'8 ';<82-2+ă$'8 www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 17

Grasslands

What to do to prepare your garden for winter

* *DUGHQVSURYLGHDQLG\OOLFHVFDSHIURPG LG LG OOL I WRSODQWOLIHLQVSULQJEXWWKH\DOVRFDQEHW O W OLI L L E W WK O E WKHKXVWOHDQGEXVWOHRIHYHU\GD\OLIH,Q KDUPIXOLQWKHZLQWHU:HHGVDQGGHEULV IDFWPDQ\JDUGHQLQJHQWKXVLDVWVW\SLFDOO\ OHIWWROLQJHULQJDUGHQVWKURXJKWKHZLQWHU FDQQRWZDLWIRUWKHVSULQJWKDZVRWKH\FDQ SURYLGHRYHUZLQWHULQJVSRWVIRULQVHFWVDQG VSHQGWKHQH[WVHYHUDOPRQWKVWHQGLQJWR FDQFRQWULEXWHWRGLVHDVH6RLW·VLPSHU- - WKHLUSODQWVXQGHUWKHZDUPVXQ%XWDJDU DWLYHWKDWZHHGVDQGGHEULVDUHUHPRYHG JDUGHQVRLOQHHGVOLPHLVWRWHVWLW/LPH • Protect fruit trees.,I\RXKDYHIUXLW GHQHU·VZRUNLVQHYHUWUXO\GRQHDQGWKH EHIRUHWKHJURXQGKDUGHQVLQZLQWHU'RQ·W PDNHVVRLOOHVVDFLGLFDQGUHGXFHVVRLO WUHHVLQVWDOOPRXVHJXDUGVDURXQGWKH ZRUNWRPDNHJDUGHQVVWXQLQWKHVSULQJ ZDLWXQWLOWKHJURXQGKDUGHQVDVWKDWFDQ S+/RZVRLOS+PDNHVLWKDUGIRUFHUWDLQ EDVHWRSUHYHQWPLFHDQGYROHVIURPNLOOLQJ DFWXDOO\EHJLQVGXULQJWKHSUHFHGLQJIDOO PDNHLWKDUGWRUHPRYHWKHURRWVRIZHHGV SODQWVWRJURZEXWDFLGLFVRLOLVLGHDOZKHQ WKHWUHHVRYHUWKHZLQWHU,IOHIWWRWKHLURZQ  3UHSDULQJJDUGHQVIRUZLQWHULVDQ DGYHUVHO\DIIHFWLQJWKHJDUGHQDVDUHVXOW LPSRUWDQWVWHSWKDWFDQKHOSKRPHRZQHUV • Prepare the soil.7KH)DUPHU·V JURZLQJEOXHEHUULHV7HVWWKHVRLOIRUOLPH GHYLFHVRYHUWKHZLQWHUPLFHDQGYROHV HQVXUHWKHLUJDUGHQVUHWXUQWRIXOOVWUHQJWK $OPDQDFDGYLVHVKRPHRZQHUVWRJHQWO\ DQGDPHQGLWGHSHQGLQJRQZKDW\RXKRSH PD\HDWWKHEDUNRIIUXLWWUHHVNLOOLQJWKH LQWKHVSULQJ7KHWDVNVQHFHVVDU\WRSUH- WLOOWKHVRLOLQWKHLUJDUGHQVVRWKH\FDQ WRJURZLQWKHVSULQJVRLW·VUHDG\WRWKULYH WUHHVDVDUHVXOW7KH)DUPHU·V$OPDQDF SDUHJDUGHQVIRUZLQWHUPD\GHSHQGRQ H[SRVHDQ\LQVHFWVEHIRUHWKH\VHWWOHLQIRU ZKHQZLQWHUHQGV QRWHVWKDWPRXVHJXDUGVPDGHRIILQH ZKDWKRPHRZQHUVDUHSODQWLQJEXWWKH WKHZLQWHU2QFHJDUGHQVRLOLVH[SRVHG • Remove dead or diseased plants. PHVKKDUGZDUHFORWKFDQHIIHFWLYHO\SUR- IROORZLQJDUHVRPHJHQHUDOPDLQWHQDQFH DGGDOD\HURIFRPSRVWOHDYHVDJHG 'HDGRUGLVHDVHGSODQWVVKRXOGQRWEHOHIW WHFWIUXLWWUHHVIURPKXQJU\PLFHDQGYROHV VXJJHVWLRQVWKDWFDQNHHSJDUGHQVVDIH PDQXUHDQGLIQHFHVVDU\OLPHJHQWO\ LQWKHJDUGHQWKURXJKWKHZLQWHU7KHVH RYHUWKHZLQWHU WKLVZLQWHU WLOOLQJLWLQWRWKHVRLO$FFRUGLQJWRWKH SODQWVFDQDWWUDFWLQVHFWVDQGDUHYXOQHUD-  $JDUGHQHU·VZRUNLVQHYHUGRQHDQG • Remove weeds and debris.:HHGV 1RUWK&DUROLQD&RRSHUDWLYH([WHQVLRQWKH EOHWRGLVHDVHZKLFKFDQPDNHLWKDUGIRU WKHZRUNWRFUHDWHEHDXWLIXOVSULQJJDUGHQV DQGGHEULVDUHXQVLJKWO\DQGGHWULPHQWDO RQO\DFFXUDWHZD\WRGHWHUPLQHLIODZQRU WKHJDUGHQWRWKULYHLQWKHVSULQJ EHJLQVLQWKHIDOO The balance of Libra marks the course of celestial bodies By Emily Jane Fulford ODWLRQVKDYHDORWPRUH \DUGJDUGHQWDNHDORRN UHDGXVLQJVSHFLDOL]HG H[SORUHU6DPXHOGH FRQVWHOODWLRQVGDWHVEDFN Grasslands News WRRIIHUWKDQLQVLJKWLQWR XSDWWKHQLJKWVN\IRUD LQVWUXPHQWVVXFKDVDVWUR- &KDPSODLQLVYLVLEOHIURP URXJKO\\HDUVZKHQ SHRSOH·VORYHOLYHVRUIXWXUH PRPHQWDQGSD\WULEXWHWR ODEHVVH[WDQWVDQGFKLS WKHWRSRIDKLOODW1HSHDQ WKH5RPDQVFDPHXSZLWK HQGHDYRUV7KHVHFRPSOH[ WKHROGHVWIRUPRIWKHWHFK- ORJV 3RLQW'HSLFWHGKROGLQJWKH WKHLGHD7KH$XWXPQDO ,I\RXNQRZDQ\/LEUD·V VWDUIRUPDWLRQVZHUHXVHG QRORJ\  7KHDVWURODEHZDVD DVWURODEHLQFRUUHFWO\LWLV (TXLQR[WKHSRLQWZKHUH in town, you might be E\DQFLHQWFLYLOL]DWLRQVWR  2IFRXUVHWKHVHVWDUIRU- GHYLFHXVHGWRPHDVXUH VXIILFHWRVD\WKDWHLWKHU WKHVXQFURVVHVWKHHTXD- VHQGLQJDELUWKGD\JUHHWLQJ WUDFNFDOHQGDUGDWHVVRDV PDWLRQVVXFKDV/LEUDZHUH WKHDOWLWXGHDERYHWKHKRUL- KLVGLVFRYHU\RIWKHFRXQ- WRURQURXWHWRWKH1RUWKHUQ VRPHWLPHLQWKHQH[WIHZ WREHWWHUSUHGLFWZKHQWR XVHGIRUPRUHWKDQMXVW ]RQRIDFHOHVWLDOERG\DQG WU\ZDVH[WUHPHO\OXFN\RU +HPLVSKHUHHQFRPSDVVHV ZHHNV7KH]RGLDFVLJQRI SODQWRUKDUYHVWFURSV6R KDUYHVWLQJFURSVWKH\ZHUH FRXOGEHXVHGWRLGHQWLI\ WKHLQGLYLGXDOUHVSRQVLEOH WKH/LEUDFRQVWHOODWLRQ VFDOHVLVJLYHQWRDOOWKRVH WKHQH[WWLPH\RXFKHFN DOVRYLWDOIRUWUDQVSRUWDWLRQ VWDUVDQGSODQHWV7KLV IRUFUHDWLQJKLVOLNHQHVVLQ 6LQFHWKLVLVWKHWLPHRI ERUQEHWZHHQWKHGDWHVRI (QYLURQPHQW&DQDGDIRU &RQVWHOODWLRQVVHUYHGDV ZRXOGDOORZWKHXVHUWR EURQ]HZRXOGKDYHPDGH \HDUZKHQGD\DQGQLJKW 6HSWDQG2FWDQGLV WKHZHDWKHUIRUHFDVWWR DQFLHQW*36ZD\SRLQWV GHWHUPLQHDODWLWXGHRU IRUDYHU\SRRUVHDYR\D- KRXUVDUHHTXDOWKHVFDOHV VDLGWRUHSUHVHQWEDODQFH FKHFNLILW·VWLPHWRGLJWKH IRUDVWURQRPHUVDVZHOODV WRWULDQJXODWH,Q2WWDZD JHXU ZHUHDSHUIHFWGHSLFWLRQ  +RZHYHUWKHFRQVWHO- SRWDWRHVRXWRIWKHEDFN- QDXWLFDOH[SORUHUVDQGZHUH 2QWDULRDVWDWXHRI)UHQFK  7KHQDPLQJRIWKH IRUWKLVFRQVWHOODWLRQDV WKH\UHSUHVHQWEDODQFH ,WLVDOVRWKHUHDVRQZK\ /LEUDLVFRQQHFWHGZLWKWKH Gender Equality Week recognized in Canada Sept 20 to 26 FRQVWHOODWLRQFDOOHG9LUJR WKHILJXUHUHSUHVHQWLQJMXV- By Emily Jane Fulford FRYHUDJHDUHDRIFRXUVH 5R\DO$VVHQWRQ-XQH SHRSOHWRWHOOWKHLUVWRULHVRI KRPH WLFHVLQFH-XVWLFHLVDOVR Grasslands News DUHQRH[FHSWLRQZLWKDQ ZKLFKGHVLJQDWHVWKH WKRVHLQVSLULQJWUDLOEOD]HUVLQ  *UDVVODQGV1HZVLV UHSUHVHQWHGZLWKVFDOHV LPSUHVVLYHO\GLYHUVHZRUN- fourth week in September WKHLUOLYHVZKHWKHUWKH\EH SURXGWRVXSSRUWJHQGHU UHSUHVHQWLQJWKHEDODQFH IRUFHLQDOOVHFWRUVIURP DV*HQGHU(TXDOLW\:HHN DIDPLO\PHPEHUFROOHDJXH HTXDOLW\ZLWKDOORXUUHDGHUV RILQWHUHVWVEHWZHHQRQH 6HSWHPEHUWR VPDOOEXVLQHVVWRPXQLFLSDO  7KLV\HDUWKHWKHPHLV RUJURXSLQWKHLUFRPPXQLW\ $Q\RQHZKRWRRNSDUWLQ SDUW\DQGDQRWKHUDFRQ- PDUNVWKHGHEXWRI JRYHUQDQFH FDOOHG´%HFDXVH2I

