Annual Conference Preview by MARIAM PERA

YOUR AD HERE In the Library n ACTIVISM Going Digital n NEWSMAKER Alice Walker

JUNE 2013

THE MAGAZINE OF THE AMERICAN LIBRARY ASSOCIATION Chicago Annual Conference PLUS Preview n Tastes of Chicago n The Void in Charter Schools n Sound Literature 100% of the New York Times hardcover ﬁ ction bestsellers available to libraries as eAudio are on OneClickdigital.

The OneClickdigital homepage is the place for your patrons to © Recorded Books, LLC © Recorded Books, LLC ﬁ nd the New York Times bestseller list—no search required. FREE mobile apps and patron support are included with the service.

Visit booth #644 at ALA in Chicago!

Visit www.recordedbooks.com/oneclickdigital or give us a call at 1-877-828-2833 A new approach to discovery, library automation, and mobile access

Did you know? Infor powers some of the world’s leading libraries, including the City of Paris Library Network in France, the Amsterdam Public Library in the Netherlands, and the Vatican Library. By using our automation solutions, which include everything from an integrated library system to a discovery platform and mobile access, libraries across the globe deliver more services and provide better access to rich collections. We’re at ALA annual in Chicago. Visit us at booth # 1524.

Scan the QR code to get in touch or visit us at http://go.infor.com/libraries/ Infor End-To-End Solutions for Libraries

Our solutions include: • Infor Libraries Iguana: A visually appealing, collaborative and easy to manage web portal and discovery platform. Iguana brings a library’s website and catalog together in one environment. • Infor Libraries V-smart: A full-featured, web-based integrated library system. With V-smart, you get efficient workflows, flexibility, and a way to showcase collections of any kind. • Infor Libraries V-insight: A powerful business analysis portal that provides key data and metrics for effective decision making. • Infor Libraries NOW: A cost-effective mobile app and website that works with most back-end- systems (ILS). We can use your existing mobile catalog or create a mobile catalog specifically for you.

A customer experience Using Infor Iguana, Kingston Frontenac Public Library in Kingston Ontario, Canada, merged its website and catalog. Now library users enjoy one-stop access to collections and services. The end-result: More engaged users who explore collections and partake in the many services that the library offers. “Iguana just fits the bill.”—Lester Webb, Director, Outreach and Technology, Kingston Frontenac Public Library

Why Infor? A recent Pew Internet & American Life Project study confirms that 91% of Americans ages 16 and older say public libraries are important to their communities. What’s more, the widespread use of technology is changing the way library users expect to access not only library materials but also library services such as job search help, homework assistance, meeting rooms, and much more.

While the public has high expectations from the library and the services it provides, budgets are tight. With the right solution, libraries can deliver more services while attaining operational efficiencies along the way.

Infor end-to-end solutions for libraries are designed to help libraries increase usage of collections and services in the most efficient way. Our solutions are: • Personalized. Customize workflows to meet your – and your library’s needs. • Flexible. Manage collections of any kind – digital and traditional. • Extensible. Easily deliver a range of services such as RFID, self-check, sorting systems, and more. • Insightful. Know how you’re doing with insight into trends and performance.

Get in touch today to learn how Infor can help you deliver more services to users and provide better access to collections. We’re at ALA annual in Chicago. Visit us at booth # 1524.

Features 32 THE VOID IN CHARTER SCHOOLS 26 How can kids develop a love for reading without a library to nurture them? BY MARIA R. TRASKA

SOUND LITERATURE 32 A guide to audiobooks for youth BY MARY BURKEY

APPS AND AUTISM 36 Tools to serve children with special needs BY BARBARA KLIPPER

TASTES OF CHICAGO 52 American Libraries staff members offer a sample of our choice picks BY THE EDITORS

52 36

COVER STORY 40 CHICAGO 2013 Annual Conference Preview BY MARIAM PERA

A view of the Chicago River and downtown. Cover photo by Songquan Deng / Shutterstock.com CONTENTS AMERICAN LIBRARIES | JUNE 2013 | VOLUME 44 #6 | ISSN 0002-9769

52 Departments INFORMATION TECHNOLOGY 24 DISPATCHES FROM THE FIELD Ebook Business Models BY MIRELA RONCEVIC 25 IN PRACTICE Need Help? Join.me Online BY MEREDITH FARKAS

PEOPLE 62 CURRENTS

PROFESSIONAL DEVELOPMENT 64 YOUTH MATTERS The Whole Library Approach BY LINDA W. BRAUN 66 LIBRARIAN’S LIBRARY Updates and Trends Bridging the Digital Divide BY KAREN MULLER 10 ALA 67 ROUSING READS 17 PERSPECTIVES The Grief and Joy of Man’s Best Friend 20 NEWSMAKER: Alice Walker BY BILL OTT 68 SOLUTIONS AND SERVICES

OPINION AND COMMENTARY 20 26 4 FROM THE EDITOR Chicago, My Kind of Town BY LAURIE D. BORMAN 5 PRESIDENT’S MESSAGE Representing ALA BY MAUREEN SULLIVAN 6 EXECUTIVE DIRECTOR’S MESSAGE Rethinking, Reinventing BY KEITH MICHAEL FIELS 8 READER FORUM Letters and Comments 18 17 21 NOTED AND QUOTED 22 ON MY MIND Analog Ideas, Digital Activism BY ANDY WOODWORTH 23 ANOTHER STORY As a Matter of Fact ... BY JOSEPH JANES 72 WILL’S WORLD Reading Mom Like a Book BY WILL MANLEY

APA Handbooks APA Books® in Psychology™ Series E-Collection 2013 • APA Addiction Syndrome Handbook APA Books E-Collection 2013 features the exclusive electronic release of core scholarly and professional • APA Educational Psychology Handbook titles* from the 2013 copyright year. APA Books • APA Handbook of Behavior Analysis E-Collections are available from 2001 forward, and • APA Handbook of Counseling Psychology encompass book content in psychology and related disciplines including medicine, psychiatry, nursing, • APA Handbook of Ethics in Psychology sociology, education, pharmacology, neuroscience, and • APA Handbook of Industrial more. and Organizational Psychology *Exclusions apply. • APA Handbook of Psychology, Religion, and See www.apa.org/pubs/eBooks13 Spirituality in Psychology (NEW!) • APA Handbook of Research Methods in Psychology • APA Handbook of Testing & Assessment in Psychology (NEW!)

For more information go to www.apa.org/pubs/eBooks13 or contact APA at [email protected]

APA DATABASES & ELECTRONIC RESOURCES The Past, Present, & Future of Psychology

ebooks ad resize.indd 1 4/26/2013 2:20:49 PM 4 americanlibrariesmagazine.org | june 2013 will notberealized.” and probablythemselves magic tostirmen’s blood little plans.Theyhaveno iel Burnham:“Makeno master planarchitectDan In thewordsofChicago FROM THE EDITOR | Aim highinhope andwork.” Makeblood andprobablythemselves willnotberealized. bigplans. inspire you:“Make plans.Theyhavenomagic tostirmen’s nolittle McCormick Place) createdthemasterplanfor Chicago.His wordsmay 1893 World’s Columbian Expositiononthe city’s SouthSide(southof anarchitectanddirectorof Burnham, worksofDaniel Burnham. the works of Frank LloydWright, Holabird LouisSullivan, and &Root, Chicago isalsoknownfor itsarchitecture,areputationbolsteredbythe cool insidetheconventioncenteronlake. Aswellasiffyweather, conference time,youprobablyshouldexpecthotweatheroutsideand charter schoolshasnotincreasedthetotalnumber of school libraries. terviewing librarians,writerMaria Traska found thatso far, therisein for school libraries.Delvingintodatabasesandstudies,aswellin amines theburgeoningcharterschoolmovementandwhat thatmeans sampling here.Find completedetailsat and scholarshipeventsathistoriclocations.Too badwecanlistonlya spaces toworkingwitholderadults,aswellauthorbooksignings great speakers, programs,andspecialevents,ontopicsfrommaker in ourpreviewbeginningonpage40. Theconference willbefilledwith find ourfinalselectionsbeginningonpage52. gleeful whenIpassedoutbookstofolks alongmytriphome.It wasasif tosurprised light andnonreaders.Reactionsrangedfrompuzzled Thousands of peopleacrosstheUSgaveout500,000 freepaperbacksto their loveof bookswithothersthroughWorld BookNight onApril23. arrive inthelunchroomforperusing,it’sabooklover’sdream. have beenconsideredforreviewbythemagazine.Whenthesebooks tors sharewiththeALAstaffpilesofboundgalleysandARCsthat O As Iwritethis,thelatespringweatherispredictablymercurial. By June windsuptheyearfor manyschools.Ourfeature onpage26ex We alsoputtogetheranticipatedhighlightsof thisyear’s conference No wonder, thatALAstaffers then, jumped atthechancetoshare ne ofthebestperksworkingatALAispickingup“gently yet-to-be-published books.Everyfewweeks, used” advancereadingcopies(orARCs,asthey’reknown)of by D. Laurie Borman Chicago, My of Kind Town - had a hard time winnowing the list. You’llhad ahardtimewinnowingthelist. There weresomanyheavenlyoptions,we well asgoodfood withyournewbooks. so youcanenjoyourneighborhoodsas brainstormed theirfavoriteplacestoeat Chicago. Theeditorsour hometown, This year, we’re happytowelcomeyou coming toALAAnnualConference, too. just oneof themanyperksfor librarians everyone gotanALAbookbenefit. z

Picking upbooksfrompublishersis Masthead alaannual.org . Booklist edi - - - - Associate Editor Associate Editor Senior Editor Senior Editor Managing Editor Editor andPublisher online career classifiedads: local 312-944-6780•fax312-440-0901 toll free 800-545-2433plus extension email americanlibrariesmagazine.org 50 E.Huron St.,Chicago, IL60611 THE MAGAZINEOFAMERICANLIBRARY ASSOCIATION reproduced fornoncommercial educationalpurposes. maybe can LibraryAssociation. Materialsinthisjournal ALA, 50E.Huron St.,Chicago,IL60611.©2013 Ameri changes to offices. POSTMASTER:Personalmembers: Send address postage paidatChicago,Illinois,andadditional mailing Library Association(ALA).PrintedinU.S.A.Periodicals yearly withoccasionalsupplementsbytheAmerican American Libraries published Perkins, 800-545-2433x4286. with 40%discountforfiveormore; contactCharisse Customer Service.Allowsixweeks.Singleissues$7.50, visit 800-545-2433 x5108,email price forindividualsincludedinALAmembershipdues. U.S., Canada,andMexico;foreign: $60.Subscription Libraries andotherinstitutions:$45/year, 6issues, subscribe H. W. Access, LexisNexis,Information Wilson, Available fulltextfrom ProQuest, EBSCOPublishing, indexed ment. ALAreserves therighttorefuse advertising. Acceptance ofadvertisingdoesnotconstituteendorse advertising representative Editorial policy:ALAPolicyManual,section10.2 Interns David Tyckoson, SusanM.Weaver Brenda Pruitt-Annisette,SarahRosenblum, Paul Signorelli (Chair),BrianCoutts,Luren Dickinson, advisory committee Director membership development Will Linda W. Braun,Meredith Farkas,JosephJanes, columnists Reprints Rights, Permissions, Marketing Director Associate ExecutiveDirector publishing department Senior Production Editor Senior Production Editor Managing Editor, ALAProduction Services design andproduction Advertising andMarketingSpecialist Manley, Karen Muller, BillOtt ala.org americanlibraries George M.Eberhart• SianBrannon,MollyKrichten Beverly Goldberg • Doug Lewis• Sanhita SinhaRoy• Laurie D. Borman • Laurie D.Borman . Claimmissingissues:ALAMemberand American Libraries Phil Morehart •

Mariam Pera• (ISSN 0002-9769)ispublished6times

Katie Bane• @ [email protected] ala.org membership JobLIST.ala.org [email protected] [email protected] [email protected] , c/oMembershipRecords, [email protected]

[email protected] Mary JoBolduc•x5416 [email protected] [email protected]

Krista JoyJohnson

Donald Chatham @ •770-333-1281 ala.org Ron Jankowski Kirstin Krutsch Mary Mackay

Chris Keech

JSTOR. •x4212 •x4217 •x4219 •x4213 •x5105 •x4218 •x5282 , or

- -

PB americanlibrariesmagazine.org | month 2011 President’s Message | ALA Representing ALA

Looking back, looking forward by Maureen Sullivan

t has been a privilege this noticed, and the effort is ongoing. Age” institute for 2014. ALA’s sup- year to serve as your presi- We stepped up efforts to engage port of the Digital Public Library of dent. The experience ex- the large publishers in discussion America continues. DPLA Executive ceeded my expectations in about the need to make their ebooks Director Dan Cohen will join me in Iso many ways. I especially enjoyed available for sale to libraries at a rea- the President’s Program at the 2013 representing ALA in the larger sonable price. The story isn’t com- ALA Annual Conference. world. One of the special joys was plete on this issue, I enjoyed meet- working closely with Immediate but significant This is a ing so many of you Past President Molly Raphael and progress was made time of great at conferences and President-Elect Barbara Stripling with some publish- events around the to ensure continuity across our ers, notably the re- opportunity for country, getting to terms to fulfill our shared vi- cent decision by us to engage know ALA staff and sion. I now look forward to having Penguin to sell its our communities to many of the won- Courtney Young join in this effort. front list to derful people who One of our ongoing visions is of libraries. pursue our shared serve as chapter the library as a community conver- Another area of aspirations. and division offi- sation center, a place where people concern is the role cers and leaders. come to share their ideas and learn of school libraries and librarians. In ALA is a large and complex organi- from others. Highlighted by 2000– 2011, Molly Raphael appointed the zation with much work to do. It 2001 ALA President Nancy Kranich, School Libraries Task Force, and the takes all of us to do it well. the library is a place to promote civ- work moved forward this year under Many ALA presidents stay in- ic engagement, open access, and the leadership of cochairs Susan Bal- volved long after their terms have free expression. This year, with a lard and Patricia Tumulty. One im- ended. I will support Barbara in her grant from the Institute of Museum portant result is a campaign to raise presidency and will continue to and Library Services, ALA joined public awareness and gain public work in the areas I can contribute with the Harwood Institute for Pub- support. best. I especially look forward to lic Innovation in the project “The It was a pleasure to be part of a being involved in the “Leading to Promise of Libraries Transforming group invited by then–Secretary of the Future” institute in August. Communities” to develop a sustain- State Hillary Clinton to make the ar- The challenges we face are com- able program to enable librarians to tifacts and rich history of the State plex. Yet this is a time of great be effective leaders and conveners Department Diplomatic Reception opportunity for us to engage our

of community engagement. Rooms more accessible to our citi- communities to pursue our shared june 2013

Another ongoing project has been zens. If you cannot take the guided aspirations. I urge all ALA members |

the effort to “reimagine” ALA. With tour, you can visit the beautiful to embrace our leadership role as considerable member input, the website at diplomaticrooms.state conveners of community engage- ALA Executive Board, the Council, .gov/home.aspx. ment. z divisions, and ALA staff were chal- The first “Leading to the Future” lenged to identify ways to improve ALA Leadership Institute will be MAUREEN SULLIVAN is an organization development consultant to libraries and the Association and make it more held this August, and the Harvard professor of practice in the Managerial flexible, nimble, and responsive to Graduate School of Education has Leadership in the Information Professions doctoral program of the Graduate School of changing needs. The effects of some already begun planning a second Library and Information Science at Simmons

of those changes will take time to be “Library Leadership in a Digital College in Boston. Email: [email protected]. americanlibrariesmagazine.org

5 ALA | Executive Director’s Message Rethinking, Reinventing

Working together to strengthen our Association by Keith Michael Fiels for the future

n late April, the ALA Ex- Over the past 130 One of the bers—add content ecutive Board and the years, members to the ALA web- Association’s Budget Analysis and Re- have formed 11 site. view Committee met to divisions, 20 round greatest These complex- Ireview the status of the cur- tables, 57 state and strengths— ities are a direct rent 2013 ALA budget and to regional chapters, result of our and challenges—is approve a preliminary budget nearly 30 affiliates, “member-driven” for the 2014 fiscal year that a thousand commit- that it provides a philosophy, but begins September 1, 2013. tees, and numerous “home” for everyone. they can make The continuing impact of the re- online discussion change a slow and cession on libraries and projected and special interest groups. New cumbersome process. revenues this year and next year groups are being formed on an on- All of this means that we will means that ALA has had to make an- going basis. Each of these groups need your help as a member to other round of budget reductions— approaches its work in a unique make sure we focus our efforts on approximately $1.8 million worth— fashion, and each is driven by the what is most important. Like the this spring. The picture for FY2014 members that created and sustain many libraries that have had to re- is even tighter, which translates to the group. duce their budgets since the begin- another $1 million in reductions in This makes for a very, very com- ning of the recession, we will have the general fund offices and support plex organization. The complexity to make careful decisions about service units this fall. This means a provides plenty of opportunities for where we concentrate our efforts. nearly 20% reduction in staffing engagement, and increased mem- To do this, we will need every ounce and budgets since the beginning of ber engagement is one of the Asso- of member creativity and member the recession. ciation’s five strategic goals. It also support. More important, this means that allows us to harness the energy and ALA has continued to make real every office and every member creativity of thousands of active progress on a number of critical group will need to look closely at all members to continually advance fronts (examples include ebooks, the programs and services they are nearly every aspect of library ser- the value of libraries, public policy, currently providing. With resources vices locally, nationally, and global- diversity, and community engage- tighter than ever, we’ll need to focus ly. And it provides us with ment) despite a tough economy, and on those that are most essential and tremendous impact and influence we’re seeing encouraging signs of those that further our strategic pri- when we speak as one. recovery from libraries around the orities as an Association. This complexity, however, is also country. june 2013

| There has been a lot of discussion one of our greatest challenges. ALA Many more challenges lie ahead

recently about rethinking and re now supports almost 1,600 pricing for our libraries, our profession, imagining ALA. One of the Associa- permutations and rules. Accounting and the public we serve. Our job will tion’s greatest strengths is that it tracks thousands of separate ac- be to make sure that we have the provides a “home” for everyone: counts. Our IT staff supports multi- strongest, most focused Association librarians, library workers, trustees, ple platforms for many everyday as we work together to meet them. z and friends from all types of applications. Communication inlibraries, representing all interests volves a rapidly growing number of and all perspectives within the channels and media. More than 300 KEITH MICHAEL FIELS is executive director of the American Library Association,

americanlibrariesmagazine.org library community. individuals—both staff and mem- headquartered in Chicago.

6 Like Kingsley on Facebook for a chance to win a complete Luster Ensemble! Visit us at Booth 1653 in Chicago to see the complete Kingsley line! By now you know how bad stainless steel is.

Kingsley 4ever™ Luster.... superior to Stainless in about every way...... including a lower price.

Side by side, it’s hard to distinguish the Kingsley 4ever™ Luster Finish from Stainless Steel. They both have that beautiful sheen that can only come from a shiny natural metal �nish. But beyond the good looks, Kingsley Luster outshines Stainless with a price that’s around 20% lower and durability that leaves Stainless in the dark. Like Stainless, 4ever™ Luster can never rust.....but unlike Stainless that will tarnish, discolor, develop ugly red streaks that look like rust, or easily scratch, Luster keeps its shine for decades. While Stainless will corrode and discolor in coastal areas and where solvents are used to melt ice and snow, 4ever™ Luster outperforms....outpe with no e�ect on the �nish, at all. Luster will look just as good in ten years as the day you receive it. Plus, Luster™ is highly resilient and therefore dent resistant. To make things even better, Luster™ comes standard with a clear, powder coat anti�gra�ti �nish that allows easier clean up of all ink and paint with no harm to the �nish. Luster is constructed of 100% recycled materials, and is - itself - 100% recyclable. It’s so good, Kingsley® guarantees it beyond a lifetime...... we guarantee it forever.

We are Kingsley. We are Librarian. And we’re proud of it. strong | capable | visionary | helpful | caring

Kingsley sells more carts to libraries worldwide We took the hassle out of through wall returns! There’s MORE in our e-STORE! kingsley.com than all other manufacturers combined! Easy to retro�t into most libraries. �eautifully 800-376-7209 for one-on-one product advice! Check out our full selection at kingsley.com crafted and built to last the lifetime of your build- details of Facebook promotion available on Facebook ing. See the full selection only at kingsley.com all product details are available on kingsley.com “The riskto “The libraries by First Amendment.” much greaterthan of violatingthe any theoreticalrisk allowing access 8 americanlibrariesmagazine.org | june 2013 to pornographyis today’s Emerging Leaders. training. Allthebestinfuture to continues tosupportthisimportant 2007). It’s wonderfultoseethatALA by President LeslieBurger (2006– revived, expanded,andtransformed EL wasdiscontinued,onlytobe Leaders Institute.Aftermypresidency ing andlaunchedtheEmerging incentives togrowth andunderstand recognized thevalueofearly after joiningALAandALSC,I conference thatIattendedshortly information sciences,Universityof associate professor oflibraryand Charles, Louisiana,andMauriceis University’s FrazarLibrary, Lake now director ofMcNeeseState Wheeler madeithappen.Debbieis Johnson-Houston andMaurice Emerging Leadersprogram. Debbie Francisco (1997)weinitiatedthefirst to myheart.SixteenyearsagoinSan Emerging Leaders,bringinggreat joy Libraries The March/April issueof Emerging Leaders Enabled Comment OPINION | The editorswelcome lettersaboutrecent contents ormattersofgeneralinterest. Lettersshouldbelimited to300words. Sendto prominently features [email protected] ALA President, 1996–1997

imnhm Alabama Birmingham, Reader Forum Mary R.Somerville leadership Children (ALSC) Services to for Library an Association first participants. became ofthe see what be interesting to Denton. Itwould North Texas in American Because of ; fax312-440-0901; or - bound!” to leaptallbuildingsinasingle powerful thanalocomotive,andable “faster thanaspeedingbullet,more Libraries correctly intuitthatto the dimmestbulbsamonguswill need istightsandcapessothateven be anAssociationmember?Allthey to bean“emerging leader”youmust Perhaps thetakeawayisthatinorder what’s withthissilly“ALA”emblem? jawed butoh-so-sensitivegeek?And full-figured Amazonsandasquare- nay, glowering!—butconspicuously shoes folkswithwhomIhang. anything intelligent, andfashionable—inshort, project animageoflibrariansaship, well thatmanyamonguslongto graying profession. AndIknowalltoo constantly reminded thatweare a notwithstanding thefactthatwe’re highlight onitsMarch/April 2013cover, American Libraries white maleboomer—isn’t theone my particulardemographic—aging, Okay, firstIneedto remind myselfthat über-tech andüber-cool, thepresence ing efforts topresent ourselvesasboth Come tothinkofit,givenourunceas there are ‘needy’ forapproval.” ‘relevant,’ wesimplycomeacross as our attempttoseem‘cool’and Another observedthat“onceagainin asked calledtheimage“lame.” book superheroes? OnecolleagueI ourselves asbadcaricatures ofcomic But c’mon, Oh, well,onthebrightside,atleast Do wereally wishtoportray American Libraries butthecardigan-and-sensible- , ouremerging leadersare books AL inthebackground! friends:twostern— isseekingto American , ReaderForum,50 E.Huron St.,Chicago,IL 60611-2795. - Amendment” ( In herarticle“FilteringandtheFirst Filtering Internet cartoon coverimage. all inMr. Sugar’s bizarre andlaughable ogy) maywellbethestrangestpartof of books(andtheabsencetechnol and obscenitybyusinginternet filters adults’ accesstochildpornography children from harm andlimiting because theybelievedthatprotecting signed byPresident BillClinton CIPA wascreated by Congress and we violateourprofessional ethics.Yet e-rate fundsandcomplywithCIPA, around her. of themisinformationsheseesall Bradburn interpretation ofthe views reflect anunpersuasive she saystheymeant“must.”Her that libraries“may”remove filters, obligation todoso;whenCIPA says permission toremove filterswithan unchanged. SheconfusesCIPA’s ALA’s positiononinternetfiltersis District North CentralRegionalLibrary courts thathaveruledon Protection Act(CIPA) andthetwo ruling ontheChildren’s Internet Amendment. TheUSSupreme Court censorship andviolatestheFirst any useofinternetfilters results in Caldwell-Stone andALAbelievethat position oninternetfiltering.Ms. unfortunate intransigenceofALA’s Caldwell-Stone demonstratesthe According toALA,whenweaccept (2010) reject thatview, but Sackville, NewBrunswick,Canada decisionsandcreates more AL , Mar./Apr.) Deborah CIPA Bradburn v. and Marc Truitt - submitted alettertoOreo cookies I amaretired librarianof27years.I Oreo Commercial advice. like advice.Regrettably, it’s notgood looks likealegalopinionandquacks speech online?”anditscontent,itsure the subtitle“Whenisitokaytoblock be regarded aslegaladvice,”butwith it “isnotalegalopinionnorshould asking toomuch. provide safeworkplaces.Thisis our legalobligationto done tochildren, and courts, potentialharm the opinionsofour cally electedofficials, will ofourdemocrati asks ustoignore the Amendment. ALA theoretical riskofviolatingtheFirst pornography ismuchgreater thanany libraries byallowingaccessto pornography cancreate. Theriskto environment thatthepresence of ees from apotentiallyhostilework practice alsoprotects libraryemploy was themostethicalchoice.This The articleincludesadisclaimerthat Douglas County (Colo.)Libraries;andALAPresident-Elect BarbaraStripling, amongothers. Feldman andRobertWolven, cochairsofALA’s DigitalContentandLibrariesWorking Group; JamesLaRue,director of sary balancebetweentwocontrasting waystoviewtheebookproblem.” Inouye writes.“But,ofcourse,addressing thebasicchallenges theBigSixposeremains apriority. There isaneces prevalent inALA’s workoverthepastfewyears. ebook archiving andpreservation, andotherconcepts.Asaresult, theybecamemore self-publishing, interoperability oflibrarysystemsfordigitalcontent,aspublisher, As Inouyenotes,thepasttwoyearshaveseenanenormousamount ofchangein of articlesthatlookatboththebigpicture andthenitty-grittyoflibrariespublishing. ogy Policyandtheprogram managerofALA’s DigitalContentInitiative,compiles arange latest edition,guesteditorAlanInouye,director ofALA’s OfficeforInformation Technol digital content,availableonlineandatthe2013AnnualConference inChicago.Inthis Keep aneyeoutforcopiesofthethird American Libraries Digital Content:What’sNext Included inthesupplementare articlesbyPeterBrantley, director ofscholarly communicationatHypothes.is;Sari “These issuesandothersare criticallyimportantforthefuture oflibrariesanddemand heightenedattention,” Wenatchee, Washington - “Every timeyou “Every you destroypart heritage.” of ourcultural destroy alibrary, Dan Howard

- supplement express theirdispleasure. Nabisco, themanufacturer ofOreos, to present, willtakethetimetowrite hope otherlibrarians,bothpastand heritage. library, youdestroy partofourcultural collections? Everytimeyoudestroy a protect electronic resources, andbuild materials, selectfurniture andcarpets, money ittakestoorder andprocess ad peopleanyideaofthetimeand for allourcitizenstouse.Havethese acknowledged asacommunitygood over shelving,break furniture, andin argument theydestroy books,push or thecream. Intheprocess ofthe of thecookieisbest—thecracker library tablearguing aboutwhichpart takes placeinalibrary. regarding theirrecent commercial that American Libraries This commercial isanoutrage,andI In thisad,twomenare sittingata libraries are universally was horrified.Our materials. water onthelibrary sprays high-power department arrivesand the finale,fire Ardmore, Pennsylvania Needless tosay, I supplementonebooksand Victoria E.Evalds Victoria

Perris, California inMarchPerris, California tobecome of C 47) steppeddownasbranchmanager CORRECTION: registered readers! six continentsandmore than250 this project. Itreally wasworldwide— been overwhelmedbytheresponse to powerful letteryesterday! We have celebration ofDr. King’s beautifuland Thank youverymuchforjoiningour Jail,’” ALOnline,Apr. 16: Anniversary of‘Letterfrom Birmingham In response to“ALACelebrates50th Thanks, ALAOFD/OLOS! Library. ALapologizesfortheerror. director ofthePalmdale(Calif.)City é sar E.Ch - use aQRcodereader app onyour americanlibrariesmagazine.org smartphone toscanthisbarcode. SEE MORECOMMENTS á vez PublicLibraryin Thomas Vose (May, p. Birmingham, Alabama Birmingham, Renee Blalock at , or -

9 americanlibrariesmagazine.org | june 2013 10 americanlibrariesmagazine.org | june 2013 2014–2015 Presidency ALA Louise YoungCourtney Wins UPDATE | UPDATE (2008–2009) andtheALATask C Annual Conference inChicagobe Austin SchoolofInformation. Association. ShedefeatedBar 2010), councilor (2005–2008),Di 2013). Shehasalsobeenamember 2014), andthe ALA-APA 2012–2015), aswelltheAwards Table (NMRT) president(2009– Force onElectronicMember Partici (2012– Fundraising Committee Pennsylvania, hasbeenelected Committee (2012–2014), thePlan Committee ning andBudgetAssembly(2012– members of ALAtoserveaspresi of theALA ResolutionsCommittee councilor-at-large (2008–2011, ecutive Board(2009–2012)andALA career developmentandengagement, continue workingwithALAmembers bara FrolingImmroth,profes versity Committee chair versity Committee vice-president/president-elect serving asamemberof theALAEx starting atthecloseof the2013ALA sor attheUniversityofTexas as New Members Round at thecloseof the2014 AnnualCon a totalof 10,420 votescastfor presi and outreach.” and ALAstafftodemonstratetheval ference inLasVegas. fore assuming theALApresidency dent. Shewillserveone year asdent. dent,” Young “Iamexcitedto said. pation (2007–2009).Shehas served president oftheAmerican ue of membershipthroughdiversity, “It istrulyanhonortobeelectedby Young received5,391 votesoutof Young’s activitieshave included ourtney LouiseYoung, head librarianatPenn State GreaterAlle- gheny inMcKeesport, ALA ALA

Library ------(2003–2004), andStudentChapter (2010–2011) andmember(2006– West Bloomfield(Mich.) Township Courtney LouiseYoung andMarioM.Gonzalez 2012) of theBudgetAnalysisand Review Committee (BARC), amem Review Committee Board (2006–2009),aschair Public Library, receiving 5,096 Library, hasbeenelected ALATrea Clara Nalli Bohrer, directorof the rector of thePassaic (N.J.) Public well to as all membersof theALA, with staffandmemberleaders,as confidence.” continue tofinanciallysupportthe of theYear Awardchair(2004–2005). ber of theFinance andAuditCom humbled andIthankyoufor your have beenelectedbythemembership votes outof 9,847 castfor treasurer. surer for 2013–2016.He defeated to serveastheirnewtreasurer,” Gon goals oftruly ouram I Association. zalez hasservedontheExecutive “Ilookforward zalez said. toworking “It isanhonor andaprivilegeto An ALAmembersince1985, Gon Mario M. Gonzalez,executivedi ------The proposaldirectsthe Board toreviewpersonalmember Council aswellleadersof divi members. mail voteof personalmembers,and in theelectionthatalsoincluded (2010–2011),andhasbeena mittee of adues adjustmentnottoexceed councilor-at-large since1996. visit sions androundtables.Afive-year seats ontheAssociation’s governing alaelection and amailvoteof ALApersonal any subsequentduesadjustmentaf above theCPIwouldbesubjecttoa from 2013to2017inconsideration dex (CPI).Anyincreaseproposed dues annuallyeverySeptember dues adjustmentmechanismpro the ALA Executive Board, Council,the ALAExecutiveBoard, ter 2017wouldrequireapproval by tional averageConsumer PriceIn the percentagechangeinna posal passed, 7,832posal passed, votesto2,969. A totalof 11,083 ballotswerecast For completeelectionresults, ala.org/aboutala/governance/ . Executive - - - -

- support. “By fundingtheLibrary support. congratulated the presidentfor his sequestration). FY2013 continuingresolution (after over fundingenactedfor thebillin approximately 1.16%increase Thebudgetrequestisanogy Act. the LibraryServicesandTechnol for assistance tolibrariesthrough for FY2014 allocates$177million President BarackObama’s budget Aid Proposal Library Hails Obama for ALA Florida. Annual Conference inOrlando, through theendof the2016ALA Conference inChicago,andextend conclusion of the2013ALAAnnual terms. Thetermsbeginatthe the Councilof ALAfor three-year elected ascouncilors-at-largeon Thirty-three membershavebeen Elected Councilors ALA 10 un open leaving include Steps gap. this close to place in savings expense put to (BARC) Committee Review and Analysis Budget the and Board Executive the with working is ment publishing and membership. Manage of areas some in shortfalls of because budgeted originally than less million $1.8 approximately be will revenue end Association. focused more but aleaner in resulting reductions, budget some necessitate year next and year and lower-than-projected revenues this libraries on recession the of impact the that 2013 2014. reported and years He fiscal for budgets Association discuss to A 2014 and 2013 Revenues Fall ShortALA for Fiscal Years ALA PresidentMaureen Sullivan Overall, the ALA General Fund year- Fund General ALA the Overall, Fiels addressed ALA staff on May 2 May on staff ALA addressed Fiels Michael Keith Executive Director LA

- - received during the2012fiscalyear. of federal assistancethatlibraries budget iswellbelowtheamount “Fundingshe said. includedinthe millions relyonfor assistance,” centers andtechnologyhubsthat continue tobethethrivingresource more federal fundingsupportto weknowthatlibrariesneedogy Act, the LibraryServicesandTechnol $2 millionincreaseinfundingfor forward, however. Obama administrationmoving more efforts andsupportfromthe skills neededfor 21st-centuryjobs.” learn theresearchanddigitalliteracy who cometolibrariesfindworkor trons, manyof whomarejobseekers ies withthemeanstoservetheirpa fundingprovideslibrar “This said. the nation’s economicrecovery,” she edged thekey rolelibrariesplayin Obama administrationhasacknowl Services andTechnology the Act, mental budgets. requires reductions in further depart 2014 the budget aresult, As Chicago. in 2013 for Annual those than less lion $1 mil approximately are Vegas Las in Conference 2014 the Annual for tions improvement, but revenue expecta show to expected is Publishing tighter. FY2013. for budget abalanced projects ALA efforts, these General Through Fund departments. ALA all across reductions expense in other $750,000 approximately and increases; compensation staff ing suspend year; the of remainder the for for seniorreduction ALA management salary 10% voluntary a positions; filled “While weareverypleasedbythe “While Sullivan stressedtheneedfor Department headsDepartment and unit manag even be will FY2014 that noted Fiels ------of progress, and will be providing providing be will and progress, of councilors and membership apprised keeping be will Board Executive the He and said. Fiels results, budget the pending highestpriority final ALA. of priorities strategic the further that and essential most are that those retain to services and programs their at looking are groups member and units All in staffing. additional reductions include may which reductions, these implement to plans developing are ers available athome. with information and resources not that librariesprovidetheirchildren reason librariesareimportant is ing andbooks.And81%saya major velop theirchildren’s loveof read to librariesisthathelp de want theirchildrentohaveaccess important sayamajorreasonthey parents whoindicatelibrariesare with publiclibraries. the strongconnectionsparentshave with ReadingandLibraries,” reveals Children’s SpecialRelationships Thestudy,children. “Parents’ and say librariesareimportantfor their study showsthat94%of parents Internet andAmericanLife Project A newPew ResearchCenter’s Love Libraries Pew Parents Study: even moresupportinthefuture.” tration willprovidelibrarieswith We hopethattheObamaadminis 2014-budgets inside-scoop/update-ala-2013-and- visit at Annual Conference. presentations their of part as reports detailed more According tothefindings,84% of Staff compensation increases are are increases compensation Staff To read Fiels’s statement in full, full, in To statement Fiels’s read americanlibrariesmagazine.org/ .

- - -

11 americanlibrariesmagazine.org | june 2013 12 americanlibrariesmagazine.org | june 2013 UPDATE | UPDATE June 26–July1: Jan. 24–28: 2014 EVENTS Nov. 16: Oct. 20–26: Oct. 13–19: Sept. 25: Sept. 22–28: Sept.: Aug. 17–23: June 27–July2: ALA EVENTS CALENDAR Week, cardsignup Month, .org/ifla79 Singapore, Information Congress, tions, World Libraryand Associations andInstitu Federation ofLibrary Chicago, Annual Conference, Association, Library Las Vegas. Annual Conference, Library Association, Meeting, Philadelphia. Day, conferences/folweek ala.org/united/events_ of LibrariesWeek, ala.org/teenread aasl/bwad Awareness Day, LibraryCard Sign-Up ngd.ala.org InternationalGames BannedWebsites ala.org/bbooks ala.org/library ALAMidwinter NationalFriends Teen ReadWeek,

International alaannual.org BannedBooks ALA . . . conference.ifla American American ala.org/ . .

munity College inSanford, North New Mexico; Central CarolinaCom Community CollegeinLasCruces, Moines, Washington; Doña Ana Highline Community CollegeinDes nois CentralCollegeinEastPeoria; DuPage Illinois;Illi inGlenEllyn, Sugar Grove,Illinois;Collegeof Waubonsee CommunityCollegein College inEscondido,California; na (Calif.)CityCollege;Palomar ments havebeenmadewithPasade requirements. Similararrange the majorityof LSSC’s competency curriculum andfindingthatitmeets agreement afterreviewingtheCCSF sional Association(ALA-APA). Library Association–AlliedProfes the collegeandAmerican to anagreementreachedbetween fication (LSSC)designationthanks receive LibrarySupportStaffCerti College of SanFrancisco (CCSF)will tion Technology ProgramattheCity Graduates of theLibraryInforma Joins LSSC’s Ranks College California SUMMER READINGLISTSFORKIDS The ALA-APA proposedthis booklists/summerreadinglist ney GrantfundedbytheALAPublishingCommittee. Programs andServicesCommitteecreated through aCarnegieWhit members oftheALSCQuicklistsConsultingCommitteeandSchool-Age patrons andschools. and summerprograms forchildren before printinganddistributingto can customizethebooklistswiththeirowninformation,summerhours, available onlineandare free todownload,copy, anddistribute.Libraries and 6ththrough 8thgrade.PDFsofthelistsare garten through 2ndgrade;3rd through 5thgrade; the summer. to keepchildren interested inreading throughout enjoyable books,bothclassicandcontemporary, These listsincludeadiversegroup offunand for studentsinkindergarten through 8thgrade. (ALSC) hascreated summerreading booklists The AssociationforLibraryServicestoChildren Find thelistsandadditionalinformationhere: The summerreading titleswere selected,compiled,andannotatedby The listsare grouped bygradelevel:kinder

. ------strated courage inresistingcensor library profession whohavedemon freedom fightersinandoutside the when governmentscensorbooks. ists, andothers—thatcanfollow physical harmtoauthors,journal logistical consequences—suchas Books Week, whichfocused onthe lauded for itsapproachtoBanned particular, theorganizationwas freedom for morethan25years.In USA for itssupportof intellectual Award toAmnestyInternational John PhillipImmroth Memorial Table (IFRT) hasawardedthe2013 The Intellectual Freedom Round ImmrothWins Award International Amnesty formation visit LSSC competencies.For morein meet thestandardssetforth bythe er collegestoseeifitscurriculaalso munity Collegeof Indiana. Clairsville, Ohio;andIvy Tech Com Carolina; BelmontCollegeinSt. The awardhonorsintellectual ALA-APA isworking with11oth - ala.org/alsc/compubs/ ala-apa.org/lssc

- . -

- - -

- - an openforum for conference-goers toward ALAleadershipbycreating The fairprovidesanessentialstep day, June 30,from1to2:30p.m. Association OptionsFair, onSun from ALAandlibraryleadersatthe tunities for careergrowthdirectly have achancetolearnaboutoppor Annual Conference inChicagowill of theupcomingALAAttendees Fair Options Annual at Leaders Engage ALA alaannual.org ceremony areavailablefrom Friday, June 28. Annual Conference inChicagoon celebration of IFRT duringtheALA be presentedatthe40thanniversary Thisyear’sand acitation. awardwill ship. Recipientsearna$500prize Tickets tothefundraiseraward .

- - application beyond a specific local application beyondaspecificlocal future; andhavebroaderimpact are innovativeandresponsivetothe library services;effect changesthat that developorimprovepublic Loleta D. Fyan, supportsprojects after ALA’s 1951–1952president named Theannualgrant, program. Generation” animationanddrawing Grant for its“Animation for theNext awarded the2013LoletaD. Fyan hasbeen Alabama, Birmingham, The North ShelbyLibraryin Program Grant Wins Animation Library alaannual.org Forattend. information, visit nual participantsareencouragedto discuss opportunities.AllALAAn to table, andaffiliaterepresentatives round division, to meetAssociation, .