Kim Wieme Massage Therapy

PERSONAL CARE HOME 306-736-3374 Phone / Text Wellness, Beauty and Holistic Melville, SK Private bedrooms/bathrooms for RMT - Recognized by Health Insurance Companies Singles and Couples. • Specializing in Th erapeutic Massage Corinne Pauliuk - Owner/Operator Directory • Muscle Fascia Cupping 306.699.2548 • Th ai Yoga Massage website: carehomes.ca/homes/sunrise-country-haven/ • Th ai Hand and Foot Refl exology • Rapid Adhesion Release Technique Located on acreage between McLean & Qu’Appelle

For all your denture needs: Yorkton Hearing Services Simply Divine #18 First Avenue North, Yorkton, Sask. S3N 1J4 Your ears deserve an audiologist! Tru-Fit Denture Clinic LizelleLizelle - HairstylistHHairstylist • Hearing Tests • Hearing Aids 306-730-5748 • Repairs • Batteries 2130B Broad Street, Regina, Saskatchewan S4P 1Y5 • Custom Molds 540-8th Ave. West, Melville, SK Phone: 306-782-1793 306-352-2552 www.yorktonhearing.com Jacquie Mvula CALL COLLECT M.S., R. Aud. “Doing a smiling business for over a decade and a half” 18 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

WEEK OF SEPTEMBER 27 TO OCTOBER 3, 2020

THE LUCKIEST SIGNS THIS WEEK: TAURUS, GEMINI AND CANCER ARIES If fatigue is becoming a constant companion, it might be time to

include more exercise in your Copyright © 2018, Penny Press routine. A lifestyle adjustment will give you more energy and a CROSSWORDS PUZZLE NO. 043 more active social life to boot. TAURUS ACROSS 47. Threat’s final word 17. Honorably Surprisingly, you’ll benefit from 51. Totally cool 21. “____ Town” (play) stress this week. It’ll give you the 1. Clutch 54. Carton 22. Expanded motivation to accomplish great 6. Smear 55. Kind of sauce 24. Evening garment things. Just make sure to balance 9. Not in tune 56. Storage crib the spheres of your life so you 25. Cake decorator can better channel your energy. 12. An ____ of 57. Challenger 26. Vogue 58. Weed tool prevention . . . 27. Fax GEMINI 13. Wise bird 59. Puzzling 28. Jeans patch site Everything will fall into place and 14. Trouble 60. 12-month periods allow you to start a small business 15. Fantastic! 29. Cherished one or move into a position of autho- 31. Overwrought rity at work. You’ll discover your 16. Smiled broadly natural leadership skills. 18. Stitched 34. Divisions 19. Memo error 36. “____ Me No CANCER 20. Nero’s garment DOWN Questions” A tropical vacation is on the ho- 23. Border 39. Show up rizon. Even if your departure date is a few months away, you 27. Alpine slider 1. Gear teeth 43. Unearthly should take care of certain prep- 30. Compulsion 2. Angler’s bait 45. Wanderer arations now like renewing your 32. Loony 3. From scratch 46. Among passport and getting vaccinated. 33. Undergo 4. Meager 48. Igneous flow 35. Studio couch LEO 5. Goldfish, e.g. 49. Night sight 37. Bright light You may witness an injustice that 6. GI’s ID 38. Wiggles, as a tail 50. Slippery fellows spurs a reaction from several 7. Wrong people around you. In the after- 40. Previous to, 51. Charcoal residue math, you’ll play an important role poetically 8. Radar-screen spot 52. Court, as a in restoring harmony and sug- 41. Appetizing store 9. ____ up (confess) sweetheart gesting appropriate changes. 42. Tot 10. Enemy 53. Gaze at VIRGO 44. Not this 11. Gave lunch to 54. Wail If you witness an injustice, you’ll be tempted to take things into your own hands. As you look for a resolution, you’ll need to consider all the angles. Make sure to rely on tact and delicacy to handle the situation. LIBRA You’ll be relentless in your at- tempts to reach an agreement or complete a transaction at work. You may experience a fair amount of anxiety and insomnia, but im- mense success awaits. SCORPIO You’ll be offered a leadership po- sition at work, but be sure to carefully reflect before you ac- cept. To avoid adverse fluctua- tions in your health, you must learn to express your emotions as they arise. SAGITTARIUS You’ll get almost instant results from starting a new diet and exer- cise routine. A strong sense of satisfaction and pride will come from having taken up the chal- lenge to improve your health. CAPRICORN You’ll find it easy to speak up and express what others are keeping to themselves. However, some people might be quick to criti- cize you so be careful not to make inappropriate or off-hand remarks. AQUARIUS If your finances are strained, it’s Creamy Rice With Roasted Shrimp FAVORITES important to carefully review your Submit your favorite recipe to [email protected] invoices. An error might have and Tomatoes been made, and correcting it could save you an unnecessary đ'8;,'£!A@&!@93(9<11'8T(!££3đ'2!88-='9>-;,6!$0'&9$,'&<£'9!2&'='8@32'+'ষ2+#!$032;8!$0T>,';,'8(38>380 expense or allow you to get a considerable sum of money back. 389$,33£W='27<-$01'!£9$!29'8='<69-+2-)$!2;*!=3<8W PISCES You’ll participate in a personal INGREDIENTS DIRECTIONS: or professional activity that will '8='9‹ bring out your competitive side. 1. Heat oven to 400 F. Heat 1 tablespoon of the oil in a large saucepan over medium heat. Add the onion Your refusal to come in second place will lead you to victory and 2 tablespoons olive oil !2&$330<2ধ£93đTŒ;31-2<;'9W&&;,'8-$'!2&>-2'!2&$330T9ধ88-2+T<2ধ£;,'>-2'-9!#938#'&T fill you with pride. ˆ 32-32T)2'£@$,366'& 1 to 2 minutes. ˆ $<68#38-38-$' ‰W &&‰$<69>!;'8!2&ˆ‹ teaspoon each salt and pepper ˆ $<6&8@>,-;'>-2' ;3;,'9!<$'6!2W-11'8T  39,'89!£;!2&#£!$06'66'8 $3='8'&T<2ধ£;,'>!;'8-9 ˆ 63<2&6''£'&!2&&'='-2'& !#938#'&!2&;,'8-$'-9;'2&'8T  1'&-<19,8-16 18 to 20 minutes. ‰ 6-2;9+8!6';31!;3'9 ŠW '!2>,-£'T32!8-11'& ¥ 968-+9(8'9,;,@1' #!0-2+9,'';T;399;,'9,8-16T ;31!;3'9T;,@1'T!2&+!8£-$ ‰ $£3='9+!8£-$ >-;,;,'8'1!-2-2+;!#£'96332 3(3-£!2&ˆ‰;'!96332'!$, 9!£;!2&6'66'8W3!9;<2ধ£;,' 9,8-16!8'36!7<';,83<+,3<;T ˆŒ;3‰‡1-2<;'9W'8='3='8 the rice. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 19 Neighbourly Advice - Ray Maher On Labor Day, Ed I agree with Ed that no Moses instructed the Is- make us weary. We need called from Saskatche- one should ever underes- raelites: “Six days you to sow daily compassion, WHITEWOOD AND AREA wan. He was ready to har- timate a farmer even in shall labor and do all forgiveness, understand- KNOX ST. JOSEPH’S ROMAN vest, but his crops were next year’s country. your work, but the seventh ing, and kindness and PRESBYTERIAN CHURCH CATHOLIC CHURCH 6HUYLFHVDP not fully ripe. He said the Sometimes job stress day is a Sabbath to the not give up because there 6HSWHPEHU6XQGD\0DVV 5HY6HRQ2N/HH DP weather would determine is forced on people by cir- Lord your God. On it, you does not seem to be a har- how quickly he would be cumstances beyond their shall not do any work … vest in those closest to us NEW LIFE ST. JOHN’S LUTHERAN COMMUNITY CHURCH CHURCH, WAPELLA in his fields. control. In the book of Remember that you were or those we deal with reg- 6HSWQRRQ :RUVKLS6HUYLFHaDP My old neighbor Exodus in the Bible, the slaves in Egypt and the ularly. &RPPXQLRQ6HUYLFH claims he always has Israelites in Egypt mul- Lord your God brought At the proper time, God :HGa.LGV&OXEaSP +HOGDW1HZ/LIH&KXUFK ST. MARY’S great passion and eager- tiplied in number, and you out of there with a will produce a harvest $JHV  ANGLICAN CHURCH ness the first day of com- a new king who knew mighty hand and an out- )ULa

',5(&725< $'9(57,6,1* $ *5$1,7(0$5%/( for only 10* / week %521=(02180(176 0XVWEHSUHSDLGSOXV*67 6HFRQG,QVFULSWLRQV 5HJXODUUDWHLVSOXV*67SHU\HDU 9DVHV&UHPDWLRQ8UQV /LFHQVHGDQG%RQGHG *UDVVODQGV1HZV*URXS 'HQQLV7HPSOH 306-332-1335 1-844-464-6397 or 306-728-8197 ext 230 Melville’s Churches Welcome You Tubman Funeral Home Cremation and Funeral Services

Melville Anglican Lutheran Ecumenical %(7+$1<(9$1*(/,&$/ /RFDWHGDWWK$YH:DQG0DLQ6W0HOYLOOH6. Denton Keating Community - MALEC 0,66,21$5<&+85&+ 210 Claude Street * * * ´7UHDWLQJ

visit us on our Website or Facebook Page *22'6+(3+(5'/87+(5$1&+85&+ WK$YH:²3K Matthews Funeral Home ),56781,7('&+85&+ 3DVWRU'RXJ6FKPLUOHU WK$YH( .LQJ6W IDFHERRNFRPJVOFPHOYLOOH Melville’s only locally-owned funeral home. 2IÀFH+RXUV 0RQ7XHV7KXUVDPQRRQ Sunday Services: DP,QSHUVRQDQGRQOLQHVHUYLFHV %UDQFKRI¿FHLQ:KLWHZRRG 3K %XULDODQGFUHPDWLRQVHUYLFHVJULHIVXSSRUW 5HY%ULDQ0HH3K 67*(25*(·68.5$,1,$1 FHPHWHU\PHPRULDOVQRWDU\SXEOLF ZHEVLWHÀUVWXQLWHGPHOYLOOHRUJ &$7+2/,&&+85&+ :HKDYHUHWXUQHGWRUHJXODURIÀFHKRXUVDQG &RUQHURIUG$YH( 0DQLWRED6W 0HOYLOOH²:KLWHZRRG FKXUFKUHRSHQLQJZLWK&29,'SURWRFDOVLQSODFH )U%DVLO0DORZDQ\ EDVLOPDORZDQ\#JPDLOFRP² Sept. 27: Mark and Gaylene Matthews and staff DP:RUVKLS6HUYLFHZLWK5D\