- research journal, the fullarchiveof itsscholarly Research Libraries(ACRL) hasmade The Associationof Collegeand Online C&RL short film. minate intheparticipantsmakinga Theprogramwillcul education. and assistthemastheypursuehigher that willincreasetheiremployability teens in21st-centurytechnologies week programtotraincommunity use the$5,000granttostartasix- Northneed. ShelbyLibraryplansto to 1996weredigitizedthroughthe 1939 throughthecurrentissue. of thejournalfromitsbeginningsin chive containsthecompletecontents Libraries, The journalcontentsfrom1939 Archives availableonline.Thear College andResearch Now Now

- -

13 americanlibrariesmagazine.org | june 2013 14 americanlibrariesmagazine.org | june 2013 ALA CELEBRATES DR.KING’SLETTER UPDATE | UPDATE Perfect Prices. Patron Scanners. Is InDemand On-Demand wide celebrationmarkingits50th Birmingham Jail”aspartofaworld tin LutherKingJr.’s “Letterfrom in Chicagoforareading ofDr. Mar On April16,ALAstaffers gathered World Press, hadmetandworked Johnson, vicepresident ofThird of Third World Press, andBennett lisher, editor, educator, andfounder tive. HakiR.Madhubuti,poet,pub ethnic background aswellperspec ers chosentorepresent diversityin livered initsentirety byseveralread and Outreach Services(OLOS). Diversity andtheOfficeforLiteracy was organized bytheOfficefor (Ala.) PublicLibrary, theALAevent event sponsored bytheBirmingham aloud. Althoughpartofalarger sites where King’s letterwasread anniversary. ALAwasoneof207 www.thecrowleycompany.com The letterwassectionedandde

ALA 240.215.0224 BOOTH 344 -

- - - - - publicity tools, checklists,adown such asactivity andplanningideas, to helpencourageteensread, new sitefeatures abevyof resources library” isthisyear’s theme,andthe 19. 2013, whichtakes placeOctober13– the websitefor Teen ReadWeek Association (YALSA) haslaunched The Young AdultLibraryServices LiveGoes Teen Read Week Site archive isavailableat ly publicationinJanuary 2014.The 2011 andwillbecomeanonline-on acted anopenaccesspolicyinApril the ACRL Friends Fund. ence withfinancialassistancefrom added tothejournal’s onlinepres department in2011and2012, Library’s DigitalContentCreation Illinois atChampaign-Urbana volunteer efforts of the University of ist at Chicago Public Schools’ Ross ist atChicagoPublicSchools’Ross Shakespeare, librarymediaspecial tor fortheHuffingtonPost;FeliciaR. Kim Bellware, associateChicagoedi Orange, formerdirector ofOLOS; West Englewoodbranch; SatiaM. manager ofChicagoPublicLibrary’s Advisory Committee;KeshiaGarnett, of theSpectrumScholarshipProgram Public Library;BenRodriguez,chair Anthony, director oftheSkokie(Ill.) ment. Otherreaders includedCarolyn with Kingduringthecivilrightsmove “Seek theUnknown @the College andResearchLibraries crl.acrl.org

en -

------attended on behalf of the Illinois attended onbehalfoftheIllinois youth servicesconsultant,also PLSC statedatacoordinator and Library Association.RobertJones, program coordinator atALA’s Public Elementary School;andLianSze, segregated America.” are shockedbywhatlifewaslikeina be twogenerationsofpeoplethat Bellware said.“In50years,there will remember andcelebratetheletter,” State Library. members inconsultation with the communitiestheyserve. vative, sustainable,andvaluable to nize libraryservicesthatareinno (IRRT) for 2013. International Relations RoundTable Projects havebeenawardedbythe for Innovative International Library Three ALAPresidentialCitations Awarded by IRRT Presidential Citations teenread Teen ReadWeek 2013siteat also available. publishers andcorporategroupsis Store. Sponsorshipinformation for Teen ReadWeek productsattheALA of $1,000,aswellalinktoofficial General LiteracyFoundation grants tion onapplyingfor oneof 10Dollar well asforums toshareideas. loadable Teen ReadWeek logo,as “It wasimportanttocontinue Recipients were selectedbyIRRT For moreinformation, visitthe Libraries canalsofindinforma . The awardsrecog

ala.org/ - - - program established toincrease tunities Program (BTOP), afederal the BroadbandTechnology Oppor details USlibraryengagement with Office for Information Technology A newreportissuedbytheALA Libraries on Impact Details BTOPReport research/ncle-infographic entire reportat or greaterthanothereducators. their owntimeandatratesequalto and staffintheirschools, often on development topeers,educators, pate inbutalsodeliverprofessional school librariansnotonlypartici andstudent learning. laboration, professional learning, educatorcol investigates theconnectionbetween grade levelsandsubjectareas, 2,400 educatorsrepresentingall nationwide surveyof morethan .org Works MakingLearning: RoomforWhat tion withothereducators. consistent andsustainedcollabora critical roleintheirschoolsthrough highly involvedleaderswhoplaya shows thatschoollibrariansare ter for LiteracyEducation(NCLE) A reportissuedbytheNational Cen School Librarians NCLE Hails Report ala.org/irrt/alapresintlibraryaward process for thecitations,visit learn moreaboutthenominating ToCommunity LibraryinGhana. ing theAccraCollegeof Education the OsuChildren’s Fund for build European Network of Libraries;and Ebooks onDemandprojectbythe University of Nigeria Library;the e-Library ProjectattheAmerican This year’s winnersaretheAUN ALA PresidentMaureen Sullivan. For seethe morespecificdata, Additional findingsrevealthat The report, ) , ( is basedontheresultsof a literacyinlearningexchange Remodeling Literacy ala.org/aasl/ .

- -

- - . - resources for jobsearches, video in broadbandspeeds, useof online are featured. It notesimprovements states andtheDistrictof Columbia force Projectsin29 development. resources, digitalliteracy, andwork to improvepublicaccesstech Program Broadband Technology Opportunities libraries benefitfrom BTOP funding. nationwide. Twenty percentof US broadband accessandadoption The report, The report, the conversationonTwitter usingthehashtag#alavc13. the speakers,topics,andoverallprogram at ($350 fornonmembers).You canregister andgetmore informationabout group registration forupto15IPaddresses is$325forALAmembers tinuing educationinthelibraryworldtoday. which isfastgainingareputation forbeingoneofthebestbargains incon for uptosixmonths.Log-ininformationwillbeprovided aftertheevent, Marie Arana)andDonnaSeaman. Booklist ingful gamificationinlibraries;andmore. ming inthelibraryandwhyit’s good;findingyourfirstlibrarianjob;mean administration andapps;makingcreative communityspace;loudprogram other innovativeinstructionideas;improving studentlearningspaces;iPad ment; newdirections forlibrariesanddigitalcontent;iPods,games, sium). Otherspeakerswilladdress transformationalcommunityengage with MappingtheJourney”)andKyliePeppler(“MaketoLearn” and tryingsomethingnew. starting pointsfordiscussionaswellpracticalideasmovingforward transforming boththeirlibrariesandcommunities.Thesessionsoffer tation andinnovation,withpresenters highlightinghownewservicesare sessions, conversations,andinsightsfocusonexperimen “interesting,” “inspiring,”and“fresh.” Theinteractive “enlightening,” “engaging,”“insightful,”“amazing,” day program July24–25thatpastattendeessaidwas theme ofMappingTransformation, offering atwo- The 2013ALAVirtual Conference continueslastyear’s ALA VIRTUAL CONFERENCE Individual registration is$70forALAmembers($80nonmembers);and The ALAVirtual Conference archive willbeavailablefree toregistrants Back bypopulardemandare the30-minuteauthorluncheshostedby Keynote speakersincludeStevenBell(“Transforming theLibraryStarts , highlightsBTOP efforts editorsandexpertinterviewersBradHooper(inconversationwith US Public Libraries and US PublicLibraries TRANSFORMATION MAPPING - - Institutions—FY2012.” The pilot vation Activities inCulturalHeritage to participatein“A Surveyof Preser invites culturalheritageinstitutions Collections andTechnical Services Section of theAssociationof Library The PreservationandReformatting Institutions Cultural for Open Survey .com/doc/138899219 conferencing capabilites,andmore. To readthe full reportvisit learningtimes.net/ala13

- .

sympo . Join scribd ------

15 americanlibrariesmagazine.org | june 2013 16 americanlibrariesmagazine.org | june 2013 digital preservation activities. digital preservationactivities. anddigitization reformatting, preservation conservation treatment, and expenditures,programming, ing of preservationactivities,budget document administrationandstaff complete thesurvey. Questionswill tion withpreservationactivitiescan servation fieldsovertime. changes inthepreservationandcon information sharingandtracking era viaquantitativedatathatfacilitates preservation activitiesinthisdigital survey aimstodocument thestateof UPDATE | UPDATE PRO3473 Launch_Academic_ALib_Layout14/30/1311:38AMPage Any culturalheritageinstitu The Trusted Voice InTheScholarly Community. Visit us at ALA Booth 436 Booth Visit usatALA of digitalresearch. essential scholarlyresource.Get thecore to MUSEisan Project and flexiblecollections, rich archival and so current, scholarshipinthehumanities full-text Academic Core. To The faculty, providing24/7 digitalaccessto and discoveryforscholars, cial sciences.Withcurrentscholarshipand

indispensable resourceforresearch indispensable ALA content packaged into affordable packaged into content Project MUSEisan Project - - students, and - significant andlastingimportance are sooutstandingthattheyof librarianship oracloselyrelatedfield country whosecontributionsto stowed uponlivingcitizensof any Thesemembershipsarebe cepted. highest honor, arenowbeingac memberships, theAssociation’s Nominations for honoraryALA Nominations Open Membership Honorary survey surveymonkey.com/s/preservation- To take thesurveyvisit . http://muse.jhu.edu

- - now availablefor free. patrons withgovernmentservicesis helping publiclibrariesprovide A newALAwebinarthatfocuses on Webinar Available New E-Government membership it to downloadnominationforms, vis tember 2.For moreinformation and Annual Conference inLasVegas. recognized duringthe2014ALA of theExecutiveBoardandwillbe by Counciluponrecommendation orary membersareelectedfor life to thefield of libraryservice. Hon vance, visit on page50.To buytickets inad For moreinformation, seefeature and writerPaul Rudnick( of Chicago’s professor SaraLevine, While LosingMy Mind Swear: True Tales ofLovingMy Kids Knepper ( author/counselorNicoleCoppock, Wait...Don’t Tell Me ans Paula Poundstone (NPR’s in ChicagoonSunday, June 30. at ALAAnnualConference sored bySAGE, afundraisertobeheld Libraries’ TheLaugh’s onUs, spon Jay Leno Ross Mathews of Fest Comedy Annual Ross Mathews Joins youtube.com/watch?v=V4sJEmqTfOg and taxation. Watch thewebinarat deal withissuessuchasimmigration nongovernmental organizationsthat able fromgovernmentagenciesand and whatonlineresourcesareavail mation Onlineservice(govtinfo.org); ture throughtheGovernmentInfor use thevirtual“Ask aLibrarian” fea needs of theircommunities;howto libraries servethee-government libegov.org, awebtoolthat helps teaches participantshowtouse ala.org/awardsgrants/honorary- Deadline for nominationsisSep Mathews joinsstandupcomedi “Libraries andE-Government” hasbeenaddedtoUnited for Moms and WhoDrink ala.org/united . The Tonight Show ) andSelena ), Art Institute Gorgeous

. z Wait,

with with ------). ). - - . free two-plybathroomtissuefromthestart-upcompany June 2012.Within twomonths,the ads afterhavingtoreducestaffingandservicehoursin Rye Brook firm solicitstheads. back of everydate-dueslip.The pilot inwhichadsappearonthe began thisspringasasix-month arrangement withReceiptMedia that freeproduct. from sellingtheadsdisplayedon keeps whateverrevenuecomes brary. In exchange,thecompany provide aproductfor freetotheli placement companies.Thefirms accepted aquidproquofromad and servicesinthelibrary. to advertisetheirproducts allow commercialenterprises Brook (N.Y.)Library—isto brary andthePortChester–Rye (Ont.) ReferencePublicLi least twolibraries—Toronto cal triage,undertakenbyat W Paid AdstoKeepAfloat Libraries Weigh Accepting Administrators atPort Chester– Toronto PublicLibrary’s (TPL) In bothcases,thelibrarieshave advertising. rolling outtoiletpaper library savedmoneyby upstate NewYork Your adhere: One Library ing avenues.Thelatestforayintofis libraries continuetopursuenewfund ing publicservicebudgetsnationwide, ith theGreatRecessionstillaffect decided toallow CBC Radio’s “Metro Morn er venues.” brary andventuringintolarg “winding downwiththeli can Libraries, Silvermantold Bryan rates,” companycofounder codes delivered“great scan vendors. Trackable coupon vertising it prints onthetoiletpaperad Star Toilet Paper, which - In a March 11interview on - library wasreceiving Torontans borrow 33millionitems ayear. great waytocovertheentire city”since72%of date-due slipsasaprimeadvertisingvenue”a Receipt MediatoutsToronto PublicLibrary’s secures fromlocal and nowitis Ameri ------hood branch.” Shestressedhowthelibraryboard first the pilot—“our annualbookbudgetinasmallneighbor save $20,000 Canadian($19,795 US)overthedurationof ing,” TPLChiefLibrarianJane Pypersaidthelibrarywill business?” heasked. asks for alistof alllocalestablishments inthatlineof appear togivethemaplaceof privilege whenapatron “Wouldan ethicaldilemma. advertisers’ messages and apersonal-injurylawyer. advertisers includeatheatercompany, the coupononthebackofpizza his date-due slip.OtherTPL that goestofundingprogramsandservices.” say theyarecomfortable with“unobtrusiveadvertising sophical oppositiontoanysuch told gagement atTPL, of communications, programming,andcustomeren way ortheother”from hasnotbeenahuge responseone “There to beintact. Garnar cautionedthatsucharrangements couldpose One patroncalledtheadsa“win-win” afterfindinga Perspectives AL. right torejectanythingdeemed public space” andreserving the range of information inaneutral TPL’s missionto“provide abroad established apolicythatreaffirms p the communityworth of thelibrary’s reputationwithin of Professional Ethics.“Is theloss quoting ArticleVIof ALA’s Code employing institutions,” hesaid, library users,colleagues,orour private interestsattheexpenseof “Weagrees with. donotadvance on Professional Ethics,readily Library Association’s Committee Garnar, chairof theAmerican vironment,” Pypersaid. that issensitivetothelibraryen is toraiserevenueinacontext goalhere “The aimed atchildren. “inappropriate,” suchas ads patrons, LindaHazzan, director otential advertisingrevenue?” So far, TPL’s reputationseems That’s anoutlookMartin Afew users havevoicedphilo arrangement. Othersarrangement. —Beverly Goldberg | TRENDS | Toronto Star, -

- - -

17 americanlibrariesmagazine.org | june 2013 18 americanlibrariesmagazine.org | june 2013 entertainment. totality ofpop-culture to encompassthe scope hasexpanded dominate, butthe Graphic novelsstill tory of comicbookcensorship. From thecomics scarein libraries andcomics duringhispresentation on thehis Defense Fund, notedthecloserelationshipbetween programming toexpandtheir clientele. ians sharinghowtheyusecomic booksandpop-culture Programming, BestPractices, and More” featured librar SilverAgeof ComicsinLibraries: libraries, and“The dressed strategiesfor supportinggraphicnovelsin The AdultReadingRoundTable Tackles Comics” ad Library Advocacyhostedtwoprograms.“Into theWild: branding, andretailingadvice. videogame designstart-upguidance,andmarketing, fundraising tips,artisticandstorydevelopmentpointers, lishing issuesandcopyrightconcerns,aswelloffering some chargingupto$50for theopportunity. ribbean from Newmar, Stine,andcastmembers L. BruceBoxleitner, R. Juliewriters, andillustrators—suchasPatton Oswalt, andcostumes. Filmwork, andtelevisioncelebrities, graphic novels,vintageandcollectibletoys,originalart ters—browsed theboothsof hundredsof vendorsselling in2010,event, theChicagoComicandEntertainment is gaininggroundamongcomicsconventions.Atitsfirst Comic Conleadinsizeanddraw, butarelativenewcomer andmore. toy collecting,tattooing, fantasy, sciencefiction, lifestyle: television, film, cosplay, compass thetotalityof pop-cultureentertainmentand novels stilldominate,butthescopehasexpandedtoen C Comic Books C2E2 2013 More Than Offers Just TRENDS | TRENDS Alex Cox, deputydirectorofAlex Cox, theComicBookLegal ALA’s Office for Intellectual FreedomandOffice for Panels, forums, andspeaker eventsaddressedpub Comic-Con International: SanDiegoandNew York The Walking Dead films—wereonhand for autographsandpictures, grown intolarge,multifacetedaffairs.Graphic gan inthe1960sasmodestfangatheringshas Whatbe omic bookconventionshaveexploded. Perspectives TVshowand super center. McCormick Placeconvention people tothepacked eventatthe comed approximately53,000 2013, heldApril26–28,wel crowd of 27,500 C2E2 attendees. Expo (C2E2)drewanestimated Attendees—many dressedas Attendees—many heroes andothercharac The PiratesoftheCa

- - - -

------

er’s directorof salesandmarketing. book technology, accordingtoPaul thepublish Ohlson, his booksoitcouldadapttothe changes. Lambersonhadtowriteninedifferentresult, versions of As a 1990s, TREEbookschangeevery timetheyareread. Choose Your Own Adventurebooksof the1980sand amongotherthings.Muchstretch, like thepopular andhowlongitisbeingreadinasingle book isread, shifting thenarrativebasedonreadingpace,day real-time triggersthatdetectareader’s readinghabits, with words, thenovelwillbeatime-sensitiveebook, a TREEbook(Timed ReadingExperienceEbook).In other The JulianYear Writer GregoryLambersonsaidhisforthcoming novel one of the moreinnovativedevelopmentsinthisarea. story AL Stays inChicagoPublicSchoolsButOutof Classrooms,” Marjane Satrapi’s graphic novel about theChicagoPublicSchool’s recentchallengeof cording totheOffice for Intellectual andtalked Freedom, of Earth, He detailedthecaseof KimDongHwa’s manga cussed lenges, manyof whichcomeatthelibrarylevel,Coxdis Comics CodeAuthority—throughcontemporarychal the 1940sand1950s—whichledtocreationof the McFarlane attheALAboothC2E2. ALA staffers ChristinaColeman,JoaquinFalcon,andMegan Medallion Pressowns proprietaryrightstotheTREE While multipleforums examinedadvancesindigital Online, Mar. 15, 2013). telling, a“Mystery Authorsof C2E2”panelrevealed

ongoing threatstocomicbooksandtheirreaders thesecond-most-challengedbookin2011,ac (Medallion Press,2014) willbereleasedas Persepolis (“ —Phil Morehart Persepolis The

Color -

- - - - .

Photo: John Olivero Photo: John Olivero No injurieswere reported. a teamofsalvage experts forfreeze-drying andconservation. books from ahistoriccollectionhavebeenmovedtoOxford by water damagetoareas usedmainlyasofficespace,butsome the blazeundercontrol. Thebuildingsuffered fire, smoke,and on April26.Ittook50firefighters nearlyfourhourstobring public April30followingafire thatdestroyed partofits roof The NationalLibraryofWales inAberystwythreopened tothe WALES phones. the librarytoenforce rulesaboutnoiseandtheuseofmobile The monitorwearsadistinctiveblueT-shirt andwalksthrough introduced toimprove customersatisfactionwithnoiselevels. said thiswasoneofmanymethodsthatGlucksmanLibraryhas monitor toensure silence.LibraryAdministratorMichelleBreen ing examsweekbecausethelibraryhashired alibrarynoise Students attheUniversityofLimerickwillenjoyquiettimedur IRELAND not haveit. will haveaccess,withinstallationsinthe151schoolsthatstilldo public schools(97%)haveaccesstotheinternet;in2013,100% digital divideandhavebetterteachingtools.Atpresent, 4,800 to theinternetineverypublicschoolorder toreduce the On April5,thegovernmentannouncedaplantoinstallaccess COSTA RICA 1813. and wouldhavebeenrepresentative ofalibrary’s offerings in not theactualstolenitems,three bookschosenare originals ries-old wrong thatoccurred duringtheWar of1812.Though stance Barone ofSackets Harbor, NewYork, rightedthecentu of return. Inaceremony filledwithlightheartedhumor, Con April 28totheToronto Reference Libraryinasymbolicgesture during theBattleofYork onApril27,1813,were presented Three booktitlesthatwere lootedfrom thecity’s onlylibrary CANADA —Toronto Star, Apr. 28. —Limerick Leader, Apr. 21. 4 —Latin AmericanHeraldTribune, Apr. 7. 1 3 1 2 2 —BBC News,Apr. 30. GLOBAL REACH 3 4 5 - - - 6 of thezombieinvasion withthereading bug. kids tothelibraryand hopedtheeventwouldinfect survivors ager Richard Misileisaidheneededaninnovativeideatobring ing “survivors”whohadtodoresearch tofindawayout.Man group ofteenagersformingtheundeadmasses,otherform name ofliteracy. TheTupu Youth Librarycameundersiege—one Zombies invadedalibraryinsouthAuckland onApril26,allinthe NEW ZEALAND and educationalusesofthepatterns. adding thattheywillestablishregulations forthecommercial patterns asimportantdocuments,Director Es’haqSalahisaid, to protect thecopyrightofcarpetart.Thelibraryviews Carpet Company. Thepatternswillbetransferred tothelibrary toric Persiancarpetpatternsthatare currently heldbytheIran The NationalLibraryandArchives inTehran willpreserve thehis IRAN phone. ebooks forfree, buttheyneedavalidticketaswellsmart had disappeared. Underthenewsystem,travelerscanread the in netsonthebacksoftramseats.ButbyAprileveryvolume in Januarytopromote literacy, and5,000bookswere placed this year. Thecity’s MobileReading campaignwassetinmotion trams afterthousandsoftraditionalbookswere stolenearlier Gdansk hasmadeaseriesofebooksavailableonmunicipal POLAND the locationofbooksinaLondonattic. library.” Theformeremployeemadeafullconfessionandrevealed the recently deceasedthief, whohadbeen“associatedwiththe was stunnedtohearfrom asolicitordealingwiththeestateof croft, andGeorge Abbot.InFebruary2011,thepalacelibrarian of three archbishops ofCanterbury—JohnWhitgift,Richard Ban 40 yearsaftertheywere stolen.Manycamefrom thecollections been returned tothelibrary ofLambethPalaceinLondonnearly Some 1,400rare booksdating backtotheearly17thcenturyhave ENGLAND —Radio Gdansk,Jan.4,Apr. 25. 7 6 7 5 8 —Tehran Times,Apr. 22. —BBC News,Apr. 24. —3 News,Apr. 27. - - - 8 - -

19 americanlibrariesmagazine.org | june 2013 20 americanlibrariesmagazine.org | june 2013 TRENDS | TRENDS they hadapublic library. in theSouthwould stillnotknowthat Iferation. blackpeople wehad not, manage tochangethelawinmy gen this isoutrageousbecausewedid Evennowweonlythink happened. to enteritasachild. library becauseyouwere notallowed that yourhometownhadapublic You were notaware untilyouwere 50 done athousandtimes. Something thathasalreadybeen things thatthereisnorealneedfor. Because sometimespeoplecreate be manifested. Andtheneedfor it. sense of itsform, itsowndesireto of whateveritisuntilIhavesome unripeones.SoI steercleargreen, but I’m notgoingtostarteatingthe of greenmangoes.Ilovemangoes, I’m lookingnowatatreethat’s full is ready. Idon’t pursueanything. that Iwaituntilwhateveriscoming ALICE WALKER: forms ofliterature youwrite? How doyouapproach thediverse A Booklist at theALAAnnualConference inChicago.Onbehalfof the Road, essay collection, Walker’s newestbooksare an Lennon/Ono GrantforPeace. genheim Fellowship,andthe National BookAward, aGug ors includethePulitzerPrize,a essay collections.Walker’s hon for children, andpoetry groundbreaking novels,books Walker haswrittensixother masterpiece selling authoroftheindelible geous globalactivist.Thebest of conscienceandacoura NEWSMAKER: prolific andversatilewriter lice Walker isaremarkably Senior EditorDonnaSeamanreached Walker at herhomeinMexico. andapoetrycollection, The ColorPurple,