Obituary Elmer Murphy George Obituary Julia (Judy) Talbot Memorium Notice to Creditors Nov. 2, 1933 - Sept. 16, 2020 March 8, 1928 – Sept. 14, 2020 NOTICE TO CREDITORS +$/<.²(GLWK6HSW  ,Q WKH (VWDWH RI Rose Novak, (YHU\GD\LQVRPHVPDOOZD\  Elmer (Mike) George was 2Q0RQGD\6HSW ODWH RI 0HOYLOOH 6DVNDWFKHZDQ 0HPRULHVRI\RXFRPHRXUZD\ GHFHDVHG ERUQ 1RY   WKH ¿IWK FKLOG -XG\ 7DOERW SDVVHG DZD\ 7KRXJKDEVHQW\RXDUHDOZD\V  $OO FODLPV DJDLQVW WKH DERYH RI$OH[DQGHUDQG&ODUD QHH$OH[ SHDFHIXOO\DWDJHDWWKH(V near (VWDWH GXO\ YHULILHG E\ VWDWXWRU\ son) George. Elmer George was WHUKD]\ &DUH +RPH ZLWK KHU 6WLOOPLVVHGORYHGDQGDOZD\VQHDU GHFODUDWLRQDQGZLWKSDUWLFXODUVDQG D PHPEHU RI WKH 2FKDSRZDFH GDXJKWHU-HDQHWWHKROGLQJKHU ²)RUHYHU UHPHPEHUHG DQG ORYHG YDOXDWLRQ RI VHFXULW\ KHOG LI DQ\ %U\DQ-DQHDQGIDPLO\%UHQGDDQG PXVW EH VHQW WR WKH XQGHUVLJQHG 1DWLRQ DQG ZDV WKH JUHDWJUHDW KDQG IDPLO\ F EHIRUH WKH WK GD\ RI 2FWREHU JUDQGVRQ RI &KLHI .DNLVLZHZ -XG\ ZDV ERUQ 0DUFK   /RXG 9RLFH  VLJQDWRU\ WR 7UHDW\ WR3DXOLQDDQG-DFRE.R .5(./(:,&+ &+$0%(56 Four. SHWVNL DW KRPH LQ WKH &RWKDP %DUULVWHUV 6ROLFLWRUV UG$YHQXH(DVW (OPHU DWWHQGHG WKH 5RXQG 'LVWULFW VRXWK RI 'XEXF 6KH 0HOYLOOH6DVNDWFKHZDQ /DNH 5HVLGHQWLDO 6FKRRO IURP JUHZ XS LQ D IDPLO\ ZLWK QLQH 6$3  WR  ZKHUH KH OHDUQHG VLVWHUV DQG RQH EURWKHU 7KH\  6ROLFLWRUVIRUWKH(VWDWH WKHUXGLPHQWVRIIDUPLQJDQGORRNLQJDIWHUOLYHVWRFN+HDOVRHQ DWWHQGHG &RWKDP 6FKRRO     F MR\HGWHDPVSRUWVDWVFKRRODQGZDVWKHSLWFKHURIWKH5RXQG/DNH ZHQWWRWKH&DWKROLF&KXUFKLQ %UDYHVEDVHEDOOWHDP+HSOD\HGRQWKHKRFNH\WHDPDVZHOO *UD\VRQ DQG JUHZ XS RQ WKH ,Q KLV HDUOLHU \HDUV KH ZRUNHG IRU WKH7UDQV &DQDGD 3LSHOLQH IDPLO\IDUP+HU¿UVWMREDZD\ Personal DQGWKH&35EXWHYHQWXDOO\UHWXUQHGKRPHWRIDUPDQGUDLVHFDWWOH IURPKRPHZDVDVDKLUHGJLUOZLWK/LO\DQG&RQ%HOODQGWKHLU '(&(170$1VHHNLQJDODG\FRP RQ2FKDSRZDFH+HDOVRZRUNHGDVDFRZER\DWWKH2FKDSRZDFH \RXQJIDPLO\ZKHQVKHZDV,QDWDZKLVWGULYHDW SDQLRQ EHWZHHQ  DQG  \HDUV &RPPXQLW\3DVWXUH(OPHUORYHGKRUVHVDQGORYHGWRULGH(OPHU /DUVRQ6FKRROVKHPHW-RKQ7DOERWDKDQGVRPHIDUPHUIURP RIDJHLQWKHDUHDVRI0RRVRPLQWR ZDVSUR¿FLHQWDVDFDUSHQWHU+HGURYHVFKRROEXVIRUDQXPEHU )UHHGKRPH6KHODWHUZDVDZDLWUHVVDWWKH%RVWRQ&DIpLQ *UHQIHOO DQG (VWHUKD]\ WR &DUO\OH RI\HDUV/DWHUGHVSLWHIDLOLQJYLVLRQ(OPHUDOVRWDXJKWWKH&UHH

CLASSIFIED RATES 1 week: $12.00 • 2 weeks: $18.00 • 3 weeks: $24.00 • 4 weeks: $28.00 1-844-GNG-NEWS (based on 25 words or less) Additional weeks: $2.50 • Deadline: Tuesdays at 12 noon Email: [email protected] www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 21 Prairie Co-operative Ltd. NOTICE The Tax Enforcement Act FORM C (Section 6) Fuel Good raises funds for Legions Village of Abernethy  7$.(127,&(WKDWWKH9,//$*(2)$%(51(7+<LQWHQGVWREH By Emily Jane Fulford communities. Their focus UHJLVWHUHGSXUVXDQWWRWKHDERYH$FWDVRZQHURIWKHODQGGHVFULEHG Grasslands News on community-minded- EHORZ ness reflects our values NORMA-JEAN DUBRAY/BYRD 1DPHRI$VVHVVHG2ZQHU as a Co-op.” Legal Description of Land(s) Title Number(s) Melville Co-op mem- Over 400 Co-op gas /RW%ORFN3ODQ&  bers and customers re- bars throughout British  7KH PXQLFLSDOLW\ FODLPV WLWOH WR WKH ODQG E\ YLUWXH RI DQ LQWHUHVW cently pumped up the Columbia, Alberta, Sas- EDVHGRQWKHWD[OLHQUHJLVWHUHGDJDLQVWWKHH[LVWLQJWLWOHWRWKHODQGLQ community and the Co-op WKH/DQG7LWOHV5HJLVWU\DV,QWHUHVW1XPEHU katchewan, Manitoba and would like to say thank of directors were respon- DQG\RXDUHUHTXLUHGWR7$.(127,&(WKDWXQOHVV\RX northwestern Ontario, you for the support. sible for selecting the FRQWHVWWKHFODLPRIWKHPXQLFLSDOLW\RUUHGHHPWKHODQGSXUVXDQWWR celebrated Fuel Good On Sept. 15, Prairie community group which WKHSURYLVLRQVRIWKHDERYH$FWZLWKLQVL[PRQWKVIURPWKHVHUYLFHRI Day this year. Each local would benefit from the WKLV QRWLFH RQ \RX DQG VXEMHFW WR WKH IXUWKHU SURYLVLRQV RI The Tax Co-op raised $3,686.40 for Co-op selected a commu- Fuel Good Day dona- Enforcement ActDWLWOHZLOOEHLVVXHGWRWKHDSSOLFDQW the Royal Canadian Le- tions to raise money, nity organization or ini- gions of Melville, Lem- tions. This year, however, but this year, because of  2QDQGDIWHUWKHGDWHWKDWWKHWLWOHLVLVVXHGWRWKHDSSOLFDQW\RX tiative to support. ZLOOEHIRUHYHUHVWRSSHGDQGGHEDUUHGIURPVHWWLQJXSDQ\FODLPWRRU berg, Lipton, Kelliher, Prairie Co-Op decided to COVID restrictions, this “Last year, Co-op loca- ZLWKUHVSHFWWRWKHODQG Fort Qu’Appelle and open up the process and is not possible,” explains tions across Western Can-  7KHDPRXQWUHTXLUHGWRUHGHHPWKHODQGPD\EHDVFHUWDLQHGRQ Cupar, which means that requested nominations Wihak. ada donated over $685,000 DSSOLFDWLRQWRWKH&OHUN7UHDVXUHURU$GPLQLVWUDWRURIWKHPXQLFLSDOLW\ to be submitted by their each Legion will receive “We chose the Royal from Fuel Good Day,  'DWHGWKLVWKGD\RI6HSWHPEHU staff members. $614.40 as part of Fuel Canadian Legions as the with nearly $1.9 million 6KHUHH(PPHUVRQ “Our team members recipients of the Fuel Good Day. During the donated to more than 400 7UHDVXUHU are very communi- Good Day funds raised day, 10 cents from every local charities and non- ty-minded,” said Prairie because Legion branches litre of gasoline and die- profit organizations since Co-op marketing special- are the cornerstone of sel purchased at Prairie 2017,” said Wihak. “The ist, Kim Wihak. “It’s one communities across Can- Co-op gas bars were do- total result from across of the key ideas behind ada. They provide one NOTICE nated to the organization. Western Canada for 2020 the Co-op system and we of the largest volunteer The Tax Enforcement Act “As a locally owned will be released in early wanted them to help us bases in the country. FORM C (Section 6) and operated business, October and will be avail- choose where the money Their members provide Village of Abernethy we’re proud to give back able on www.fuel.crs, would go.” local services and sup- and get behind local ini- along with the complete  7$.(127,&(WKDWWKH9,//$*(2)$%(51(7+<LQWHQGVWREH With so many loca- port to build a stronger tiatives that are work- list of supported organi- UHJLVWHUHGSXUVXDQWWRWKHDERYH$FWDVRZQHURIWKHODQGGHVFULEHG tions across the west Canada. Whether helping EHORZ ing to address the needs zations.” of our community,” said coast, it’s important to local veterans, supporting RICHARD BYRD 1DPHRI$VVHVVHG2ZQHU Chris Paradis, general include multiple districts seniors, providing youth Legal Description of Land(s) Title Number(s) manager of Prairie Co-op. so as to promote inclu- sports programs, raising /RW%ORFN3ODQ&  “Thank you to our mem- siveness between areas. funds, or volunteering  7KH PXQLFLSDOLW\ FODLPV WLWOH WR WKH ODQG E\ YLUWXH RI DQ LQWHUHVW bers and customers for “Prairie Co-op encom- to help those in need, EDVHGRQWKHWD[OLHQUHJLVWHUHGDJDLQVWWKHH[LVWLQJWLWOHWRWKHODQGLQ the support you’ve shown passes a wide geographic Legionnaires provide es- WKH/DQG7LWOHV5HJLVWU\DV,QWHUHVW1XPEHU DQG\RXDUHUHTXLUHGWR7$.(127,&(WKDWXQOHVV\RX during Fuel Good Day. area, and we want to sential services in their FRQWHVWWKHFODLPRIWKHPXQLFLSDOLW\RUUHGHHPWKHODQGSXUVXDQWWR In these unprecedented try and choose charities WKHSURYLVLRQVRIWKHDERYH$FWZLWKLQVL[PRQWKVIURPWKHVHUYLFHRI times, it’s amazing to see or groups that reach as WKLV QRWLFH RQ \RX DQG VXEMHFW WR WKH IXUWKHU SURYLVLRQV RI The Tax what we can accomplish many of our Prairie Co-op Enforcement ActDWLWOHZLOOEHLVVXHGWRWKHDSSOLFDQW when we all work to- communities as possible.  2QDQGDIWHUWKHGDWHWKDWWKHWLWOHLVLVVXHGWRWKHDSSOLFDQW\RX gether.” In the past, we also held ZLOOEHIRUHYHUHVWRSSHGDQGGHEDUUHGIURPVHWWLQJXSDQ\FODLPWRRU In the past, the board barbecues at our loca- ZLWKUHVSHFWWRWKHODQG  7KHDPRXQWUHTXLUHGWRUHGHHPWKHODQGPD\EHDVFHUWDLQHGRQ Help keep your community’s history alive. DSSOLFDWLRQWRWKH&OHUN7UHDVXUHURU$GPLQLVWUDWRURIWKHPXQLFLSDOLW\ SUBSCRIBE TO YOUR LOCAL NEWSPAPER!  'DWHGWKLVWKGD\RI6HSWHPEHU Call Toll Free: 1-844-GNG-NEWS 6KHUHH(PPHUVRQ [email protected] 7UHDVXUHU

Heavy Duty Mechanics, Province Wide Heavy Equipment FARMLAND Operators and Contractors and Home 1257+ ($67 35$,5,( *5$,1 1A Drivers required: WANTED ,1& %8<,1* )((' %$5/(< 62<%($16 '$0$*(' &$12/$ Late model, clean 2Q )DUP 3LFNXS 3URPSW 3D\PHQW CAT, JD equip: winch, 3+  :(%6,7( I am currenlty Directory dump, gravel trucks and QHSUDLULHJUDLQFRP ´,Q %XVLQHVV WR trailers. Both camp and PURCHASING single 6HUYH:HVWHUQ3URGXFHUVµ to large blocks of shop locations; R & B land. /$1' )25 6$/( 50   provided. GHHGHG DFUHV LQ :QG  DFUHV /HDVH DYDLODEOH WR TXDOLILHG Wage negotiable. NO FEES OR SHUVRQV )HQFHG DQG FURVV IHQFHG Clean drivers abstract COMMISISONS J&V ELECTRIC /RWV RI ZDWHU DQG JUDVV $OO LQ RQH a must. EORFN,QTXLULHV2IIHUVWR%R[%LJ Saskatchewan born %HDYHU6.6+* Send resume and and raised, I know Jamie Sebastian work references to: land, farming and Owner/Journeyman Bryden Construction farmland and can Box 2388, Fort Qu’Appelle, SK S0G 1S0 )V_(YIVYÄLSK:R help you every step TREE SERVICE :,(" of the way. [email protected] Fax: 306-769-8844 306-331-8742 - 306-331-8732 3062I¿FH ,THPS! Doug Rue, 306-331-8827 Cell brydenconstruct@ for further information Fort Qu’Appelle, SK xplornet.ca 306-716-2671 www.whitingtreeservice.ca Serving Fort Qu’Appelle and area for over 25 years www. [email protected] brydenconstruction www.sellyourfarm andtransport.ca land.com FlatLand LAND FOR SALE Plumbing & Heating 117 - 3rd Ave. West, Melville, SK BY SEALED TENDER 306-728-5493 ž,'#8!2&9@3<023>W  7KH7RZQRI*UHQIHOORIIHUVIRUVDOHWKHIROORZLQJODQG Whitewood, SK. ž,'9'8=-$'@3<;8<9;W LOT 9 BLK/PAR 152 PLAN NO 101271237 EXT 0 Phone: 306-735-4328 ž,'=!£<'@3<&'9'8='W 414 STELLA STREET Mon., Tues., Wed. & Fri. 9:00 a.m. to 5:30 p.m. [email protected] Thurs. 9:00 a.m. to 6:00 p.m., Sat. 9:00 a.m. to 3:00 p.m.  7KH7RZQLVQRZDFFHSWLQJWHQGHUVIURPLQWHUHVWHG SDUWLHV IRU WKH VDOH RI WKH DERYH ODQG DFTXLUHG WKURXJK WD[ HQIRUFHPHQW SURFHHGLQJV 7KH 7RZQ UHVHUYHV WKH ULJKW WR UHMHFW DQ\ RU DOO ELGV UHFHLYHG 7HQGHU SDFNDJHV WKDWLQFOXGHWKH,QVWUXFWLRQVWR%LGGHUVDQG7HQGHU)RUP FDQEHSLFNHGXSDWWKH7RZQRI*UHQIHOO'HVPRQG 6W *UHQIHOO )RU PRUH LQIRUPDWLRQ FRQWDFW WKH 7RZQ RI Whitewood, SK *UHQIHOODW   The Town will consider all bid proposals with deadline for receipt of any tenders of Wednesday, October 14, 2020 at 4:30 p.m. 7HQGHUV VKRXOG EH PDUNHG ´3523(57< 7(1'(5 /$1'7(1'(5µ 22 September 25, 2020 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Prairie Valley School Division School division nominations accepted until Oct. 7