The mainthingis Interview The Cushion in The Cushionin Yes, thatiswhat - -

- -

The World WillFollow Joy. ALICE WALKER - deserve tohaveaccessinforma the libraryfor allpeople.Allpeople want theexperienceof freedomin to make peoplefeel SoI unwanted. what racismdoestopeople,whichis Francisco. ButI’m imprintedwith fornia, instance,andtheoneinSan bished libraryinBerkeley, Califor was abigsupporterof therefur usuallywith money.I supported, I welcome in? Did librariesbecomeplacesyoufelt useless. Thereason Iabsolutelydo itwouldbevirtually compassion, ture didn’t inspireempathyand and compassion? Does literature helpinspire empathy and kindnesspatience. in highesteemfor theirhelpfulness Librariansarehelda badlibrarian. I’veneverheardastoryaboutation. Learningisthekeycerned. toliber ultimate activityasfarI’m con Andlearningisthecan goandlearn. library istheplacewhereeveryone The andpeacequiet. tion, No, theybecameplaces American Libraries, Oh, yes.IfOh, litera Walker willspeak -

- - - - - Walker, visit 2013 ALAAnnualConference speakerAlice To read the full interviewwithnovelistand Lessing. AlbertCamus.Allthese Shakespeare, evenFaulkner. Doris would besomuchpoorer. Without cares. Without CharlesDickens, life people andtheirownaspirations opened uptheemotionsof other opened uptheworldtome.It has andithas could easilybestuck, self,inwhichI narrow self,thelittle has taken meoutof myself.Outof the love andtreasureliteratureisthatit ing whatscaresyou. bit morecourageaboutencounter a bitmoreadventuresome.Have a Beabitmorestrong. their spirit. people togrowabitmorefiberin I also like theideaof encouraging reading. Eventhoughit’s difficult. most nourishingfor whoeveris me deliverwhatismostusefuland forces are beingcalledupontohelp priestess. Iunderstandthatallthe often say, IapproachitasifI’m a you? Is writingaspiritualpracticefor for itall. was nurturedbythesenseof wonder magic of thatwentintomybeing.I and shegrewourfood, andallthe alive. My mothercreatedgardens with thefeeling thattheearthis the fields,andIconnectedveryearly mother hadtotake mewithherto that Iwasbabysatbynature.My interconnectivity oflife. You oftenwriteabout nature andthe door afterdoor. keep openingwindowafterwindow, people giveussomuch;theyjust Oh, itis.ItOh, I istotallythat. americanlibrariesmagazine.org z I like tosay . -

Photo: Ana Elena Noted and Quoted | OPINION What They Said

“It’s hard to say which is worse: an ex- does that look like for the 21st centu- “It suddenly struck cessive deference to a small cultural ry? ‘Welcoming schools’—we’re rein- elite or a hubbub of cyber chatter in vesting in those schools, and what they me that there must which everyone feels entitled not only will have is air conditioning in every be towns and to an opinion but to a grateful audi- classroom; we’re looking for libraries boroughs where ence for it. Concepts such as ‘citizen and science labs; technology labs. And journalism,’ ‘open access,’ and ‘crowd- we’ve heard loud and clear from our there is no longer sourcing’ all have their merits, but it is parents also that wraparound services, either a newspaper difficult to prevent them from descend- social services, and counseling are im- office or a library. ing into a relativistic free-for-all. In that portant to them. So this is what our respect, the transition from printed ref- welcoming schools will receive.” The digital revolution, erence books to the digital universe is BARBARA BYRD-BENNETT, CEO, Chicago allied with economic but one example of a wider and deep- Public Schools, on the consolidation of hard times, is er cultural transition: How do we cope Chicago Public Schools on ABC 7 News with a loss of faith in absolute knowl- Chicago, Mar. 20. changing our culture edge without descending into a sub- forever.” jectivism in which the only truth is the “The public library is a resource many ROY GREENSLADE, author of the passion with which people believe? In people overlook. Libraries subscribe Greenslade Blog, on a reporter from that sense, we haven’t yet fully worked to databases you undoubtedly don’t, the Milngavie and Bearsden Herald in out what the demise of print encyclo- and librarians can find information not Scotland working out of the Milngavie pedias—and all they symbolize— easily available with a Google search Library in East Dunbartonshire, after means for truth and knowledge.” or to a person without library-science the newspaper moved its offices, in JULIAN BAGGINI, writer and founding edi- training.” “Local Reporter Without an Office to tor of The Philosophers’ Magazine, on the CONSUMER REPORTS magazine, “101 Use a Library,” The Guardian, Apr. 23. decline of respect for experts and why he Secrets from Our Experts,” May 2013. burned his old set of Encyclopedia Britani- ca, in “Bibliocide,” Aeon Magazine, Mar. 6. “I’m also hard at work on plans for the access, and coffee shop. It is not your- Obama library. Some have suggested grandmother’s library—library staff is “Some people say libraries are old-fash- that we put it in my birthplace, but I’d there to help, not shush, you. Each visit ioned, they’re lost in a new society. No. rather keep it in the United States.” is a community experience.” It’s all learning in a new environment.” PRESIDENT BARACK OBAMA, at the STEAMBOAT TODAY (Steamboat Springs, RICHARD M. DALEY, former mayor of White House Correspondents’ Dinner, Colorado) EDITORIAL BOARD, on how Chicago, on the importance of building Washington Post, Apr. 28. glad it is that voters ignored its earlier and remodeling public buildings and what opposition to the expansion of the Bud he’d like people to remember about his “It is clear that the library’s success is Werner Memorial Library, in “Our View: june2013

time in office, in “Daley Settles (Not about more than the collection of Library Delivers on Public Promise,” |

Entirely) into Life as a Regular Chicagoan,” books, magazines, audiotapes, videos, Steamboat Pilot & Today, Apr. 14. Chicago Tribune, Apr. 28. and other content it contains. What really makes it worth the millions bor- “There was a time in my life when I “Post-consolidation, what we’re really rowed to build it is the library staff’s wasn’t likely to be found in a library, looking to is, where are the invest- ability to transform it into a true com- much less found one.” ments and what do we want our chil- munity meeting place. The library now PRESIDENT GEORGE W. BUSH, during re- dren to have? And that is that every hosts an average of 45 public events marks at the dedication ceremony for the child in the Chicago Public Schools per month. It has a children’s area, George W. Bush Presidential Library, Los z should have a quality education. What work space, meeting rooms, Wi-Fi Angeles Times, Apr. 25. americanlibrariesmagazine.org

21 OPINION | On My Mind Analog Ideas, Digital Activism

Creating library advocates online and in the real world by Andy Woodworth

tanding outside the line gathering place in the world. It the internet affords a soapbox to any ice cream freeers is where I founded and moderated individual who seeks it, the mental at the local grocery the Save NJ Libraries (now We Sup- marathon of waging public aware- store, a notion struck port NJ Libraries) group, which at ness and library campaigns is in no Sme from out of the blue. one point had more than 10,000 way diminished. In cutting through “There ought to be a library- members. Today, that group serves the cacophony of online discourse, themed Ben & Jerry’s flavor.” other library issue groups such as it is still a matter of delivering the Alas, to this day, this has not Urban Libraries Unite and EveryLi- message to the people who can actu- come to pass. But this single seren- brary. Tumblr, Twitter (where I have ally do something on your behalf. dipitous thought on an otherwise done the bulk of my promotion and Whether it is reaching people in uneventful evening shopping trip is publicity work), and other websites your voting district or service area, a testament to the surprising things create places where people can the challenge of converting them that lead people down the path of gather to work together on issues. into library advocates still exists. library advocacy and activism. While In addition to websites like these, But as the digital world continues to some of my col- petition sites have take shape and mold itself around leagues have It is still a matter risen to promi- the demands of its citizens, so too picked up a mega- of delivering the nence. After will our ability to create library ad- phone, pounded message to the HarperCollins an- vocacy spaces. the pavement go- nounced its limit- It cannot be stressed enough that ing door to door, people who can ed ebook lending this digital activism is not a replace- and orchestrated actually do something on policy in 2011, I ment for face-to-face interactions, rallies, I have your behalf. crafted a petition noisy rallies and protests, handing mostly worked on Change.org that out pamphlets, and other advocacy within the confines of the digital gathered more than 70,000 signa- efforts. Nor should it diminish the world. tures to protest the move. The peti- importance of those activities and Personally, I think it’s the natural tion was signed by people all over their impact. But we cannot be stuck next step in the evolution of library the United States and around the in a library advocacy rut where old advocacy and activism. As society world. Through the We the People tactics such as mailing postcards to creates new gathering spaces on- website, a petition asking for open politicians are used over tools that line, so must librarians become a access to publicly funded scientific recognize, organize, and mobilize part of this digital social fabric. The research garnered the requisite our communities online. Just as we june 2013

| diners, barbershops, and church number of signatures to elicit an of- work to engage our communities

fellowship halls that serve as com- ficial response from the Obama ad- online, we must also work to create mon contact points for the commu- ministration. This petition, a the next generation of library advo- nity are now complemented (and response to the defeated Research cates. z sometimes replaced) by Facebook Works Act, put on the record politi- groups, Pinterest boards, and Tum- cians’ stances on open access. ANDY WOODWORTH is a librarian in New blr posts. In reaching out to the The barrier to participation in Jersey. He’s been actively advocating for community, there is an online com- library advocacy and activism is de- libraries in his own fun way for five years. Read his blog “Agnostic, Maybe” at agnosticmaybe ponent that is hard to ignore. ceptively low in the digital forum. It .wordpress.com and follow him on Twitter at

@wawoodworth. Photo: Krista Godfrey americanlibrariesmagazine.org Facebook is still the largest on- is not, however, without cost. While

22 Another Story | OPINION As a Matter of Fact …

How we interpret data can affect public perception and policy by Joseph Janes

s always, it was a pleasure about the technology, the approach, the ble “Examples of Genocides Since to welcome friends and relevance, and the challenges. 1900” with its very large and very colleagues to Seattle for What is only hinted at is the infor- round numbers and no sources the Midwinter Meeting mation angle, which we know is crit- whatsoever, a number of furrowed thisA January. Two topics of con- ical to any attempt to “validate” or brows and scrunched looks appear versation often arose, unexpect- “verify” facts. It immediately re- around the room. edly: our recent ballot measures on minded me of a class exercise in The point of the exercise is mainly marriage equality and marijuana which I ask students to indepen- about how we typically substitute au- legalization. Of course, we’d been dently check a variety of things found thority for accuracy because it’s easi- living with those issues all through in the World Almanac. It starts beer to figure out. The second question, the election, nignly, asking not very far beneath the surface, is, so the fact that New fact-check- for alternative “What’s a fact?” Trivially, if my anybody else ing apps raise lists of birth- birthstone is opal rather than aqua- wanted to talk questions about stones—which marine, who really cares? But about them took are numerous, shouldn’t Josh Gibson get credit if he me by surprise. accuracy, approach, mainly from a really hit more home runs than Barry We passed relevance, and challenges. variety of jewelry Bonds, asterisks notwithstanding? both of those rel- associations, all Couldn’t very different numbers, atively comfortably, though not with- understandably trying to sell gems. perhaps based on different defini- out a lot of discussion and more than They then work on other examples, tions of homeschoolers, potentially a little soul searching on the part of exploring the “official,” if almost affect public perception, profession- many. A particularly intriguing com- certainly imprecise, recent election al practice, and policy questions? ponent of that discussion was the vote totals, trying to determine who And if my genocide is your war of fine Living Voters Guide, an ongoing actually measures the world’s lon- liberation, how does one properly project that brings together a num- gest railway tunnels and whether record and memorialize that? ber of partner organizations inter- anybody other than MLB.com can be Is there an app for that? Not yet. ested in civic engagement and that definitive on all-time home run It’s fascinating to contemplate this year had its fact-checking pro- leaders (no, though the Hall of Fame how one might work and how that vided by reference librarians at Seat- plaque for Negro Leagues star Josh would affect political coverage, not tle Public Library (“Seattle Gibson mentions his “almost 800”). to mention daily life. If Guinness Librarians Elected to Fact-Check the More potentially fraught are World Records was meant to prevent

Living Voters Guide,” American questions of how many home- pub fights, what would a made-up june 2013

Libraries Online, Oct. 23, 2012). schooled students there are, what factoid lead to? Who knows what the |

It appears now that the Washington kinds of organizations and institu- state of the art on factual interpreta- Post is working on implementing an tions are interested in that question will be by the time Midwinter automatic real-time fact-checking tion, and what their various and rolls around here again in 2019, not system for political speeches. Stories likely competing motivations might to mention views on marijuana and about this have a sort of breathless, be. By the time my students get to marriage …but that’s another story. z world-of-tomorrow kind of feel to “some notable new books for chil- them (“a Shazam for truth,” as an exec- dren,” courtesy of ALA’s Association JOSEPH JANES is associate professor and utive producer from the Post calls it), for Library Service to Children chair of the MLIS program at the Information School of the University of Washington in

though tinged with serious questions (ALSC), and the delicately titled ta- Seattle. americanlibrariesmagazine.org

23 24 americanlibrariesmagazine.org | june 2013 Ebook Business Models Business Ebook A complexarrayoffactors sales representativemayencounter: business modelquestionsavendor explore viablealternatives. take aproactiveapproachand websites, solibrariansneedto explained atlengthonvendor Pricing optionsareusuallynot ing plans. their purchas- quently upgrade panies tofre- enable com- advances that technological try mergersand tinually changebecauseofindus- and businesspracticesthatcon- constant monitoringofpolicies ebook acquisition.Itrequiresa cated—and controversial—partof available isthemostcompli- purchasing (and withoutneedingto be invoiced? tent aftermycontractexpires? package, whathappenstothe con- advance? number of ebooksarepurchasedin associated withusingtheplatform? arethereannualaccessfeesto own, model? or purchase-to-ownbusiness D TECHNOLOGY |Dispatchesfrom theField Here isasamplingof typical n n n n n n ow frequentlywillmylibrary f Iopt for asubscription f Ichoosetopurchaseebooks s thisasubscriptionplatform Can Iviewtheproduct bef H I Can theybewaivedifacertain I I of pricingoptions standing themultitude models andunder- ealing withbusiness affordable content. ore Short-term loans library accessto library may beagood solution for

ment policiesshouldIbeawareof? customers. with aPDA optionfor publiclibrary 3M) havebegunexperimenting somevendors(includingcommon, Althoughitisstillnotpurchased. only thecontentthatgetsused gets business modelguaranteesthat interest inparticulartitles.This gered basedontrafficandpatron ward: Ebookpurchasesaretrig- PDA modelisfairlystraightfor- publishers andaggregators,the demic libraries.Offered byboth models for acquiringebooksinaca- is oneof themosttalked-about ited useof eachebook. single use,multipleandunlim- will alsowanttoknowthepricesfor Theylation toitsprintcounterpart. what thecostof eachebookisinre- so librarianswillwanttofindout a certainpercentagefor theebook, e-versions of printtitles,somestill long astheyusedtoinreleasing titles? to waitbefore itcanoffer bestselling sign upfor aninstitutionaltrial)? Short-term loans (STL)maybea Patron-driven acquisition(PDA) Although publishersdon’t waitas n n n ow longwillmylibraryneed H What aboutembargos? What digitalrightsmanage of aprinttitleplus dors chargethecost lending. available for library ook versionsare period before eb- impose anembargo Many ebookven- - ject collections when choosingebookplatforms: contracts for ongoingaccess. STLs arerentalagreements,not Thekeybudget. difference isthat drives howthelibraryspendsits in thatpatrondemandultimately STLs aresimilartothePDA model wouldn’t otherwisebeabletoafford. to obtainaccesscontentthey good solutionfor librarianslooking Platforms inLibraries.” April 2013LibraryTechnology Report,“E-Book editor, contentdeveloper, andauthorofthe MIRELA RONCEVICisanindependentwriter, sure youknowthevendor’s terms.z are notalwayssetinstone,so be whiteboards) interactive projection devices(for example, quarterly, yearly) Here are20factorstoconsider Access policiesvarywidely. They n n n n n n n n n n n n n n n n n n n n f contentviaclassroom RM policies m commitment A model embargo period approval plans consortial purchasing availability ofprebuiltsub pay-per-view option free trials(length) annual maintenancef use o D invoicing intervals(monthly interlibrary loan minimu title costrelativetoprint perpetual archivef free viewingperiod(f the PD the STLmodel subscription option purchase-to-own option one user/onebookmodel by Mirela Roncevic

ee or PDA) ee - , Need Help? Join.me Online same page Screen sharinggetslibrariansandpatrons onthe sharing hisorher screendownloads options. To theperson getstarted, cludes chatandVoice overIP(VoIP) screen-sharing applicationthat in speaking withapatronremotely. or their screenwhilechatting that allowlibrarianstoeasilyshare significantly. Therearenowtools the market andothershavematured screen-sharing toolshavecomeon defunct Meebo. new Sincethen, Instant Messenger andthenow- lightweight chattoolslike AOL clients ledmanytomovesimple, ability of freeandinexpensivechat The highfailurerateandtheavail it frequentlyfailedtoworkproperly. ence software offered co-browsing, While earlycommercialchatrefer existed for morethanadecade. computers viewyourscreen—has the abilitytoletpeopleonother much easiertojustshowthem. to somethingthatwouldbeso lost helpingpatronsmaneuver ian’s screen.Significanttimeis the patroncan’tseelibrar chat-based interactionsisthat sessions. Whatcomplicatesthese involved asface-to-facereference many chatinteractionsarejustas didn’t getthememoonthis,and person. Somehow,ourpatrons questions werebestansweredin questions. Involvedresearch dium toanswerquickandsimple W Join.me isasimpleandfree Co-browsing orscreensharing— visioned itasame reference, mosten began offeringchat hen librariansfirst

- - - - - reference desk. Subjectlibrariansreference desk. screen-sharing toolsbeyondthe among otherthings. room link, a permanentpersonalmeeting- vance, swappresenters,andprovide people toschedulemeetingsin ad A paidversionof allows join.me through yoursmartphoneortablet. ortalkwithothers chat, text, you caneasilysharescreensand application, stalled thefreejoin.me Android devices.Onceyou’ve in within areference transaction. lows for activelearninginstruction simply provideguidance.Thisal patron controloverthescreenand thelibrariancan givethestrated, able todowhatisbeingdemon order toensurethepatronwillbe tocommunicate. Inwithin join.me chatorVoIPthen eitherusetext the librarian’s Theycould screen. website whereheorshecouldview could sendthepatronalinkto The librarianvisual explanation. ries thatareinvolvedorrequirea at thereference deskfor chatque anything toaccessjoin.me. viewer doesn’t needtodownload interface. The screen-sharing top of the provided atthe sends alink sharer simply people, the To inviteother startsthescreensharing.recipient, whenopenedbythea smallfilethat, Some librarianshaveused Join.me even worksoniOSand A toollike couldbeused join.me becoming therule. Given the learning, serving learning, serving remote patronsis growth ofonline - - - In Practice - - search consultationsfor students frequently provideindividualre Contact herat created LibrarySuccess:ABestPracticesWiki. She blogsatInformation Wants toBeFree and services atPortland(Oreg.) StateUniversity. MEREDITH FARKAS more effective. tion andreference assistancemuch onstrate somethingmakes instruc Beingabletovisuallydem person. patrons asweoffer thoseweservein a similarlevelof servicetoonline allowlibrarianstoprovidejoin.me Toolsrule, nottheexception. like remote patronsisbecomingthe ing andonlinelibraryuse,serving web conferencing software. prone tofailure,thantraditional a bitsimpler, andprobablyless it’sneed todownloadjoin.me, quite ing andVoIP. Sinceviewersdon’t use of onlinetoolsviascreenshar a librariancoulddemonstratethe session, ajoin.me users canattend Since upto250group instruction. for thesamepurpose. line learners.Join.me couldbeused tual researchconsultationsfor on conferencing software tooffer vir screen sharingfunctionalityof web tance educationservices,usedthe Given thegrowthof onlinelearn Join.me couldevenbeusedfor |

[email protected] TECHNOLOGY isheadofinstructional z in Northfield, wich University area(s). AtNor their liaison and facultyin digital anddis Steiner, headof Vermont, Heidi by Meredith Farkas . ------

25 americanlibrariesmagazine.org | june 2013 26 americanlibrariesmagazine.org | june 2013 By MariaR.Traska nurture them? without alibraryto a loveforreading How cankidsdevelop National Alliance forPublicCharterSchools) hasnot dents inthe2012–2013 academicyear, accordingtothe bymorethan2.3millionstu charter schools(attended poorest students. resources cansignificantlybolster learning for eventhe tion Outcomes,acredentialed librarianwithsufficient and Stanford University’s Center for ResearchonEduca KeithCurryLance,researchers suchasStephenKrashen, Asdemonstratedtimeandagainbyeducation librarian. library staffed byatleastonestate-certifiedschool anadequately stocked andfundedschoolschool setting: mented factorthatimprovesstudentperformance inany must adhereto. with fewer strictures than what traditional public schools system tocreateanalternativeschoolunderacharter cases a for-profit entity, contractwith a publicschool in havingaparentorothernonprofit group,orinsome of traditionalpublicschools.Proponentsseethesolution education programunboundbythebureaucraticconfines of transferring intoadifferentlytion structuredpublic- underperforming theyneedtheop schoolstosucceed, tion intheUS.Reformers saythatinorderfor studentsin choice as a key component in strengthening K–12 educa 2005, overseesbothof them. nonprofit Tri-Valley LearningCorporation, formed in lish asisterhighschoolthatopenedin2010;the ment magnetschools.Parents andteachershelpedestab local school district closed the city’s two open-enroll Valley CharterSchool(LVCS) nineyearsagowhenthe working inthelibrary,” shesays. Cuesta College.Shehasnoclerkoraide.“I’mthesoleperson students whileworkingonlinetoearnalibrarycertificatefrom garage. Sincethen,she’s becomethefull-timelibrarian for1,085 sorts, saysEschen—anassortmentofdonatedbooksinateacher’s books. Thenewlyformedschoolalready hadalibrarycollectionof LVCS’s success notwithstanding, the proliferation of The librarycommunityiskeenly awareof onedocu The educationreform movementembracesschool Concerned teachersandparentsformed Livermore itself openedin2004,unpackingboxesandcataloging Livermore Valley (Calif.)CharterSchoolwhentheschool inda Eschenbeganherfirstdayasalibraryvolunteerat ------course, alibrary inwhichEschenwillcontinue toserve. dition toclassrooms andlabsfor of 1,300students—and, eventually haveplaygroundsand athleticfacilitiesinad joint-use facilityattheendof May. Thenewbuilding will the gradeschoolanditssister highschoolintoanew Valley Learning Corporation was scheduled to move both Tri-tops, dependingonwhatsubject isbeingtaught. and someclassesintheuppergradeshavetheirownlap Thelibraryhassixlaptopsfor$1 perstudent. studentuse, by LVCS parentsfor newacquisitions,slightlymorethan For the2011–2012year, shesayshad$1,250donated nated for theinitialcollection. way for mostof thisschoolyear. No moneywasdesig out asinglebookinitslibraryandhasfunctionedthat rehab, reopenedfor the2012–2013academicyearwith School, whichjustunderwentacomplete$63million cently, he says. Anacostia High their libraries have not, number of schoolshavebeenphysicallymodernizedre aD.C.-basedent Organization, parentsgroup.Whilea Peter MacPherson of theCapitolHill PublicSchoolsPar don’t havethespacefor them,” saysparentandactivist “In D.C., mostcharterschools don’t havelibraries—they Charter schoolsintheDistrictof Columbia aretypical. bricks versus Books survey wasscheduledforreleaseinJune.) schools did. (Issued everyfouryears,the2011–2012 lic that about 92% of traditional pub May—indicated Schools andStaffingSurvey schools. TheUSDepartmentofEducation’s seen anequalincreaseinschoollibrariesthose Eschen workswithoutapreapprovedlibrarybudget. schools hadaschoollibrary,butonly51%ofcharter —the mostrecentasofearly 2007–2008 ------

27 americanlibrariesmagazine.org | june 2013 28 americanlibrariesmagazine.org | june 2013 in aMay 10, 2010, blogpost for emeritus at the University of Southern California, argued every 750students. ortechnicianfor(36 hoursperweek)libraryaide,clerk, certified teacher-librarianandonepart-time recommendonefull-time standards California modelschoollibrary butreally,good, they’re not.”The the libraryservicesherearepretty $2,400. she Officials, Her 2012–2013budgetisabout school’s parent-teachergroup. hoursfundedbythe has extended puters, andascanner. Thelibrary online catalog,44networked com periodicals andonlinedatabases,an about 20,000 booksandsubscriptionsto 2,400 9th–12thgraderswithacollectionof LoftonSchool inManhattan Beach. servesabout full-time certifiedteacher-librarianat Mira Costa High California workssoloasa SchoolLibraryAssociation, fornia’s publicschools.Jane Lofton, presidentof the But thingsaren’t thatmuchdifferent inmany of Cali Stephen D. educationexpertandprofessor Krashen,

Connect withusattheALAAnnual Conference inthe ALISE/LISbooth#137 Journal’s· Alumnae/inamedtoLibrary “MoversandShakers”forthree yearsrunning · Advancedsevenspotsinthe2014U.S.NewsandWorld Reportnationalrankings outlibraryleaders. Lookatourmostrecenthas beenturning accomplishments: For more than80years,DominicanUniversity’s GraduateSchoolof LibraryandInformation That’s Innovations in of libraryprograms; ranked#12forchildren’s andyouthservices

says, “think

Library andInformationScience. Education Week -

Dominican. and socharterschoolsare proliferating. Butlibraries embraceschoolchoice, Educationreformers thatit’s not in charterschools aren’t. - Journal publishedinthe the post, performance. He pointsoutinacondensedversionof school quality but poverty that causes poor student findings thatshowself-selectedreadingisapowerful whichmakeslower readingachievement, senseinviewof says. “Studiesconfirmthatlessaccesstobooksmeans at homeorintheirowncommunities,Krashen books to accessbooks for poorchildrenbecausetheyhavelittle gslis.dom.edu (2011, vol.2),thatpeoplethinkUSschoolshave failed mainlybecause“American studentshave

School libraries may be the only source of

Denmark’s 3%.”

not done especially well on international | in poverty—over20%,comparedwith 708.524.6845 tests of mathandscience.Studies US hasahighpercentageof children show, however, that American stu cre overallscoresarebecausethe dents fromwell-fundedschools 2009; Martin, 2009).Themedio (Payne and Biddle, 1999; Bracy, who comefromhigh-income countries onthesekindsof tests families outscorenearlyallother New EnglandReadingAssociation

- - the academicperformance of thestate’s charterschool than 12 years of charter schools in Illinois, more After schools inChicagoatthattimelacked schoollibraries.) article thatatleast160of the472publicelementary Bond saidinanOctober19, 2010, Public Schoolsspokeswoman Monique schools alsolacklibraries:Chicago sometraditional publicthen, operate withoutlibraries.(But charter schools,mostof which officials haveheavily invested in new standardsandtests. health care,andbooks—noton schools shouldfocus firston food, McQuillen, 2010).” Lee,and 2008;Krashen, (Achterman, large positive effect on reading test scores have shownthataccesstoagoodschoollibraryhas nia andanotherinvolvingstudentsfrom40countries, the effects of poverty. Two recentstudies,oneinCalifor good evidence that quality school libraries can mitigate predictor of readingachievement.” He adds,“We have Chicago isanothercitywhere Krashen’s conclusionisthat Chicago Sun-Times for poorchildrenbecausethey have littleaccesstobooksat betheonlysourceofbooks Schoollibrariesmay home orintheirown communities.

- Organizing for change traditional publicschools. students stilllagssignificantlybehindinits force recommendedafull-timelibrarianineveryschool, in theDecember2012taskforce Althoughthetask report. to makingwhateverimprovementswererecommended study D.C.’s publicschoollibrariesandtocommititself forced DCPSmanagementtoappointataskforce to The presenceof librariesinschools,then—and

the groupspearheadedbyMacPherson

enrollment of fewer than300students, the involvementof parentsinadvocat positions inthe58schoolswithan ing for theirinclusionandsup the defundingof schoollibrarian port—is thekey toeffecting Henderson proposed in 2012 positive change.MacPherson lic SchoolsChancellorKay says district parents are doing library funds.WhenD.C. Pub most of theheavyliftingwhen it comes to getting moreit comes to getting - - -

29 americanlibrariesmagazine.org | june 2013 30 americanlibrariesmagazine.org | june 2013 spends, onaverage,$17–$25perstudentannually dedicated fundfor librarybooks,” andtheschooldistrict terrible shape,” MacPherson says. “Right now, there is no evenmorefull-timeschoollibrarianpositions. cutting fewer than400studentstoahalf-timelibrarian—thus Henderson’s currentproposal istolimitschoolswith Statistics from theUSDepartmentofEducation’s 2007–2008 “The school librariesin the city,“The by and large, are in Public Library continuallydemonstratesinnovativeplanning Public Library and innovation,aplaceinthecommunity where people congratulates ourcolleaguesatthePrinceton Honored modelofcommunityengagement asanexemplary Award fortheirCommunityCollaboration Information Today, Inc.LibraryoftheFuture positioning the library as a cornerstone of lifelong learning oflifelonglearning asacornerstone positioning thelibrary The NewJerseyStateLibrary and responsiveness tocommunityneeds,the Princeton and developmentofpatron trainingprograms, further Public Library,winnersofthe2013ALA/ can cometoshare andnetworkaround technology. Enhanced Technology Servicesproject! Schools andStaffingSurvey books. That’s not enough for the Capitol Hill parents; their our Parent Teacher Organization.” this time,theonlyfundsfor newpurchasescomefrom purchase new-releasebooksfor ourlibrary,” shesays.“At compiling datatogetfundsdedicatedfor thelibraryto “Right now there is a parent group that isdevelopment. been attheheartof herschoollibrary’shas creationand LVCS librarianLindaEschen says parent involvement how theD.C. resultssofar, parentsgrouphasgotten and lic school, such parental advocacy is a critical factor. That’s fronting localpoliticiansfor severalyearsatastretch. past thatfor howeverlongittakes, evenifitmeanscon when itcomestopublicpressure,andparentshavepush just athreshold of pain that elected officials can withstand” MacPhersonproblems areaddressed, advises.“There’s sense thatyou’re notgoingawayandwillkeep on” until well astheteachers’ union. trict of Columbia LibraryAssociationandlocalPTAs as parents grouphashad representation ateverysingleoneof thosemeetings.” The “wehadschools meetingsearlierthisyearineveryward, library cuts,andwhenHenderson heldstate-of-the- 4,000 signaturesonapetitiondriveagainsttheproposed successful advocacyprogram,” hesays.His groupgathered e-readers pluslibrarydatabasesubscriptions. and student inadditiontoa40,000-volume ebooklibrary goal isfor eachschoollibrarytohave15–20booksper And whetheritisacharterschoolortraditionalpub The key toeffecting changeis “conveying anabsolute MacPherson “We’ve thinkstheycangetit. hadavery journalist, author,journalist, andblogger. MARIA R.TRASKA . significant support

is aChicago-basedfreelance z from theDis - - - connects people from all over the Web, through

the biggest search engines

the most popular web sites

and great online conversations

to your library.

People start information searches in lots of places online. And if your library’s catalog is in WorldCat, they can find their way from these starting points back to all the great resources you provide.

Learn more at www.oclc.org/syndication Sound Literature A guide to audiobooks for youth

By Mary Burkey

he act of reading is evolving. Today’s readers can experience the same story as they toggle between audiobooks in the car, Tebooks on the iPad, and paperbacks at home, and young people in particular are naturals in this transmedia world. june 2013

| Introducing these digital natives to literature as audio- lived format. As audiobooks shift from physical to digital

books can be as easy as maintaining a format-neutral policy releases, questions about digital rights management and when referring to reading. As families, classroom teach- downloading protocols raise concerns about content ers, and library workers consider expanding their collec- ownership versus rental. Availability of both broadband tions of literature in the 21st century, evolving formats for downloading and the players needed for listening to provide challenges to developing and maintaining them. digital content provokes unease about equity of user access. The result? Libraries need to build their audio col- Build your collection lections on a just-enough-for-just-right-now basis. That The quickly changing world of publishing can paralyze means focusing on a variety of currently available formats librarians who are hesitant to purchase a possibly short- that address the diverse needs of the listener and allocat- americanlibrariesmagazine.org

32 ing limited funding to patron-driven selections. particular online vendor—or none at all. Many titles are Auditory learners, once frustrated by the dearth of released as digital-only products, with no physical edition. nonfiction audiobooks, now have a multitude of categories Some audio publishers have both a public library division to provide enlightenment and education. Some audiobook and a school division. Some formats, such as the Playaway publishers have produced complete courses, developed version of a publisher’s title, may be available through one and recorded by professors with supplemental texts and vendor for the school market, another for the public library online exams, such as Recorded Books’ Modern Scholar market, and directly from the manufacturer’s website for imprint. Other large publishers offer blockbuster-fiction consumers. Noncommercial recordings produced for bestsellers, simultaneous audio and print versions of people who are blind or otherwise print disabled usually indie favorites, and scholarly nonfiction. Quality nonfic- cannot be found through any commercial vendor. tion for youth, which often contains essential visuals, may A simple solution to edition and format overload is to have an additional disk in the physical audiobook edition search OCLC’s WorldCat website (worldcat.org), the that includes computer-readable images, or may combine world’s largest catalog of library materials. There you can text, image, and narration in a streaming digital product. seek a desired title and narrow the format parameters to Biographies and memoirs are a fast-growing segment of audiobook, CD, or e-audiobook. The results show the the market, with the added benefit of an author voicing range of formats and editions held in libraries around the his or her life story. Even small niche publishers have world, including international editions and foreign- created audiobooks for a unique clientele, language audio versions, as well as audio- such as Knitting Out Loud. Digital down- books available through Recordings for loads offer a hybrid product: both images Auditory learners— the Blind and Dyslexic. You can then search and professional narration synced to text. once frustrated a commercial source, a school or library When creating a balanced collection, wholesale vendor, or the publisher for a librarians need to consider not only the by the dearth particular edition. Schools and libraries format and genre of audiobooks but also of nonfiction may choose to purchase and repackage a production and narration methods. Au- audiobooks—now lower-priced retail consumer physical diobooks are not a one-style-fits-all edition, while many institutions may want format. Some listeners like evocative have a number to purchase directly from the title’s pub- audio effects and underlying music. Oth- of categories to lisher to take advantage of sturdy library ers are distracted when music and other choose from. packaging and lifetime free replacement sounds compete for attention and prefer of physical media. AudioFile (audio- only narrated text. Some listen best when filemagazine.com) has an excellent audio- a cast of readers portray characters. Others have a favor- book reference guide that includes a detailed listing of ite narrator and will listen to anything he or she reads. publishers large and small, with web links and contact Many publishers provide added content such as author information. If a certain audiobook or other desired for- interviews. Some specialize in audio recordings of live mat is currently out of print, there’s a possibility that the stage or radio productions. Choose audiobooks with a publisher may have a small number in stock if you contact variety of playing times, as well, from short stories or the company directly. vignettes to epic-length titles that may span more than 20 hours, focusing on the student-friendly sweet spot of Show off your new audiobooks three-to-five-hour titles. Providing a broad spectrum of Once you’ve built your audiobook collection, promoting audiobook styles enables listeners to find a title that fits it can be as straightforward as a face-to-face recommen- their particular mood or personal listening preference. dation, or an eye-catching display in a community gather- For a diverse collection, track down titles from a large ing place. Whether personal or passive, marketing is june 2013

number of publishers. Hunting down a book’s audio edi- essential for increasing patron usage. | tion can be frustrating, though. Consumers, as well as Encourage audiobook use among kids and teens by schools and libraries, often turn to large online vendors hooking parents and teachers first, and let these trusted such as Amazon, Barnes & Noble, and Audible.com to see adults provide word-of-mouth recommendations. Adult if a title is available in audio format. However, this will coaches and youth advisors are ideal partners who not give a clear picture of the entire range of audio editions welcome suggestions of audiobooks that will allow produced. Some titles are published as both retail and students to keep up with required reading by listening library editions—often by different companies, with dif- on the bus, while waiting for club events, or during after- ferent narrators, and as abridged and unabridged versions. school activities.

Just one of those possibilities may be available from a Additional methods to try: americanlibrariesmagazine.org

33 34 americanlibrariesmagazine.org | june 2013 to giftedandtalentedhighschoolstudents. efit groups from toddlers with developmental disabilities needs youthandsharehowaudiobooksspecificallyben from publishersthatdetaileducationalbenefits. library’s audiobookcollectionanddistributehandouts and gainanadultreadytosharefavoriteswithstudents. ping asurefire YA audiobookintohisorherworkmailbox, howlisteningtoliteraturebenefitsliteracy. plaining alongwithresearchdataex parent emailnewsletters, for over-the-summer checkout. library package acollectionof audiobooksfromtheschool a child’s interestsandfamilyvacationtraveltime, town tocross-countryjaunts. tions that fit listening time blocks, from short trips around mendation listonyourlibrarywebsite. Alsopostarecom ing parent-teacheropenhousenight. holidaybreakordur on-the-go listeningbefore thenext n n n n n n n

Target interventionspecialistswhoworkwithspecial Convert ateacherwhohaslongcommutebyslip Highlight yourcollectionduringtoddlertimeand in Offer to bea virtual “shopper,” willingto matchboth Create displaysorhandoutswithaudiobooksugges Set up displays of family-friendly audiobooks for Offer tospeakinterestededucatorsaboutthe Phone 800.245.9540 | Fax800.369.5490Mackin.com 3505 CountyRoad42 W,Burnsville,MN55306 There’s anAppforThat

MackinVIA’s eBook readerappsareavailableforallthesedevices.

So nowyoucanaccessall of yourMackinVIAdigitalresourceson

iPHONE iPHON

(and that,andthat)

TOUC TOUCH

iPOD your smartphone,tabletor desktopcomputer. iPOD

Progress isabeautiful thing.

PHON PHONE

D ANDROI ANDR

TABLE TABLET

D ANDROI ANDR MackinVIA ------

iPAD iPAD lections of audiobookswillwanttoincludeacirculating audiobook group.Librariesthathavelargephysicalcol and bycreatingastudentlisteningcluborparent-child listening stationsinyouthandteenareasyourlibrary Give kidsachancetotryoutaudiobooksbyproviding Get kids involved lishers whomayoffer giveawaysorcontests. library website and social media outlets, friending pub classroom collections,andpromoteaudiobooksonthe to fulfillstudents’ readingassignments. club requirements and lobby teachers to allow audiobooks downloads atvenuessuchasthelocalpool. posters about online library card applicationsand digital family listening.Getpermissiontodisplaypromotional transfer exactlylike achecked-out deleting physicalitem, importance of following copyrightlawandtreatingthis sonal MP3playerorcellphone.Remindthemaboutthe an audiobookonCDorflashdrivetoloadontotheirper have only digital players may ask for adviceon how to rip collection of inexpensiveplayerstoincreaseuse.Kidswho n n n

Include audiobooksincurriculum pathfindersand Incorporate listeningminutes in summer reading Step outsidethelibrarytopromotesummertime