By Elaine Ashfield Valley School Division for the sub-divisions in Glenavon, Windthorst, Advance Polls and Notice 8, 2020 with the nomina- Grasslands News Office at 3080 Albert the surrounding areas Kipling, Kennedy, Lang- of Abandonment of Polls tion date for second call Street N, Regina, SK. S4P are: bank, Corning - Terry if a candidate is elected closing on Oct. 21, 2020 at 3E1 or fax to 306-949-1277. Sub-division No. 3 of Berglund. by acclamation. 4 p.m. and the Notice of Nominations are now Regular mail nomina- Lipton, Fort Qu’Appelle Sub-division No. 7 In the case where there Election, Advanced Polls being accepted for can- tions should be sent to and Balcarres - Marlene of Qu’Appelle, McLean, are no nominations for a and Abandonment of didates for the Board of Prairie Valley School Di- Blatter. Vibank, Odessa, Kendal, sub-division, a second Polls will follow. Education for all Subdi- vision #208, Box 1937, 3080 Sub-division No. 4 of Montmartre, Candiac and call for nominations may Watch for further no- visions of Prairie Valley Albert Street N, Regina, Abernethy, Lemberg, Francis - Janet Kotylak. also be posted as soon as tifications following Oct. School Division. SK. S4P 3E1 or email to Neudorf, Indian Head, Nomination Day ends possible following Oct. 8, 2020. Subdivisions No. 1 to [email protected] (The Wolseley, Sintaluta - Jef- on Oct. 7, 2020 at 4 p.m. Number 10 each have time stamp validation for frey Baran. and nominations can be a representative (board electronic submissions Sub-division No. 5 of withdrawn until 4 p.m. on member) elected to repre- will be that of the PVSD Grenfell, Broadview and Oct. 8, 2020. NOTICE OF CALL FOR sent them at the Board of mail server). Whitewood - Denise Cou- Notices will then follow Education. Nomination forms and ture. for Notice of Elections, NOMINATIONS Nominations are being other information are Sub-division No. 6 of Notice of Polls, Notice of The Rural Municipality of Chester No. 125 received until Oct. 7, 2020 available from the indi- during normal business viduals mentioned above, PUBLIC NOTICE is hereby given that nominations hours and also on Oct. from any of the schools of candidates for the offi ces of: 7 from 9 a.m. to 4 p.m. in the school division or Reeve for the RM of Chester #125 They may be submitted GET IT WEEKLY from the www.pvsd.ca Councillor for Division 1 - RM of Chester #125 to the nomination officers web site. Ginny Buchko or Nicola Councillor for Division 3 - RM of Chester #125 The Board of Educa- Subscribe for as little as $37.80 a year! Saunders at the Prairie Councillor for Division 5 - RM of Chester #125 tion directors at present 1-844-GNG-NEWS – will be received by the undersigned from Friday, FRQWDFW#JUDVVODQGVQHZVFD Sept. 25, 2020 until Wednesday, Oct. 7, 2020 at the municipal offi ce in Glenavon during regular offi ce OFFICE ASSISTANT hours. Nomination forms may be obtained from the Rural Municipality of Cana No. 214 municipal offi ce in Glenavon. 7KH50RI&DQD1RLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQ Dated this 25th day of September, 2020. RI SDUWWLPH 2IILFH $VVLVWDQW LQ WKH PXQLFLSDO DGPLQLVWUDWLRQ J.R. Hoff , RIILFH7KLVLVDSDUWWLPHSRVLWLRQIRUDSSUR[LPDWHO\WKUHHGD\V Returning Offi cer SHUZHHNVHYHQKRXUVSHUGD\0RQGD\WKURXJK)ULGD\DP WRSP  7KHVXFFHVVIXOFDQGLGDWHPD\KDYHYDULRXVW\SHVRIH[SHUL HQFHLQRIILFHDVVLVWDQWDGPLQLVWUDWLRQDQGSRVVHVVZHOOGHYHO RSHG LQWHUSHUVRQDO FRPPXQLFDWLRQ DQG RUJDQL]DWLRQDO VNLOOV NOTICE OF CALL 3OHDVHFRQWDFWWKHPXQLFLSDORIILFHIRUDGHWDLOHGMREGHVFULSWLRQ 3UHIHUHQFHZLOOEHJLYHQWRFDQGLGDWHVZKRSRVVHVVWKHIROORZ FOR NOMINATIONS LQJ  ‡&HUWLILFDWHIURPDEXVLQHVVUHODWHGSURJUDPRUUHODWLYHZRUN Village of Fenwood  H[SHULHQFH 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWQRPLQDWLRQVRI  ‡3URILFLHQF\ZLWK0LFURVRIW2IILFHSURJUDPV FDQGLGDWHVIRUWKHRIILFH V RI  ‡.QRZOHGJHLQEDVLFDFFRXQWLQJSULQFLSOHVDQGSUDFWLFHV  ‡([FHOOHQWFRPPXQLFDWLRQVNLOOVERWKYHUEDODQGZULWWHQ Councillor  ‡$ELOLW\WRGHDOHIIHFWLYHO\ZLWKWKHJHQHUDOSXEOLFDQGWRZRUN ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHGRQWKH4th day of  LQGHSHQGHQWO\ December, 2019IURP9:00 am to 4:00 p.m.ORFDOWLPH  7KH50RI&DQDRIIHUVFRPSHWLWLYHVDODU\EHQHILWVSDFNDJH at 425 Main Street, Fenwood, SKDQGGXULQJUHJXODU DQGSHQVLRQSODQ7KHVXFFHVVIXODSSOLFDQWVWDUWGDWHZLOOEHDV DJUHHGXSRQ SRVWHG RIILFH KRXUV RQ 1RYHPEHU  WR 'HFHPEHU   $SSOLFDQWV DUH LQYLWHG WR VXEPLW D UHVXPH GHWDLOLQJ TXDO  LILFDWLRQ H[SHULHQFH WKUHH UHIHUHQFHV DQG H[SHFWHG ZDJH 'HDGOLQH IRU UHFHLYLQJ DSSOLFDWLRQV LV 7KXUVGD\ 2FWREHU   1RPLQDWLRQV IRUPV PD\ EH REWDLQHG DW WKH 9LOODJH  WR WKH IROORZLQJ DGGUHVV HPDLO UPFDQD#VDVNWHOQHW RU RIILFH0DLQ6WUHHW)HQZRRG6. ID[  RU PDLO WR 50 RI &DQD 1R  32 %R[ th 0HOYLOOH6.6$3 'DWHGWKLV GD\RI1RYHPEHU The RM of Cana wishes to thank all applicants, $QJHOD'REVRQ but only those selected for an interview will be contacted. 5HWXUQLQJ2IILFHU