KINDLE KIND

NOOK O NO

C MA C MA

EDUCATIONAL RESOURCES MA

WINDOWS WIND C K I N - - - books andebooksontoe-readers.Feature theseteensin citizen centerstoteachresidentshowdownloadaudio multigenerational programthatsendsthemtosenior youth volunteersintotheaudiopromotionactwitha oralongsideworkout DVDs.beadwork, Getaudio-savvy or books in collaboration with craft programs on knitting ebooks ontoavarietyof digitaldevices. and demonstratinghowtodownloadaudiobooks Week, orTeen Tech Week zoo byhostingagadgetpetting audiobooks toyouthservicesprogramming,Teen Read order to“check itin,” andtoneversharethefile. Tie and destroyingthetitleimmediatelyafterlisteningin This explosionof optionsopenstheworldof literaryexcel literature, leading to streaming digital content everywhere. instant accessibilitywillexpandtheroleof multimedia order to provide the best for patrons. Varying formats and signs of andlibrariesmustlearntoadaptin slowingdown, The rapidpaceof changeinthepublishingworldshowsno Into the future library website. recommend favoritetitlesinaudiobooktrailersonthe how-to videosthatdemonstratedigitaldownloadsand Louisville FreePublicLibraryShawneeBranch, Multitasking teenswillappreciatedisplaysof audio KY - - -

find new appreciation from new audiences. find newappreciationfrom story” and “Every story its format,” allowing literature to as“Everypatronhisorher revised reader”—have been readerhisorherbook”and“Everybookits ence—“Every Ranganathan’s Second and Third Laws of Library Sci As libraries arereinventedinthedigital age,tradition. cates anauthor’s wordsinawaythatrecreatestheoral literature, andvoicecapturedonaudiobookcommuni truth remains:To behuman istoshareourstories. how muchthemedium of themessagemaychange,acore every youngperson’s Yet transliteracyeducation. nomatter to sound will be part of shift seamlessly from image to text formats allowareinterpretationof literacy. Theabilityto tions of newdigital “reading” and“book”arerewritten, Astheverydefini never havechecked outaphysicalbook. lence toyounglibrarypatrons,manywhopreviouslywould The auralappreciationof storyistheoldestform of Visit Visit Practical GuidetoSoundLiterature (ALAEditions,2013). is anexcerptfrom herbook AudiobooksforYouth: A Association forLibraryServicetoChildren. Thisarticle Notable Children’s Recordings CommitteeofALA’s librarian from Columbus, Ohio. Sheispastchairofthe MARY BURKEY alastore.ala.org —AIA KentuckyAwards jury are tobecommended.” materials andcompositionoftheaddition ing building.Thesimplicityoftheform, more enclosedspaceofferedbytheexist- landscape, offeringanalternativetothe the otherdirection,openingupto building. Ittakesanattitudeoflooking strong andcontrastingformtothehistoric “The newadditionisawell-proportioned, is aNationalBoard-certified teacher- Meyer Scherer&Rockcastle, Architecture &InteriorDesign topurchase acopy. www.msrltd.com 612 3750336

z LTD - - -

35 americanlibrariesmagazine.org | june 2013 36 americanlibrariesmagazine.org | june 2013 either for on-siteuseorfor circulation. I preselected appsare availableto usersofsomepubliclibraries, youth servicesworld aboutapps.Tablets loadedwith n recent monthsthere hasbeenan ongoingconversationinthe and Tools toservechildren withspecialneeds By BarbaraKlipper A long thread on the Association for Library Service to apps, so families who don’t already own this technology Children List (lists.ala.org/sympa/info/alsc-l) recently will have access. presented some strongly held opinions about the advis- 3. Librarians can offer programs that introduce tablets ability of using apps during storytime. and specific apps to families who have a child with autism. Librarians are looking at the possibility of reviewing In higher-income communities, this will help parents apps for developers and putting our expert imprimatur preview apps before they purchase them; in poorer areas, on their content and value, just as we already do for books this can introduce families to apps available on library- and other formats. Regardless of what you think are the owned devices. best ways to incorporate apps into services and programs 4. A brochure or program can describe the features to for children, librarians agree that they are important and look for when previewing an app for a child with ASD. here to stay. This approach empowers parents and helps them assess This conversation is timely and useful, but it’s incom- the value of new apps as they appear on the market (and plete unless we expand it to include a discussion of how new ones appear every day). There are features that make librarians can use apps to serve children with autism. an educational app autism-friendly for use in the library, Autism Spectrum Disorder (ASD), the official name for which I list below. For home use, parents should look for autism, is a neurobiological condition characterized by apps that can be customized with their child’s name or impairment in social-interaction, communication, and other personal information, and ones that keep data to behavioral skills. With the incidence of ASD at 1 in track their child’s progress. 88 in the United States, youth services librarians Because some children with ASD are already using need to think about how we can work with these tablets and apps in the classroom and in therapies, children and how apps play an impor- school libraries can tailor them to indi- tant role in serving them. viduals. Classroom teachers, speech or The popular media and the ASD blogo- occupational therapists, and even the child’s sphere are full of discussions about the When identifying paraprofessional aide can all provide amazing ways in which children apps for children, guidance about which apps are with ASD have embraced tablet remember that one especially appealing and helpful computers and apps, and how for each student and how they these devices are taking the size does not fit all. can be used during library time. place of more expensive and Media centers that offer tablets as cumbersome assistive technology for well as laptops and desktop computers for many children with this disability. student use can also provide access to au- A number of developers are creating tism-specific apps on these devices. high-quality apps that are specifically designed for children with ASD and other disabilities. For What works? example, there are apps that work on social skills (such as How do you identify apps that will work well for children Look in My Eyes Restaurant from FizzBrain), apps that with ASD? The first thing to keep in mind is that apps for support the development of daily living skills (one is Se- kids with ASD (just like apps for typically developing kids) quences for Autism from Club LIA), and ones that target are not one-size-fits-all. The value of an app will depend speech and language issues (such as ConversationBuilder in part on the skills that it teaches and its appeal to an from the Mobile Education Store). Other apps, like Pocket individual child. However, some criteria make for an Pond HD from Trigger Wave, Super Stretch Yoga from The especially autism-friendly educational app. Nicole Feeney, Adventures of Super Stretch, the Toca Boca products, and assistive technology specialist at the NEAT Marketplace the new apps for babies from Fisher-Price, though designed in Connecticut, and I came up with a list of elements to for the general population, are appealing to these kids. look for when evaluating an app: june 2013

n There are several ways to integrate apps for children Does it have images as well as text? |

with ASD in a public library setting: n Are the images realistic pictures or photographs? Tools to serve children with special needs 1. Apps can be used in storytimes. For example, many n Does it include video modeling (demonstrating the children with ASD have tactile defensiveness and are not lesson with a video)? comfortable with finger paints, glue, or other craft sup- n Does it provide reinforcement (rewards) and error- plies. Providing these children with a tablet device less learning? (If you want to understand why this is loaded with a doodle or drawing app allows them to par- important, read “Errorless Teaching,” bit.ly/ZMtcHc.) ticipate in an art activity in an adaptive fashion. n Can you set the difficulty level, the number of pictures 2. Tablets for circulation or in-library use can be on a screen, or the space between pictures so it won’t be

loaded with some appropriately labeled autism-specific overwhelming for a child with autism? americanlibrariesmagazine.org

37 n If there is a timer, can it be turned off? n TouchAutism (touchautism.com/TouchAutism n Can you turn off speech or other sounds? Apps.aspx) Every app that is suitable for teaching kids with ASD n Apps for Autism at The Appy Mall (appymall.com) will not have all of these features, but a good app will have In addition to checking the recommendations on at least some. these sites, you can look at the products of developers whose work has been used successfully for many kids The apps for that with ASD. Here are just a few: Where can you get recommendations? In the Winter 2013 n Brain Parade (brainparade.com) issue of Young Adult Library Services, “Autism? There’s an n FizzBrain Apps (fizzbrain.com) App for That” by Renee McGrath, a board member of ALA’s n Project Injini (injini.net) Young Adult Library Services Association, describes a n Smarty Ears Apps for Speech Therapy (smarty number of apps she recommends for use with teens with earsapps.com) autism in a library setting. Her article is especially useful n Speech with Milo (speechwithmilo.com) because there are not many sources available for finding n Toca Boca (tocaboca.com) appropriate apps for teens with autism. However, a num- Once you find a developer who creates products you ber of websites provide excellent resources for finding think are good, you can “like” them on Facebook or follow apps for younger children with ASD, including: them on Twitter to receive notices of special discounts n Babies with iPads (babieswithipads.blogspot.com) and offers. You’ll also be alerted to new apps you may want n Apps for Children with Special Needs (a4cwsn.com) to purchase or download. n Autism Apps (autismspeaks.org/autism-apps) Here are a few of my favorite apps (by developers not n iPad Apps for Autism (squidalicious.com/2011/01/ listed above): ipad-apps-for-autism-spreadsheet-of.html) n Which Go Together? (kindergarten.com). One of n iAutism (text in Spanish) (iAutism.info) several apps from this developer that apply the principles n Welcome to Their World Apps (welcometotheir of applied behavioral analysis (a therapeutic learning ap- worldapps.blogspot.com) proach used with many children with autism). The pictures

It takes forever to earn vacation time. FORTUNATELY, YOU COULD SAVE WITH GEICO’S SPECIAL DISCOUNT. june 2013

| Get a free quote.

1-800-368-2734 geico.com/disc/ala Mention your ALA membership to see how much you could save. Some discounts, coverages, payment plans and features are not available in all states or all GEICO companies. Discount amount varies in some states. One group discount applicable per policy. Coverage is individual. In New York a premium reduction may be available. GEICO is a registered service mark of Government Employees Insurance Company, Washington, D.C. 20076; a Berkshire Hathaway Inc. subsidiary. © 2012 GEICO americanlibrariesmagazine.org

38 Going Places2. this developer that’s by worth considering is Model Me can alsobeplayedtoreinforce Anotherapp thelesson. situations thatevoke Ashortsong aspecificemotion. introduce andspoken text, children andbothwritten .com learning wordsandcategories. can beturnedoff. Thisgame offers opportunities for he or she hasmadethe correct choice, but the sounds possible groups.Soundeffects letthechildknowif tify whereanobjectbelongs,givenfour Players aregiventheopportunitytoiden Natural LearningConcepts( ( Together, fromGrasshopperApps pairing objectsisThingsThatGo higher-functioning kids. aren’t easy, so this is more appropriate for Thechoicesinterlude afterseveralpairsareidentified. and thereisreinforcement intheform of amusical describes therelationshipbetweenpairedobjects; are photorealistic;aclearvoiceasksthequestionsand grasshopperapps.com n Another excellentappthatdealswith n

). Shortstories,accompaniedbyphotographsof real Autism Emotion, ModelAutism Emotion, Me Kids( Sort andCategorizeGame, ). nlconcepts.com - ). ). modelmekids

other sounds? Can youturn off speechor

meet theirneeds. and thatyouareopentofindingwaysservethem Pour hours of fun and learning from this interactive app. .com tant message that these families are welcome in your library message that these families are welcome in your library tant n to accesstheseappsathome,yousendtheveryimpor

). Allkids—notjustthosewithautism—willget My PlayHome, byShimonYoung ( cereal, turntheTVorCDplayeronandoff, model through workshops andanALSCwebinar. and hastrainedmanychildren’s librariansinthisprogram the FergusonLibraryinStamford, Connecticut,in2009, developed agrant-fundedSensoryStorytimeprogram at working withchildren with autismsince2006.She BARBARA KLIPPER or affordable (under$5).Bymakingthem information thatcanassistparentswhowant available atyourlibraryorbyproviding and effect, labeling items in a home, and much more.Greatfor demonstratingcause andmove charactersfromroomtoroom, the resourcesmentionedherearefree discussing families andthe z sive autism-specificapps,mostof they doathome. Although therearesomeexpen

has beenteachinglibrariansabout myplayhomeapp activities - -

39 americanlibrariesmagazine.org | june 2013 40 americanlibrariesmagazine.org | june 2013 ALA

2013 Annual Conference Preview

Photo: TK Photo: TK

Photo: ©Cesar Russ Photography as committedever totheprofession. Columbian Exposition—to now, 120yearslater, we remain year Chicagoplayed host—in1893,duringtheWorld’s A Annual Conference June27toJuly2.From thefirst attendees toChicagofortheAssociation’s 137th LA welcomesourcolleagues,vendors, andother Preview Preview 2013 Conference Annual By MariamPera

41 americanlibrariesmagazine.org | june 2013 42 americanlibrariesmagazine.org | june 2013 ALA of theDigitalPublicLibraryof to presentersincludingDanCohen ing Uncommons andMaker Monday out inprogramsfromtheNetwork ing OurLibraries,Ourselves,” plays The conference theme,“Transform pearances, award presentations,and grams, specialevents,authorap andEricRohmann. Raschka, Jerry Pinkney, Chris ErinStead, Paul O. Zelinsky, BrianSelznick, dren’s bookillustratorsincluding with high-profile expertsandchil Medalanniversary of theCaldecott view, page20),andOctaviaSpencer. AliceWalkerter Kuznick, (seeinter OliverStone,andPeAnn Patchett, GiadaDeLaurentiis,ple Grandin, Fu, CongressmanJohn Lewis,Tem Jaron Lanier, KhaledHosseini, Ping conference includesStevenLevitt, lineup of speakers throughoutthe Harwood Institute. Theincredible America andRichHarwood of the We’ll alsobecelebratingthe75th Here’s justasample of the pro

2013 Annual Conference Preview - -

------Rogue EconomistExplorestheHidden national bestseller book Levitt, day, June StevenD. 28,4–5:15p.m. O Conference overview alaannual.org go. For acompletelisting,visit other activitieshappeninginChica be purchasedinadvanceoronsite. Tickets areavailablefor $30andmay sions andenjoyChicago’s scenery. to clearyourmindfor theday’s ses Walk during thePresident’s Program. curs bear surprisingresults. proaches toeverydayproblemscan how applyingcounterintuitiveap problem-solving skillsbyshowing Side ofEverything pening General Session, pening GeneralSession, The Join the The Sunday, June 30,3:30–4p.m. on Think LikeaFreak Association for Library Ser ALA AwardsPresentation coauthorof theforthcoming Sunday, June 30,7–9a.m., Think Fit 5KFun Run& . , willchallengeyour Freakonomics: A and thein on Fri oc - ter - - - , - - -

elect. This elegant, ticketed This elegant, eventelect. Stripling anddivisionpresidents- oring incomingPresidentBarbara President Maureen Sullivaninhon July p.m. 2,11:15a.m.–1:30 annual sion willbefollowed bythesecond Schuster). TheClosingGeneralSes sule Bandit Detective: TheCaseoftheTime-Cap ing firstnovel, She’ll bediscussingherforthcom Spencer Award–winning actress day, July 2,9:30–11 a.m. ties. Preregistrationisrequired. Medal willbeincludedinthefestivi the 75thanniversaryof theCaldecott for Specialrecognitionof children. of theyear’s mostdistinguishedbooks celebrates theauthorsandillustrators 5:30–11 p.m. will take placeon WilderCaldecott, AwardsBanquet vice toChildren(ALSC)Newbery, Council. certification from theUSGreen Building And theWest BuildinghasLEED Events, Trade Shows,andConferences. Environmentally SustainableMeetings, Evaluation andSelectionofVenues for ASTM Standard thatpertainstothe rated LevelOneCertificationwiththe Inaddition,McCormickPlace of carbondioxideemissions. avoidance ofnearly731millionpounds years, whichcouldamounttoacarbon wind powereachyearforthenextthree estimated 130millionkilowatt-hoursof announced inMaythatitplanstobuyan Certificates (RECs).McCormickPlace wind energy Green-e RenewableEnergy electricity usethrough thepurchase of has committedtooffsetting 100%ofits convention centerinNorthAmerica— Chicago’s McCormickPlace—the largest Closing General Session, TuesClosing GeneralSession, Inaugural Tuesday, Brunch, is thekeynote speaker. (October 2013, Simon& This grand occasion Thisgrandoccasion Randi Rhodes,Ninja Sunday, June 30, Octavia Academy

Join - - - -

- -

Photo: McCormick Place Photo: McCormick Place EXHIBITS and technologies. Find thelatestpublications,products, SPECIALTY PAVILIONS trators throughout theconference. adult andchildren’s authorsandillus portunity tomeetandgreet favorite the Author/Illustrator Monday, July1,9a.m.–2p.m. Sunday, June30,9a.m.–5p.m. Saturday, June29,9a.m.–5p.m. Friday, June28,5:30–7p.m. EXHIBIT HOURS: as theexhibitskickoff. tendees theirfirstchancetonetwork exhibit hall,givingexhibitorsandat food, drink,andentertainmentinthe The follow theOpeningGeneralSession. by ALAandChicagodignitaries,will cutting ficial openingceremony andribbon- technologies. books, onlineservices,tools,and variety oflibraryproducts, services, ence. Attendeescanexplore awide development attheAnnualConfer the hubforlearningandprofessional the hottestauthors, tiple pavilionsandstagesfeaturing W Individual boothswillhold Friday, June28,4p.m. Opening Reception tions inattendanceandmul ith more than800organiza , featuringabriefwelcome events,anop includes exhibit hall The Meet of - - - - - is is - - produced mini-comicsandzines. presenting materialfrom theirself- zinesters andself-publisherswillbe and helpreaders ofallages. libraries, improve servicetopatrons, see thelatestmobileappstomanage affiliated groups, and round tables. booths belongingtoALAdivisions, programs forlibrarianshere. casing theirvaluableLISeducational bers andotherschoolswillbeshow Pavilion— library materials. and multiculturalpublications the placetofindvariousmultilingual a successfulone. ensure yourconference experienceis timers andreview informationtohelp offering aplacetomeetotherfirst- remind youthatare notaloneby time atALA?TheConcierge ishere to patronage. able forlibrariesofalltypes,size,and showcasing recorded materialsavail children’s bookstographicnovels. fers thebestfrom allgenres, from Gaming/Graphic NovelPavilion,of n n n n n n n n

Zine Pavilion— Mobile ApplicationsPavilion— Membership Pavilion— Library SchoolandInstruction Center— Visitors International Pavilion DVD/Video Artist Alley— First TimeConcierge— ALISE institutionalmem located inthe Local Chicago —will be First houses - - - - books. Chefswillbethere every fantastic displaysofthelatestcook Cooking DemonstrationStage day from 10a.m.–12:30p.m. from 11a.m.–4p.m.,andonMon stage willrunSaturday andSunday mendations foryourpatrons. The for yourlibrary, andnewrecom tips ondevelopingauthorprograms Stage DON’T MISS Monday, July1,2 tertainment andprizegiveaways. hall toballroom, lookforgreat en keep thepartygoing.From exhibit ning singer-songwriter tion. games andgraphicnovels. trators, andcreators ofthehottest Stage of theexhibits. and presentations overthecourse will feature readings, discussions, ogy, andtravel.ThePopTop Stage mystery, zines,romance, technol tremely popularlibrarianfavorites: Topics, EveryDay autograph theirlatestbooks. on theDemonstrationStageandto day toprepare thehottestrecipes n n n n n Two-time GrammyAward–win

, withreadings from authors, , tohearfrom authors,illus What’s Cooking@ALA LIVE! @yourLibraryReading Wrap Up/RevUpcelebra Graphic Novel/Gaming The PopTop Stage—Popular , focusesonex – 3 p.m. Janis Ian , for - - will ------

43 americanlibrariesmagazine.org | june 2013 44 americanlibrariesmagazine.org | june 2013 ALA on theroleandcontributionof the ident’s Program America (DPLA), for her of theDigitalPublicLibraryof Cohen Maureen Sullivanwelcomes p.m. 3:30–5:30 Sunday, June 30, President’s Program be purchasedinadvanceoronsite. Tickets areavailablefor $50andmay includes food andentertainment. 8:30–10 a.m. Saturday, June 29, you serve: and inputfromthecommunities ed towardbuildingrelationsh H engagement Community coveries intheUS.” to enablenewknowledgeanddis formation andof usingtechnology for theadvancementof sharingin realize thepromiseof theinternet objects, andartifacts.Its goalis“to photographs, historicaldocuments, access tomillionsof books,articles, libraries of alltypes,enablingopen enterprise offers greatpromiseto munities theyserve.Theambitious it offers tolibrarians andthecom howitcametobe, andwhat DPLA, overview of therecentlylaunched Transforming Communities.” Promiseof Libraries tive, “The DPLA toSullivan’s ongoinginitia Octavia Spencer ere ar He willoffer anintroductionand

| , founding executivedirector

e justafew programstarget 2013 . Cohenwillfocus Khaled Hosseini Annual Conference Preview

ALA Pres Dan ips

------Ann Patchett area willhighlightwaystheyare libraries inthegreaterChicagoland A panelof speakers frompublic Building Communitiesfor Latinos Mi CasaessuCasa:Libraries p.m. 4:30–5:30 Saturday, June 29, nity instructionalprogramming. University, speaksonmodelcommu KentState engagement andoutreach, assistant deanfor Kenneth Burhanna, Skills? tion Literacyand21stCentury Are LibrariansBridgingInforma Crossing theK–20Continuum: p.m.1–2:30 Saturday, June 29, new trajectoryinyourcommunity. your librarycanhelpkick-starta Leavy, offers tipsonhowyouand Institute’s CarltonSearsandAaron ledbythe HarwoodThis session, Community Engagement sation: AdvancingLibrary-Led Community EngagementConver p.m.1–2:30 Saturday, June 29, Public ProgramsOffice. Fournier, programdirectorof ALA’s be moderatedbyMary Davis vation andchange.Thepanelwill as facilitatorsof communityinno the Harwood practiceintheirrole periences andtheimpactof using panel of librariansabouttheirex the Harwood Institute, willleada Harwood, presidentandfounder of President SullivanandRichard dential Initiative Update forming Communities:APresi The Promiseof LibrariesTrans

John Lewis

Oliver Stone

------featuring Michael Margolis, CEOof (ASCLA) for itspresident’s program and CooperativeLibraryAgencies Join theAssociationof Specialized 21st CenturyLibraryNarrative Storytelling Mojo: Creatingthe 10:30 a.m.–noon Sunday, June 30, tural lives. healthy eating,andenrichingcul civic discourseandengagement, early andadulteducationalsuccess, in partnershipscreatedtopromote will hearexamplesof libraries’ roles andprogrammingvices, outreach, pants interestedincommunityser addressing Latinoissues.Partici strengthening theircommunitiesby mated themiddleclass.He chartsan economy intorecessionanddeci the riseof digitalnetworksledour on oureconomy. Lanierassertsthat fects network technologieshavehad 2013, Simon&Schuster),andtheef new book, um Speaker Seriesdiscussinghis virtual reality, You AreNot aGadget Jaron Lanier, a.m. 8:30–9:30 Saturday, June 29, Featured speakers libraries aroundthisissue. California andPennsylvania state laborated closelywithboththe nity institutions.Margolis hascol evolving andinnovatingascommu the excitementaboutlibraries tolearnways toshareGet Storied, Ping Fu Who OwnstheFuture? bestsellingauthorof

kicks off theAuditori andthefatherof

Mark Frauenfelder

(May

- - - -

Photos: Octavia Spencer, Randee St. Nicholas; Khaled Hosseini, ©2013 Elena Seibert; Ping Fu, ©Jonathan Fredin Photos: Octavia Spencer, Randee St. Nicholas; Khaled Hosseini, ©2013 Elena Seibert; Ping Fu, ©Jonathan Fredin

Photo: Darkroom Demons the choiceswe make resonate take careof oneanother, andhow six yearsisabouthowwelove and Books). His first novel inmorethan Echoed newest book Khaled Hosseini and Author of bestsellers 10:30–11:30 a.m. Saturday, June 29, do andshareontheweb. people toberewardedfor whatthey point thatheconsidersittimefor and allowittogrow, andmakingthe that willstabilizethemiddleclass ward anewinformation economy own ourfuture,outliningapathto alternative toallowingtechnology SCHOLARSHIP BASH: SECONDCITY library andinformationstudies. scholarships forgraduatestudentsin Bash provides atleast10Spectrum area oftheconventioncenter. be availableonsiteattheregistration online at chased inadvancewhenyouregister sketch comedy. best andbrightestperformhilarious next generationofthecomedyworld’s Gilda Radner, andothers. Stephen Colbert,TinaFey, BillMurray, launched thecareers ofSteveCarell, from thelegendarycompanythat sketches, songs,andimprovisations “Best oftheSecondCity,” anightof Second CityatMcCormickPlacefor improv-based sketchcomedygroup Quest ScholarshipBashwillfeature F 8–10 P.M. SATURDAY, JUNE29, Money raisedattheScholarship Tickets are $25andcanbepur Take aneveningoff toenjoythe great cause.Thisyear’s ALA/Pro un andentertainment—allfora A ThousandSplendidSuns (May 2013, Riverhead alaannual.org And theMountains talksabouthis . Theywillalso Kite Runner