DISTRICT BUSINESS

LOCATED ON THE CORNER OF FIFTH & MAIN, MELVILLE “Treating Your Family Like DIRECTORY You Are A Part Of Ours” 306.728.5488 Expert Service from Trusted Professionals Raymond and Crystal Bailey Don Klus, Ron Wilson Marlene Muzyka and Len Varga Advertise in this directory! Starting at $10/month Contact www.baileysfuneralhome.com Grasslands news 306-728-5448 ext. 230 or email: [email protected]

• Deli Meats Stop In and See Us at Stockholm Agencies Ltd. • Jerky 113 Ohlen St., P.O. Box 322, Stockholm, Sask. •Barbecue Needs Tel.: 306.793.2900 Fax: 306.793.2959 Neudorf Email: [email protected] • Liquor Vendor  



 



  



 
Spirits &Wines • Personal Insurance • Farm Insurance • Full Service Gas Pumps













 



 




• Diesel Dye Pumps • Commercial Insurance • Hail Insurance  
 



 
 
  
• Tire Repair & Tires • Full Line of Hardware Grayson, SK • Health Insurance • Motor Licence Issuer & Automotive Supplies



 

 
'%"


&""

• Notary Public Phone: 306 794-2113 • Minor Automotive Repairs • Feed



 
(""


&""

• Bulk Petroleum
 

 

Business Hours: Business Hours: Tues. - Sat. Tuesday to Friday: 9:00 a.m.-12:00 noon & 1:00 to 5:00 p.m. Open Monday - Saturday (Closed Sunday)
%"&%%%$#$$
Saturday: 9:00 a.m. -12:00 noon Sunday & Monday - CLOSED 8:30 a.m. - 5:30 p.m. Closed Noon Phone 306-748-2474  



  





CHECK OUT OUR NEW WEBSITE! www.fi reworksinsaskatchewan.ca COMING SOON! Skies the Limit Store - in Grayson, SK Custom Shows • Large Assortment • 306.748.0070 or 306.794.4991 • [email protected] www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV September 25, 2020 23 TENDER COVID Alert App launched in Sask. Resort Village of B-Say-Tah The Health Canada continue following public utes over a 24-hour period ada.ca/en/public-health/ The RV of B-Say-Tah invites tenders to install a 20’ COVID Alert app is now health guidelines to pre- within the last 14 days. services/diseases/coro- wide swale with slight retaining pond along the South available to Saskatch- vent COVID-19 transmis- • Subscribers who re- navirus-disease-covid-19/ side of Mackie Trail, in the Village of B-Say-Tah. The ewan residents. Once sion and protect friends ceive this exposure alert covid-alert.html. swale will be located between the South West culvert downloaded to your and family,” Health Min- can assess their risk and The app is another and the South East Culvert of Mackie Trail. Two new smart phone, subscribers ister Jim Reiter said. seek testing. tool available to help pre- 24” culverts supplied by owner, to be installed by con- may participate in digital “Wash your hands fre- • All aspects of the app vent the transmission of tractor at the South East part of Mackie Street. Stump COVID-19 exposure alerts. quently, ensure you can are completely voluntary. COVID-19. All Saskatch- removal will be required where the swale to be located. “As more activities name every contact in The COVID Alert app ewan residents must Plans and additional information can be obtained at head indoors, Saskatch- your virtual household, does not collect personal continue to follow public WKH59RIÀFHRUE\HPDLO ewan residents should maintain physical dis- information or health health measures includ- Contractors must include with their tender the fol- tancing and wear a mask data, and does not know ing: lowing: when you cannot. The or track the location, • Stay home if you are • Equipment and material to be used COVID alert app is yet name, address or contacts experiencing symptoms, • Hourly rate Body of man another tool residents of any user. even mild ones; Tenders can be submitted by mail, email, faxed or have to stay safe during The COVID Alert app • Wash your hands fre- dropped off in person to the following address: this pandemic.” does not replace contact quently; Resort Village of B-Say-Tah found along The national COVID investigations; if you do • Maintain physical 842 Broadway St, E. Alert app uses Bluetooth not have a smartphone distancing of two metres; P.O. Box 908, Fort Qu’Appelle, SK S0G 1S0 technology to detect when or device that will sup- • Disinfecting high- Ph. 306-332-6449 Highway 16 users are near each other. port the app, you will touch surfaces and objects Fax. 306-332-2923 If a user tests positive still receive notification regularly; and Email: [email protected] On Sept. 16, officers for COVID-19, they can from public health offi- • Wearing a non-med- Please be advised that the lowest tender may not from the Yorkton RCMP choose to let other users cials if you have positive ical mask when you can- necessarily be chosen. Detachment, Yorkton know about potential test results or are deter- not maintain physical Tender Close Date: Oct 1, 2019 at 4:30 p.m. Tender RCMP Forensic Identi- exposure risk without mined to be a close con- distancing or required by Opening Date: October 2, 2020. fication Section and the sharing any personal in- tact of a confirmed case. the guidelines for your Thank you for your interest in this project Saskatchewan RCMP formation. Case information for your workplace or school. Major Crimes Unit-South • If you test positive for area of the province is (MCU-S) investigated the COVID-19 you will be pro- available at https://dash- report of human remains vided a one-time key from board.saskatchewan.ca/ located near Highway 16, public health upon notifi- health-wellness. approximately eight ki- cation of your status. The Health Canada TAX ENFORCEMENT LIST lometres west of Spring- • Enter the key into COVID Alert app is avail- Rural Municipality of Wolseley No. 155 side, SK. the app and it will notify able at no cost in the PROVINCE OF SASKATCHEWAN The body of an adult other app users who have Apple and Google Play Notice is hereby given under The Tax Enforcement Act that unless the arrears and costs male was located a short been within two metres app store. For more in- appearing opposite the land and title number described in the following list are fully paid distance off the highway. before the 25th day of November, 2020, an interest based on a tax lien will be registered of you for at least 15 min- formation, visit www.can- against the land. A forensic autopsy was Note: A sum for costs in an amount required by subsection 4(3) of The Tax Enforcement Act conducted on Sept. 21 in is included in the amount shown against each parcel. Saskatoon and the re- mains, were determined NOTICE OF CALL FOR DESCRIPTION OF PROPERTY to be 40-year-old Darwin Part /RW %ON 3ODQ ([WHQVLRQ 7RWDO Keith Whitehawk. He was RI/RW Adver- NOMINATIONS 7LWOH 7RWDO WLVLQJ $UUHDUV reported missing to the Part of 1XPEHU $UUHDUV &RVWV The Rural Municipality of Wolseley No. 155 6HF 7ZS 5DQJH3ODQ 0HULGLDQ &RVWV Yorkton RCMP Detach- Section ([WHQVLRQ 6XEGLYVLRQ ment in late July 2020. PUBLIC NOTICE is hereby given that nominations of NE 34 16 8 2 148631047 $1,045.24 $22.48 $1,067.72 Anyone with informa- candidates for the offi ces of: PT NW 34 16 8 2 148631069 $849.63 $22.48 $872.11 tion about the activities of Reeve NE 35 16 8 2 130582560 $1,188.75 $22.48 $1,211.23 Darwin Keith Whitehawk Councillor for Division 1 NW 35 16 8 2 148630901 $924.33 $22.48 $946.81 leading up to his disap- Councillor for Division 3 SE 35 16 8 2 148630956 $964.60 $22.48 $987.08 pearance in late July Councillor for Division 5 SW 35 16 8 2 148630945 $884.61 $22.48 $907.09 2020, is asked to contact will be received by the undersigned at the municipal offi ce LSD 11 NW 36 16 8 2 148630990 $574.78 $22.48 $597.26 LSD 14 NW 36 16 8 2 148630967 $609.84 $22.48 $632.32 the Yorkton RCMP at 306- during normal offi ce hours until Wednesday, October 7, 2020 at 4:00 p.m. local time. SE 2 17 8 2 148630923 $1,176.65 $22.48 $1,199.13 786-2400 or Saskatchewan Prescribed nomination forms may be obtained from the PT NE 13 17 9 2 148602797 $921.95 $22.48 $944.43 Crime Stoppers by calling municipal offi ce. PT NW 10 18 8 2 140440272 $420.82 $22.48 $443.30 1-800-222-TIPS (8477) or Dated this 25th day of September, 2020. Lots 9 - 12 Plan R1516 Titles 126771206, 1267711262, 126771385, 126771521 $751.16 $22.48 $773.64 submitting a tip online at Rose Zimmer, www.saskcrimestoppers. Returning Offi cer Dated this 25th day of September 2020 at Wolseley, Saskatchewan com Rose Zimmer, Administrator