, -

- - Cultural Revolution tobecominga family’s suffering duringChina’s Ping Fu NotBend, Break:ALifeinTwo Worlds, Tech entrepreneurandauthorof Noon–1 p.m. Saturday, June 29, dents, andbookclubs. share insightswithpatrons,stu novelists, soyoucangobackand the mostwidelyreadandbeloved outstanding chancetohearoneof Take most. times thatmatter this tions of thoseclosesttousatthe often we aresurprisedbytheac sacrifice for oneanother;andhow betray,ture, wound, honor, and plores themanywaysfamiliesnur through generations.Hosseini ex tracesherjourneyfrom

- - - -

of theprogramtodiscuss their artist Nate Powell for thesecondhalf thor AndrewAydinandcomic-book umes. Lewiswillbe joinedbycoau how theprojectgrewtothreevol chose thecomic-bookformat, and (Top ShelfProductions), whyhe graphical comic-bookproject John Lewis rights movement, “Big Six”leadersinthe1960scivil endary roleasoneof theso-called Americans withthestoryof hisleg Eager toreachanewgenerationof p.m. 3:30–4:30 Saturday, June 29, lution company. ed Geomagic,a3Ddigitalrealityso top Americaninnovatorwhofound Nicole Hastings,PatReidy, BarryHite, willdiscusshisautobio Angela Dawe,AdamPeacock Congressman

March ------

45 americanlibrariesmagazine.org | june 2013 46 americanlibrariesmagazine.org | june 2013 ALA include: tivities. HighlightsoftheScheduler and organize yourconference ac of allAnnualhastooffer andtoplan U exhibitors; its andmeetingswithspecific and updatingsessionsevents; in userprofiles; library type,andinterests specified tions basedondivision,groups, private; calendars thatcanbeshared orkept in multipleways; YOUR CONFERENCE HOW TOCUSTOMIZE n n n n n

Scheduler se the

| Ease ofaddingboothvis Ease ofadding,prioritizing, Tailored listsofrecommenda Easy-to-create personal The abilitytobrowse sessions

2013 ALA AnnualConference toseethefullscope Annual Conference Preview - - - specific interests. out thedailytopicsgeared to the room atatime.Besure tocheck that more thanonegroup canuse or drop in.There’s enoughspaceso time. Signupforspecifictimeslots to helppushoutcontentinreal and screens, alongwithtechnology chairs, free Wi-Fi,andprojectors in McCormickPlacefeaturingtables, dedicated small-group meetingarea The UNCOMMONS NETWORKING bile app help inorder tolearnmore. Scheduler andotherwaystoget The n Networking Uncommons

A Quick-StartGuidetothe Conference Schedulermo willbereleased inJune.

isa

- thor of sixcookbooks Emmy Award–winningchefandau 10:30–11:30 a.m. Sunday, June 30, range of yourlibrary’s users. share insightsonservingthewide Houghton Mifflin Harcourt),and Across theSpectrum book, Shewilldiscusshernew with autism. influential andwell-knownadults Grandin science, andautismactivist Bestselling author, doctorof animal a.m. 8:30–9:30 Sunday, June 30, scheduled toshipinAugust2013. collaboration. ning novel Book AwardandPulitzerPrize–win Walker Poet, feminist, andactivist Noon–1 p.m. 1,Monday, July students. available tomiddleandhighschool current sorrystateof historybooks librarians aboutwhattheyseeasthe Kuznick arealsoeagertotalkwith traditional historybooks.Stoneand lenges theprevailingorthodoxiesof time documentary seriesthatchal history andcompaniontotheShow look atthedarksideof American searched andrigorouslyanalyzed the UnitedStates, joint project, Kuznick er Academy Award–winningfilmmak 10:30–11:30 a.m. 1,Monday, July love of acertaincityand/orcuisine. each oneinspiredbytheauthor’s Paris!, two booksintheseries, Thefirstcomes tolivewiththem. magical turnwhentheirgreataunt brother andsisterwhoselivestake a guin Young ReadersGroup)abouta pe for Adventurebookseries(Pen Laurentiis Oliver Stone The AutisticBrain:Thinking willbepublishedthisfall, —best knownfor herNational talkabouttheirrecent isoneof theworld’s most The ColorPurple discusseshernewReci The UntoldHistoryof March (BookOne) andhistorian athoroughlyre (April 2013,

Giada De Naples! —discuss Alice Temple Peter is and ------FINDING YOUR WAY AROUND ANNUAL ion andInteractive DemoAreaand Maker Monday attheMaker Pavil- and programminginnovationson other locations.Getthelatestideas libraries, schools,companies,and ing athomeandinmakerspaces at prototypes, andsetupmanufactur- designsearch anddevelopment, and effective waystoconductre- then willpresentnew, inexpensive, ability tocreateamazingthings.He individuals andsmallgroupsthe are drivinginnovationandgiving the latesttoolsandtechnologiesthat founder of BoingBoing,willpresent tor-in-chief of MAKEMagazine and Mark Frauenfelder, founding edi - p.m.1–2:30 1,Monday, July (poems). says) andTheWorld WillFollow Joy Press, TheCushionintheRoad(es- es hertwonewbooksfromTheNew ence andExhibitPinterest page ference FacebookEvent conference. endar, allatyourfingertipsthroughout mendations, andcreate asharablecal- conference time,gettailored recom- updates, planandorganize your Conference MobileApptoreceive W and informed: during conference tostayconnected are sometoolsyoucanusebefore and soned conference-goers alike.Here for bothfirst-timeattendeesandsea- navigating Annualcanbeintimidating n n n n n rack #ala2013onTwitter Check outtheALAAnnual Follow theALAAnnualConfer Join the2013ALAAnnualCon T Visit teresting programs goingon, ith somanydifferent andin- alaannual.org

- - zol, studentadvocateandbestsell- Susan D. Jonathan Ballard. Ko- Librarians (AASL),President American Associationof School 10:30 a.m.–noon Saturday, June 29, andleadershipconsultant. coach, Wasylyshyn, notedauthor, executive Unsteady Times” withKarolM. Ensuring SteadyLeadershipin Hawthorne. “StandingonMarbles: ation (LLAMA),PresidentPat Leadership &Management Associ- dent StevenJ. Bell;Library search Libraries(ACRL), Presi- Association of CollegeandRe- 10:30–11:30 a.m. Saturday, June 29, programs presidents’ Division exhibit hall. at thespecialMaker Showcaseinthe automatically signed uptogeta ence” duringregistration, youwere registrant oftheALAAnnualConfer more aboutALA. Pavilion ontheexhibitfloorto learn the program guide.CheckouttheALA for newattendeesare highlightedin out ofconference. Programs especially drop inon,andwaystogetthemost attend, exhibitorstovisit,parties in whichtheywork. of worktheydoorthetypelibrary ference experiencebasedonthetype conference attendeesplantheircon- These programs are craftedtohelp to attendees,especiallyfirst-timers. the weekendoffer valuableassistance ference 101programs throughout If youselected“Iamafirst-time Get expertadviceonprograms to ALA divisionandround tableCon-

- recognition of PLA’s 2013award President EvaPoole. Following the Public LibraryAssociation(PLA), p.m.1–2:30 Sunday, June 30, Evolving Patron.” in teract withinformation technology, es andbehaviors,howtheyin- some insightsonpatronpreferenc- & AmericanLife shares Project, tor, Pew ResearchCenter’s Internet Pagliero Popp. LeeRainie,direc- ciation (RUSA),PresidentMary Reference andUser ServicesAsso- p.m. 4–5:30 Saturday, June 29, ucation. the rolelibrariesplayinurbaned- phy, andReligion—willtalkabout Book AwardinScience,Philoso- Age—winner of the1968National ing authorof DeathatanEarly ship, andother happenings atALA. questions aboutconference, member ALA staff whocanansweranyofyour Round Table, otherALAmembers,and colleagues from theNewMembers 1231), where youcanconnectwith ship Pavilionintheexhibithall(booth your wayaround. someone togetyoustartedfinding area toseeifslotsare stillavailablefor ee Concierge Deskintheregistration ready, checkatthe First-Time Attend- haven’t signedupforaMentorSlotal- well spentonceyougetthere. Ifyou before theconference soyourtimeis tions toprograms, people,andplaces bassadors canhelpyoumakeconnec- longtime conference-goer. ALAAm- bassador—an ALAmemberwhoisa personal welcomefrom anALAAm- “The Myth andtheReality of“The the Don’t forget theALAMember

- -

47 americanlibrariesmagazine.org | june 2013 48 americanlibrariesmagazine.org | june 2013 ALA adjunct librarian, RutgersUniversity, tral Florida,and communication, UniversityofCen for informationservicesandscholarly the PlacementCenter. the chancetotalkemployersin career counselor, résuméreview, and ance workshops,conversationwitha on theJobLISTwebsite,career guid job seekersincluderésuméposting 10:30 a.m.–noon free skills, thePlacementCenterhostsa to helpjobseekersretool their tion 30, 9a.m.–5p.m. Saturday, June29, JobLIST PlacementCenter and Recruitment(HRDR),the P JOBS, JOBS, JOBS Penny Beile As partofitscontinuingefforts on man Resource Development rovided byALA’s OfficeforHu Open HouseSunday, June30,

| Saturday, June29,8:30a.m

2013 , associatedirector Therese Triumph . Free servicesfor , withan and Annual Conference Preview Sunday, June orienta isopen ALA - , - - - . Saturday, June29,3–4p.m Can DowithYour MLISDegree?” Libraries, facilitates Faget working inalternatecareers. N or editor:Meetandlearnfrom those planner, webcontent manager, writer, June 29,1–2:30p.m. Insider’s Perspective” Hunting forLibraryPositions:An position at specific pointersforthoseseeking a of theselectionprocess andmany sity ofFlorida.Heprovides areview A. SmathersLibrariesattheUniver financial professional fortheGeorge resources, grantsmanagement,and Brian Keith trative servicesandfacultyaffairs, day, June29,10:30a.m.–noon Your InterviewingSkills” “Rev UpYour RésuméandPolish ployers wantincandidatesduring will share hisinsightsintowhatem manager, BrighamYoung University, June 29,9–10:30a.m. about itinajobsearch on and whattheydon’t, andwhattodo exploring whatparticipantscontrol Unemployed,” You NeedtoKnowaboutBeing in Orlando,presents services, UniversityofCentralFlorida and head,regional campuslibrary 9–10:30 a.m. Job Market” to BeCompetitiveintheCurrent Jobs: WhatYou NeedtoKnow “The StateofAcademicLibrary discuss trends inthejobmarketat skills beingsoughtbylibraries,and libraries, discussqualificationsand point outhotjobsinacademic Social mediaspecialist,program As associatedeanforadminis Quinn Galbraith Cynthia Kisby , manager, Careers inFederal “The InsandOutsofJob isthemostseniorhuman on S aninteractivesession , personnellibrarian aturday, June29, “Guess WhatYou , humanresource “Three Things on on Saturday, Saturday, . Satur ancy

. - on - - - that representsthefutureandin tem asanewandrelevantbrand ences onrebuildingalibrarysys Colorado, willsharetheirexperi Library DistrictinAdamsCounty, Anythink Libraries,Rangeview Gail GuidryGriffin. United for Libraries,President p.m.1–2:30 Sunday, June 30, Series. as partof theAuditorium Speaker Tennessee, todeliverPLA’s keynote independent bookstoreinNashville, and ownerof Parnassus Books,an novels andtwobooksof nonfiction Patchett winners, Poole willwelcome mer editor-in-chief of American founder of Wordnik.com andfor Packrat” Myall (ALCTS), PresidentCarolynne tions andTechnical Services Association for LibraryCollec 10:30 a.m.–noon 1,Monday, July 29, 1–2:30p.m. LITA program)on and theCounterfactual and pia World: YA AuthorsDecodeDysto author seriesevents: torow willalsoparticipateintwo maintenance of afreesociety. Doc technology inensuringthehealthy information andfreeinformation of thedebateoverroleof free can anddostandonthefrontlines co-editor, willlookathowlibraries ence fictionwriter, andBoing torow Zoe Stewart-Marshall. CoryDoc ogy Association(LITA), President Library andInformation Technol p.m. 3–4 30, Sunday, June tion andcreatescontent. community connectswithinforma place of bookstoaplacewherethe morphing fromaspires innovation, on Science Fiction: TheFactual . , digital rights activist, sci , digitalrightsactivist, Friday, June 28,8–10p.m. “Confessions of aDigital , bestsellingauthorof six with Erin McKean Saturday, June

Speakers from Bleak New (also a Ann , -

- - - - -

- - -

- - torow, Lois Lowry, Patrick Ness, and for Youth Forum features CoryDoc- Annual, thisyear’s Booklist Continuing a35-yeartradition at p.m. 8–10 Friday, June 28, ests. Highlights include: nities tosatisfyavarietyof inter- above, Annualoffers manyopportu- I sampler Program serving incarceratedteens. andschool drop-outprevention, such topicsasdigitalliteracy, high innovative oruniqueway, including dress teenneedsandinterestsinan Theseprograms ad- Adults Award. lence inLibraryServicetoYoung winners of thelatestroundof Excel- Martin: Martin willshowcasethe sociation (YALSA), PresidentJack Young AdultLibraryServicesAs- p.m. 1–3 1,Monday, July Elementary SchoolinSeattle. Roxhill Bilquez, teacher/librarian, Visual ThinkingStrategies;andPat Oren Slozberg,executivedirector, ArtInstituteeducation, of Chicago; bach, assistantdirectorof museum Chicago PublicLibrary;Mary Er- of childrenandyoungadultservices, cago; ElizabethMcChesney, director seum of ScienceandIndustry inChi- for theAdvancementof Science,Mu- community initiativesattheCenter Wunarinclude Bryan , directorof Speakersnique withchildren. plore thevalueof usingthistech- engaging withpictures,andthenex- rience apowerfulmethodof gram: ThinkwithYour Eyes!Expe- Charlemae RollinsPresident’s Pro- celebrationwiththe long Caldecott lyn S.Brodie.Concludeouryear- Children (ALSC),PresidentCaro- Association for LibraryServiceto p.m. 1–3 1,Monday, July Press. Dictionaries for Oxford University n additiontotheprogramslisted

Books Little Brother(2007). is blogger. His latestyoungadultnovel tion author, and journalist, activist, 2014. adapted intoafilmset for releasein Walking Trilogy, whichhasbeen fi thrillersthatcomprisetheChaos ning authorof thethreeliterarysci- the librarycommunity. nology policyandimplications for share insightsaboutnational tech- will addressconference-goers and and former WhiteHouse official, telecommunications policyexpert Office Update.SusanCrawford, islation duringtheALAWashington Get thelatestonlibrary-relatedleg- 8:30–10 a.m. Saturday, June 29, nature cocktails,willbeserved. Ave.). Refreshments,includingsig- ter (78E.Washington atMichigan St. versary attheChicagoCulturalCen- (IFRT) willcelebrateits40thanni- The Intellectual Freedom RoundTable p.m. 7:30–10 Friday, June 28, publication inOctober2013. conclude withAllegiant,plannedfor began withDivergent(2011)andwill dystopian Divergentseries,which into theGiverQuartet. of dystopianfictionthathasgrown WWII, andTheGiver(1993),aclassic ish resistancemovementduring the Stars(1989),astoryof theDan- two Newbery Medal titles:Number books for youngpeople,including winning authorof morethan30 Youth associateeditor. by AnnKelley, BooklistBooksfor ature. Thepanelwillbemoderated the populargenreof dystopianliter- award-winning authorswilldiscuss Dystopia. Thesebestsellingand New World: YA AuthorsDecode Veronica Rothasthepanelfor Bleak Homeland (2013),thesequelto n n n n eronica Rothisauthorof the atrick Ness istheaward-win

V P Lois Lowryisthemulti-award- Cory Doctorowisasciencefic

- - a behind-the-scenes glimpseinto Logsdon andLucieFaulknor present @ ALAseries,filmmakers Dawn As partof thisyear’s Now Showing 10:30 a.m.–noon Saturday, June 29, Intellectual Freedom Committee. Library andformer chairof theALA of theNashville (Tenn.) Public cies, featuring KentOliver, director and AccompanyingLibraryPoli - Luncheon, Specialized OutreachServices United for Librarieswillhostits Noon–1 p.m. Saturday, June 29, MEETINGS FINANCIAL AND BUSINESS n 3–4:30 p.m. Membership InformationSession, n SATURDAY, JUNE29 n a.m. n FRIDAY, JUNE28 n n TUESDAY, JULY 2 n n MONDAY, JULY 1 n SUNDAY, JUNE30 4:30–5:30 p.m.

Executive Boar Executive Boar Council/Executive Boar BARC, Noon–3:30p.m. Executive Boar Council III,7:45– Council II,8:30–11:30a.m. Council I,8:30–11a.m. ALA MembershipMeeting, Intellectual Freedom d III,1:30–4:30p.m. p.m. d II,1–4:30 d I,8:30–11:30 9:15 a.m.

49 americanlibrariesmagazine.org | june 2013 50 americanlibrariesmagazine.org | june 2013 ALA Awards ceremony. Themedalsrec Excellence inFictionandNonfiction D 8–10 P.M. SUNDAY, JUNE30, tal PhotographsofEdward Curtis Catcher: TheEpicLifeandImmor of RandomHouse. Lepore: Alfred A.Knopf,adivision A HistoryofLifeandDeath row, lefttoright): cellence inNonfiction(pictured top the United States. ognize adultbookspublishedinthe SHORTLIST CARNEGIE MEDALS n n Here are the2013finalistsfor Andrew CarnegieMedalforEx

Andrew CarnegieMedalsfor on’t missthesecondannual | Short NightsoftheShadow The MansionofHappiness:

2013 Annual Conference Preview

, byJill - , - - member ofPenguinGroup (USA). by JunotDíaz:RiverheadBooks,a Publishers. HarperCollins Erdrich: Harper, animprintof Publishers. Ecco, animprintofHarperCollins row, lefttoright): lence inFiction(pictured bottom Andrew CarnegieMedalforExcel Company. David Quammen:W. W. Norton& and theNextHumanPandemic Harcourt. by TimothyEgan:HoughtonMifflin n n n The 2013finalistsforthe n

This IsHowYou LoseHer The RoundHouse Canada Spillover: AnimalInfections , byRichard Ford: , by Louise , by , - Awards Breakfast the the African-American experienceat young adultliteraturerepresenting celebrate thebestinchildren’s and will King BookAwardsCommittee Scott (EMIERT) andtheCoretta mation ExchangeRoundTable The EthnicandMulticultural Infor 7–9:30 a.m. Sunday, June30, leaders follows. sion withfilmmakers andlibrary free publiclibrary. Apaneldiscus history, andchallengesof spirit, the Public Library, in-progress the makingof theirdocumentary- onsite. able for purchaseinadvanceor elist Paul Tickets Rudnick. areavail screenwriter,playwright, andnov cago professor SaraLevine;and cole Knepper;ArtInstitute of Chi clinical professional counselorNi comedian SelenaCoppock;licensed night ShowwithJay Leno; joined byRossMathews of Meant toSay There’s Nothing inThisBookThatI ing Paula Poundstone, authorof on Us, sponsoredbySAGE United for Libraries’ Enjoy aline-upof comediansat p.m. 5:30–7:30 Sunday, June30, and SheilaUrwiler. Justinbak, Hoenke, Nora Quinlan, EmilySanford, JasonGarcia, Cha Catherine Soehner, CoryEckert, Ed Speakers includeBenjaminAndrus, job,andcareer success.position, professional toolkits thathaveledto sider theessentialitemsintheir from avarietyof environmentscon Toolkit. for Join theNew Members Round Table a.m. 8:30–10 Sunday, June 30, Blue AtlanticBallroom. Building Your Professional Coretta Scott KingBook Scott Coretta z Learnaboutwhatlibrarians . Poundstone willbe Free forAll:Insidethe whichexploresthe at theRadisson

The Laugh’s standup The To , featur ------A Degree is Great. A Career Path is Even Better. Consider how a Master of Library and Information Science from Rutgers, an iSchool, adds a crucial dimension to help you compete effectively in today’s job market. Forget the Idea of Just Books. Think knowledge management, competitive intelligence, big data, social media — all critical to many careers today. Rutgers’ MLIS program blends theory seamlessly with the technologies of today’s world. Ranked 6th nationally by U.S. News and World Report, the MLIS graduate degree offers you: • Flexibility: Take courses on campus, online or a combination of both. • Excellence in Research: Leading scholars in the LIS field use original research to address cutting-edge topics. • Guided Assistance: Knowledgeable advisers will walk you through the application process. Stop by Booth #560 at ALA National to meet MLIS faculty and advisers.

Lilia Pavlovsky Rutgers Assistant Professor 2012 Library Journal Teaching Award Winner

Explore our programs: mlis.rutgers.edu Rutgers, the State University of New Jersey

00411 SCI American Libraries Full Pg Ad.indd 1 5/7/2013 4:19:57 PM ALA | Annual Conference Dining Guide Tastes Chicago

Hot Doug’s is a hometown favorite.