STILL OPEN FOR BUSINESS We are still here to serve you, at a social distance of course! RENOVATIONS & BOBCAT WORK • Concrete driveways, walks & garage pads installed Contractors and Home • Paving stone driveways & walks installed • Paving stones releveled Free estimates, 24 hour emergency service • Yard clean-up Danny Currie, Journeyman Electrician Directory [email protected] Brian Gordon Fort Qu’Appelle, SK 306-331-6588 echoelectric.ca Locally owned and operated serving fort qu’appelle and 1-306-530-4550 surrounding area call or email today!

-LP·V5RRÀQJ Pole Buildings Home - Kitchen - Bath +RW5RRÀQJ6KLQJOLQJ Everything for your home under one roof. 6QRZ5HPRYDOIURP5RRIV ‡7UDFNKRH‡'R]HU‡/RDGHU • HARDWOOD • CARPET • LAMINATE • LUXURY VINYL )5(((VWLPDWHV ‡*UDGHU‡6NLG6WHHU • TILE • AREA RUGS & MORE ‡+\GUR‡9DF7UXFN‡%DFNKRH Jim Anderson ‡7UXFNV *UDYHO /RZ%R\  ‡6SHFLDOL]LQJLQEDVHPHQWVVHZHUDQGZDVWH ‡&RPPHUFLDO UHVLGHQWLDOIDUPVGXJRXWVHWF 110 - 3rd Ave. W., Melville, SK | 306.725-5432 | 1.877.728.5432 Cell: 1-306-621-6372 carpet1melville.com 12 Livingstone St., Yorkton, SK | 306.782.6556 | 1.888.782.6556 MLPVURRÀQJ#OLYHFD 306-740-7805 or 306-745-7226 carpet1yorkton.com Melville, Sk Whitewood, SK Photos for illustrative purposes only. ©2017 Carpet One Floor & Home. All Rights Reserved.

DO YOU NEED “We specialize in all your building needs” Mr T’s Plumbing Invoices, Business 197 Victoria Ave. We’re here to HELP! and Heating Fort Qu’Appelle Your Success is Our Success. Todd Th rossell Cards or Any Kind Journeyman Plumber Licensed Gas Fitter of Printing? HOURS Your support makes our community Mon. - Fri. 7 a.m. - 5 p.m. stronger by shopping locally! 813 Desmond St., Sat. - 8 a.m. - 4 p.m. P.O. Box 296, Contact: Grenfell, SK Grasslands News 1-306-332-2833 We take pride in servicing S0G 2B0 and serving our community! Ph.: 1-306-697-2727 1-844-464-6397 ext 229 Cell: 1-306-697-7749 www.friestallman.com [email protected] 24 September 25, 2020 )RUW4X·$SSHOOH7LPHV Grasslands News

www.remax-bluechip-yorkton-sk.ca Blue Chip Realty 269A Hamilton Road, Yorkton, SK Phone: 306-783-6666 SERVING MELVILLE AND AREA Each Offi ce is Independently Owned & Operated

$25,000 $39,90039,9, 000 $44,900 $45,900 $49,500 JUST LISTED

522 - 3rd Ave. W. 442 - 4th Ave. E. 2 Abel Bay 341 - 8th Ave. W. 365 - 6th Ave. W. MLS®SK802964 MLS®SK826328 MLS®SK789696 MLS®SK790202 MLS®SK824175

$54,90054,900 $56,500 $59,90059,9000 $64,900 $69,900 $76,90076,9000 JUST LISTED

317 - 4th Ave. W. 327/333 - 6th Ave. E. 147 - 8th Ave. E. 201 Alberta St. 368 Manitoba St. 159 - 5th Ave. W. MLS®SK825946 MLS®SK804573 MLS®SK827424 MLS®SK818796 MLS®SK826083 MLS®SK821969

$87,000 $89,900 $105,000105,,0000 $119,000 $129,000 $149,000 PRICE REDUCED

301 - 5th Ave. E 256 - 6th Ave. E. 328 - 7th Ave. W. 371 - 9th Ave. W. 829 Main St. 329 - 3rd Ave. W. MLS®SK810235 MLS®SK798466 MLS®SK803520 MLS®SK825941 MLS®SK824177 MLS®SK823956 $159,900 $199,500 $199,900 $219,000219,000 We’re In Your Neighbourhood PRICE REDUCED

253 - 7th Ave. E. 423 - 9th Ave. W. 118 - 9th Ave. W. 158 - 11th Ave. W. MLS®SK813630 MLS®SK817235 MLS®SK805011 MLS®SK814780 $245,000 $255,000 $256,900 $289,900

Shawn Pryhitka Lisa Kirkwood 7 Carlton Bay 980 Montreal St. Agriculture Specialist Residential Specialist 24 Centennial Cres. 8 Carlton Bay MLS®SK809915 MLS®SK810679 306-621-9798 306-728-6789 MLS®SK822053 MLS®SK813274 [email protected] $79,000 $69,000 [email protected] $125,000 $329,000 Let Us Help You Find

14 Anderson Dr., Crooked 44 Indian Point, Crooked What You’re Looking For! 108 Indian Point, Crooked 99-20 Indian Point, Crooked Lake MLS®SK806293 Lake MLS®SK818071 Lake MLS®SK814800 Lake MLS®SK804429 $359,000 $99,900 Residential, Recreational, $105,000 $77,000 Acreages,

208-210 Criddle Ave - Crooked 124 - 3rd St. NE., Ituna 537 - 5th St. SE - Ituna 205 Taylor St. - Neudorf Lake MLS®SK817614 MLS®SK788932 Farms and Land. MLS®SK823881 MLS®SK815620

$233,000 $649,000 $3,148,300 $170,000 $275,000 $299,900

RM of Foam Lake RM of Good Lake RM of Insinger RM of Stanley #215 - RM of Stanley #215 - RM of Stanley #215 - MLS®SK814458 MLS®SK817569 MLS®SK814639 Land MLS®SK818909 Land MLS®SK821613 Acreage MLS®SK818928

$465,000 $165,000 $485,000 $1,200,000 $549,000549,,000 $285,000 PRICE REDUCED

RM of Stanley #215 - RM of Orkney, Acreage RM of Orkney, LAND RM of Orkney, York Lake RM of Wallace #243 - RM of Willowdale #153 Farm MLS®SK818914 MLS®SK806621 MLS®SK806602 Land MLS®SK813504 Acreage MLS®SK817645 MLS®SK796383