American Libraries staff members offer a sample of our choice picks e Chicagoans love our Within 5 miles of the tomato, pickle, celery salt, and sport food. In a town best Convention Center peppers. But save room for the W known for its deep-dish house specialty, a slightly spicy Ital- pizza, hot dogs, and Italian beef ian beef sandwich, served au jus sandwiches, we also take pride in with sweet peppers or homemade our city’s more recent culinary giardiniera in an Italian roll. Fresh- accomplishments, which have cut fries (with the skins) are extra— helped transform Chicago into a and worth it. There are other dining destination for foodies locations in the Loop and River worldwide. And while there’s no North, but we like the original spot dearth of restaurant guides to help in Little Italy, across from Mario’s you maneuver your way around the Italian lemonade stand. Magnifico! city’s best eats, staff members at —LB june 2013

| American Libraries have compiled L, D (M–Sat) $

a sampling of some of our favorite AL’S BEEF spots. We hope you have a chance 312-226-4017 alsbeef.com AVEC to try a few of them (as well as 1079 W. Taylor St. (Little Italy/Univer- 312-377-2002 avecrestaurant.com other equally fine establishments sity Village, and other locations) 615 W. Randolph St. (West Loop) not listed here). At the end of the Chicago has three specialties: hot Much more casual than its upscale section is a public transporta- dogs, pizza, and Italian beef. You can sibling next door, Blackbird, but tion guide to help you find—and get a tasty Chicago-style hot dog equally good, with small-plate dish-

sate—all your food cravings. Enjoy! here, with mustard, relish, onions, es and an outstanding wine selec- Girl & the Goat photo: Anthony Tahlier americanlibrariesmagazine.org

52 Girl & the Goat photo: Anthony Tahlier 3947 S.KingDr. chicagoschickenandwaffles.com 773-536-3300 AND WAFFLES CHICAGO’S HOMEOFCHICKEN L (W–Sun),Ddaily boy sandwich. cialties includeatastycatfishpo’ and nocovercharge.Southernspe there’s alwaysaliveperformance blues, visitanylunchhour, when Ifarea. youjustwanttohearsome memorabilia intheupstairsdining for thatshow. Buttherearelotsof togetaseatto bethereby7:30p.m. Youthe clubaround9p.m. willneed If Buddy’s heshows upat intown, 700 S.Wabash Ave. 312-427-1190 BUDDY GUY’SLEGENDS B, L(M–F),Brunch(Sat,Sun) fresh andseasonal. Ingredientscroissant sandwich. are including itsbreakfastburritoand offers someoriginal fanfavorites, thispopularspotstillborhood, in 1993theWicker Park neigh Established orlunch. brunch, fast, Stop bytheBongoRoomfor break and otherlocations) 1152 S.Wabash Ave. 312-291-0100 THE BONGOROOM D daily while youwaitfor atable. Friendly staffers willbringdrinks piquillo peppersauceareafavorite. bacon-wrapped medjooldatesin Thechorizo-stuffed,tion. $$$$: $$$: $$: $: drinks, tax,ortip. for entréewithoutappetizer, Average priceperperson $$$ under$10 $11–$20 GUIDE $21–$30 PRICE $31andup —LB buddyguy.com thebongoroom.com

(Bronzeville) $$ —KB (South Loop) (South Loop, —MP

$$ - - - sujuk sausagefor moreadventurous and choicessuchascurryorspicy wraps (chickpeafor traditionalists, ria-style servicethatdeliversfalafel falafel more accessiblewithcafete Chef-owner Maher Chebaromakes locations) 72 E.AdamsSt. 312-360-9400 FALAFILL L, Ddaily orfriesforpotato salad, $11. fillets andyourchoice of waffle, Try theDarnell:twofriedcatfish get chicken andwafflesinthecity. classic, thisisdefinitelytheplaceto Parttion. localfavoriteand partcult this spotstandsabovethecompeti one cansamplesoulfood inChicago, Withthe wait. somanyplaceswhere lines toprovethatthefood isworth This SouthSidefavoritehasthelong Oysters atGirl&theGoat $$ eatfalafill.com (Loop, andother —MP - - Stephanie Izard’s name,butfew who Chef Fansslowing down. of Bravo’s this restaurantshowsnosigns of spotsintown, One of thehottest 809 W. RandolphSt. 312-492-6262 GIRL &THEGOAT Brunch (Sat),L(Tue–F), D(Tue–Sat) ings of up to10guests. Room—perfect for intimategather rience, checkoutFrontera’s margaritas. For akitchentableexpe it downwithoneof thesignature beans, andsweetplantains,wash with carne asada, to anymeal.Try the frontier grillbringsfunand bold food togowithit—thiscasual With itsboldcolorsanddesign—and 445 N.ClarkSt. rickbayless.com/restaurants/grill.html 312-661-1434 FRONTERA GRILL L, D(M–F) minted cabbage. babaghanouj, andmus, tabbouleh, ing Mediterranean farelike hum (appetizers) features crowd-pleas barrice andlentilsoup.Themezza from friestotraditionalLebanese diners) andsidedishesranging may alreadyknowchef-owner $$ girlandthegoat.com (River North) —BG guacamole, black Oaxacan-style (West Loop) —MP Library vibrancy Top Top - $$$ - - -

53 americanlibrariesmagazine.org | june 2013 ALA | Annual Conference Dining Guide

There are a string of Greek restaurants on Halsted, but this is one of my favorites. Very fresh and tasty gyros, Greek salad made with the restaurant’s own feta cheese, lots of seafood selections. Offers free valet parking, as do most Greektown restaurants, a real perk so close to the Loop. —LB DINE L, D daily $$ AROUND CHICAGO HACKNEY’S hether you’re a first-timer or a seasoned conference-goer, 312-461-1116 Wnavigating around an unfamiliar city in search of great grub hackneysprintersrow.net can be a hassle. That’s why ALA created Dine Around Chicago, an 733 S. Dearborn St. (Printer’s Row) opportunity for you to enjoy a meal at one of Chicago’s top restau - Pub grub nestled in the heart of Print- rants with colleagues from across the nation. We secure the seats er’s Row in the South Loop. Stop in for (up to 10 slots per restaurant for Friday, June 28); all you have to do is sign up—for a single seat or as a group—before these slots a Famous Hackneyburger, a Hackney’s are gone. tradition since 1939, Hackney’s origi- Dining options include: nal french fried onions (a pyramid of n Berghoff Restaurant intertwining fried onions), and a (theberghoff.com) has been a Chicago mainstay, serving German-American cuisine since 1898. One of the Guinness before or after perusing the nation’s oldest family-run institutions, Berghoff Catering and Res new, used, and rare-book stores in - taurant Group is known not only for its famous Berghoff beer and the neighborhood. —PM root beer but also for its catering and desserts. Try the beer and L, D daily $$ Wiener schnitzel. n Brasserie by LM (brasseriebylm.com ) offers casual, sophisti- HAROLD’S CHICKEN SHACK cated cuisine by combining time-honored techniques with a modern 312-362-0442 haroldschicken55.com flair to create a dining experience that will leave a lasting impres - sion. Try the signature beef bourguignon and a glass of Côtes du 636 S. Wabash Ave. Rhone. (South Loop, and other locations) n Scoozi (leye.com/restaurants/directory/scoozi Chicken (and even fish) any way you ) provides comfortable Italian ambience with made-from-scratch cuisine. All pasta want it. Harold’s doesn’t try to be dishes are either imported from Italy or made in house. Enjoy the something it’s not. What you’ll get award-winning wine list along with mouth-watering bruschetta and here is delicious fried chicken and brick-oven pizzas. sauce, with sides like coleslaw, fries, As an added treat, all participating restaurants will offer a special and hush puppies. Try one of the half- perk to those signed up through Dine Around. Find more informa - chicken dinners, which comes with tion, check for new restaurants added to the list, and sign up at three sides, all for around $8. It may bit.ly/dinearoundchicago —before all seats are filled. not be the most heart-healthy option in town, but the staff is friendly and the food hits the spot. —MP L, D daily $

THE HOP HÄUS dine here will forget the creative ins beginning at 4:30 p.m. every 312-280-8832 thehophaus.com june 2013

| menu: confit goat belly, sticky date night. Or visit the sister restaurant, 646 N. Franklin St. (River North)

cake, etc. The menu changes fre- Little Goat Diner (820 W. Randolph), Gourmet filet mignon sliders with quently, and the restaurant works for all-day breakfast, burgers, and blue cheese and shoestring onions with a number of area farms to sup- more. —KB on a pretzel bun pair well with local port the local movement. The catch: D daily $$$$ brewskis from West Coast, Domaine Getting reservations may be impos- DuPage, and Goose Island. Want sible unless booked months in ad- GREEK ISLANDS something more exotic? Try the os- vance. But don’t despair; the 312-782-9855 greekislands.net trich, wild boar, or bison sliders, all restaurant offers a waitlist for walk- 200 S. Halsted St. (West Loop) served with confetti slaw, julienne americanlibrariesmagazine.org

54 and variationson favorites(fivedif concoct its own handcrafted cocktails ing organicandartisanalliquors to the mixologydepartmentaswell, us ing therealthing.Karyn’s shinesin carnivores intothinkingthey’re eat dishes canfool themostdie-hard and crabsliders,shepherd’s pie Loop. Thefauxchicken legs,chorizo twist intheheartof swankyWest rary Americancuisinewithavegan Karyn’s onGreenservescontempo 130 S.Green St. 312-226-6155 KARYN’S ONGREEN L, Ddaily ride fromMcCormick Place. Justare yourbestbet. ashortcab pot dishesandgiantnoodlesoups money. Thebaked riceinbamboo pensive, andagoodvaluefor your butitispopular,Chinatown, inex It maynotbethefinestrestaurantin (Chinatown, andotherlocations) 2139 S.ChinaPl. 312-328-0001 JOY YEE’SNOODLES 24 hoursdaily than $5. Well-lit, easytofind. peppers, plusabagof friesfor less grilledonions, andsport low mustard, and all-beefhotdogscomewithyel 1939. Thefamousbeef/pork Polish up Polish sausagesandhotdogssince gentrification, Jim’s hasbeenserving Maxwell Streetmarket closeddueto nue afterthenearbylong-running Express ing 24hoursadayfromtheDanRyan You’ll seetheJim’s Originalsignglow 1250 S.UnionAve. 312-733-7820 JIM’S ORIGINAL L, Ddaily beers. imports andarangeof localbottled craft beersareavailable,aswell Severaldraftsandout themenu. andwrapsround pizza, Salads, fish, pickles, andfriesormac’n’ cheese. —LB way. RelocatedtoUnion Ave $ $$ $ joyyee.com jimsoriginal.com karynsongreen.com (West Loop)

(University Village) —LB —LB ------Milk Dudswhileyouwaitinline. fornut holesand, theladies,boxesof ries: Lou’s offers samples of dough draw linesfor Butnowor breakfast. staff, and“theworld’s bestcoffee” Generous portions,friendlywait breakfasts arestillbeingservedhere. buthislegendary Lou haspassedon, 565 W. JacksonBlvd. loumitchellsrestaurant.com 312-939-3111 LOU MITCHELL’S L, Ddaily toes, andthreecheeses. mushrooms,Romatoma spinach, glorious cheese.Ilike the“Lou,” with bounty of sauceandcheese, pizza the deepdishcreatesafortress for a Thefirmhigh-sidedcrust of pizza. butyouhave totrythe are allgood, petizers andpastadishes,they Yes,pizza. youcangetsaladsandap This isgenuineChicagodeep-dish North, andotherlocations) 439 N.Wells St. 312-828-9800 LOU MALNATI’S PIZZERIA D (Tue–Sat) course prixfixemenu. You’ll choosefromafour- orfive- and occasionallyexpensivewinelist. you throughthedeep,international, mel. Expertwaitstaffnimblyguide pecancrème cara roasted venison, American notes:Alaskanhalibut, ably French, soundsfamiliar sphere. Thecuisine,thoughundeni almostneighborlyatmo the quiet, zinc bar. Aglassof bubblyintroduces Butthefirststopispetit down. ings, dinersmaysitupstairsor that’s tucked betweenlargerbuild Inside aclassicChicagobrownstone welcome visitorstoasliceof Europe. A gardengateanddiscreetdoorway 222 E.OntarioSt. 312-649-9010 LES NOMADES Brunch (Sat,Sun),L,D(Tue–Sun) areoffered).ferent manhattans $$ $$$$ lesnomades.net loumalnatis.com (Streeterville/River (Streeterville) (West Loop) —LB —LB —PM - $$ ------thick Greektoastontheside,ismy with cheese andpotatoesinaskillet, Spinach specialomeletwithfeta or get your watch battery replacedon or getyourwatch battery er’s mall, socheckoutthe eat ataMiddle Eastern café inajewel You mayneverget anotherchanceto 21 N.Wabash Ave. 312-443-9534 OASIS CAFÉ B, L,D(M–Sat) Free parking. museum at558W. DeKovenStreet. Robert J. QuinnFire Academyand 1871, andnowthelocationof the the GreatChicagoFire startedin serts, too.Just oneblockfromwhere share. Deliciouspiesandotherdes sotake afriendand in onesitting, their $12pricetag.You cannoteatit sandwiches areenormous,meriting latkes? Theygot’em. Cornedbeef Gotahankeringtown. for brisket or Obama comesherewhenhe’s in go pols,thisisyourplace.President If youwanttorubelbows withChica (Little Italy/ 1141 S.Jefferson St. 312-939-2855 DELICATESSEN MANNY’S CAFETERIAAND B, Ldaily (formerly theSearsTower). Walking distancetotheWillis Tower favorite, butanyeggdishisdivine. $ University Village) —LB $$ oasiscafeone.com mannysdeli.com (Loop)

diamonds diamonds —LB - - -

55 americanlibrariesmagazine.org | june 2013 ALA | Annual Conference Dining Guide

pizza began making history. In 1943, Ike Sewell created the original reci- pe for extra-cheesy pizza with a crust as thick as a fruit pie. It caused such a sensation that Sewell opened Due kitty-corner from Uno to handle the dine-in demand. (There’s often still a wait for a table.) Choose Uno if you’ve got a taste for craft beer, which was recently added to the menu. If you have room after in- dulging, try the deep-dish sundae: vanilla ice cream, chocolate sauce, and whipped cream heaped atop a giant chocolate chip cookie freshly baked in a deep-dish pan. —BG L, D daily $$

POMPEI ON TAYLOR 312-421-5179 pompeiusa.com/taylor 1531 W. Taylor St. (Little Italy/University Village) Pompei prides itself on serving three generations of family recipes Slurping Turtle offers casual dining. that include hand-rolled pizzas and hand-cut pastas. This local gem has been on Taylor Street since 1909. your way to the café in back. There are score seating in the main dining Order the signature pizza strudels— daily specials, and the food is authen- room on the second floor, which like the poor boy (ham, salami, tic and inexpensive. Best bet: falafel overlooks the city’s skyline. Because capicola) or the Pompei Italiano sandwich and savory lentil soup. —LB the closest Red line El stop to this (mini-meatballs)—by the slice or to L, D till 6:30 (M–Sat) $ Chinatown institution will be closed share with a group. —MP this summer, consider taking a cab L, D daily $ PHOENIX or hopping on a water taxi (see page 312-328-0848 60 for info on water taxis). —SS PROTEIN BAR june 2013

| chinatownphoenix.com B, L, D daily $$ 312-346-7300 theproteinbar.com

2131 S. Archer Ave. (Chinatown) 235 S. Franklin St. Come early to this popular dim sum PIZZERIA UNO / PIZZERIA DUE (Loop, and other locations) destination, as wait times can be 312-321-1000 / 312-943-2400 This is the spot for those who love lengthy, especially on weekends. unos.com healthy, filling, and lower-calorie The steamed barbecue pork buns 29 E. Ohio St. (River North) food that’s tasty too. Protein gets are a crowd-pleaser, and the signa- 619 N. Wabash Ave. (River North) packed into every dish, from drinks to ture two-course Peking duck is Now an international franchise, Uno “bar-ritos” with yummy quinoa in- carved and wrapped tableside. Try to is where Chicago-style deep-dish stead of rice and whole wheat tortillas. americanlibrariesmagazine.org

56 SHOW-coh Xoco (pronounced (River North) 449 N.ClarkSt. taurants/xoco.html 312-334-3688 XOCO L (Tue–Fri), D(Tue–Sat) classic dish. and innovativeinterpretationsona ceviche triofor amixof traditional menu thatchangesmonthly. Try the rants. Topolo—as localscallit—hasa Rick Bayless’s otherChicagorestau classysistertocelebritychef sleek, polobampo isviewedasthequiet, that helovesthesopaazteca),To Obama’s localfavorites(storygoes Reportedly oneof President 445 N.ClarkSt. restaurants/topolobampo.html 312-661-1434 TOPOLOBAMPO L, Ddaily tapas item. duck-fat friedchicken for ahot (herbed porkmeatballs)orthe men ramenoff thedinnermenu nuke indormrooms.Try thetan don’t meanthekindcollegekids People comefor theramen—andwe 116 W. Hubbard St. 312-464-0466 SLURPING TURTLE L, D(M–Sat) even dessertsareonoffer. Smoothies, salads,sandwiches,and “noodles” issavoryandfilling. madefromslicedzucchini ghetti dishes, thisisyourplace.Thespa If youeverwantedtotryrawvegan (West Loop) Transportation CenterFrench Market 131 N.ClintonSt.,intheOgilvy 312-831-2729 RAW B, L,D(M–Th),closesat5p.m.(F) mous andunder450calories. The breakfastbar-ritosareginor $$ ) isRick —MP $ —MP slurpingturtle.com chicagorawfood.com rickbayless.com/res rickbayless.com/ (River North)

(River North) $$$$ —LB —LB -

- - at BigStar The tacodepanza $ - - availability onits sometimes postlast-minuteseating among us,therestaurantdoes procrastinators andspontaneous forins areaccepted—though, the range from$210to$265. No walk- diners mustbuytickets, whichcan making reservations,interested a halfhourstocomplete.Instead of course menuthatrequiresfour and innovative ways,creatinga20-plus- constructed andrecombinedin ner, Nick Kokonas. Dishesarede Grant Achatzandhisbusinesspart the brainchildof celebritychef beyond-fine-dining experienceis serious foodie shouldmiss,” this scribed byFrommer’s as“a placeno starred Michelin De restaurant. Alinea isChicago’s onlythree- 1723 N.HalstedSt. 312-867-0110 ALINEA Center Convention 5–10 the from miles B, L,D(Tue perienced atlunchtime. and Frontera Grill),Xocoisbestex rants (seereviewsof Topolo more well-knownsiblingrestau Located aroundthecornerfromits the dippingchocolateandchurros. sweet fixtotampdowntheheat? Try roasted chicken pozole.Need a more substantial,orderthewood- faint of Orfor heart.) something The habanerosalsaisnotfor the cubana orthecochinitapibil.(Note: food. Try oneof thetortas,like the Bayless’s take onMexican street –Sat) alinearestaurant.com $$

(Lincoln Park) —SS bampo

- - - - - rimmed glass).Thedownside: salt- servedinachilled, made salsa, beer mixedwithlimeandhouse- or theirMichelada—a canof Tecate are quenching(tryacocktail,beer, braised porkbelly)andthedrinks madewith(try thetacodepanza, and sizablepatio.Thefood isfresh around itslarge,square-shapedbar casual atmosphere,BigStarcenters Without. aprimelocationandhip, fun summertime Wicker Park hang The (big)starshavealignedatthis 1531 N.DamenAve. 773-235-4039 BIG STAR D (W–Sun) Facebook pageandTwitter feed. admire in thebeautifulglassatrium and Sitatthebaror specials withadrink. poblano burgeroroneof thedaily beers andwine.Try theturkey and selectionof craft has anextensive the name—thisurban-rusticbistro Library’s 27thWard branch—hence that oncehousedChicagoPublic Located inanearly-1900sbuilding (West Town/Noble Square) 1371 W. ChicagoAve. 312-850-2700 BRANCH 27 L, Ddaily only. Cash and eatingatthenearbypark. sider optingfor thecarryoutwindow packed crowds.Thesolution:Con —SS $ $$$$ bigstarchicago.com branch27.com (Wicker Park) (Wicker

—SS - -

57 americanlibrariesmagazine.org | june 2013 ALA | Annual Conference Dining Guide

the indoor garden and the books that ephemera hanging on the walls. A cludes six current beers and a sou- decorate the exposed-brick walls. glance at the drink menu reveals venir pint glass. Tours fill up fast, so Branch 27 will be offering a 20% that this is no ordinary public RSVP at least one week in advance. discount on food for librarians (with house. Duke of Perth is known for The brewpub also offers a seasonal a current badge or ID card) plus one its large selection of Scotch whiskey. food menu, which includes a deca- guest during the conference. —MP There are more than 75 malts to dent Stilton burger. —MP Brunch (Sat, Sun), D daily $$ sample, from the Suntory Yamazaki L, D daily $$ from Japan ($7 a glass) to a 25-year- THE CHICAGO DINER aged Caol Ila ($35 a glass). —PM GREEN ZEBRA 773-935-6696 veggiediner.com L, D daily $ (food) $–$$$ (drinks) 312-243-7100 greenzebrachicago.com 3411 N. Halsted Ave. 1460 W. Chicago Ave. (Lakeview, and other locations) FRANKS ‘N’ DAWGS (Ukrainian Village) Traditional American diner fare gets a 312-281-5187 franksndawgs.com Green Zebra presents upscale vege- vegan makeover at this Lakeview (and 1863 N. Clybourn Ave. (Lincoln Park) tarian dining with a focus on locally now Logan Square) hot spot. Their Chicago is a hot dog city, but those grown fruits and vegetables. The Radical Reuben is a favorite. Corned found at this eatery are a far cry dishes are clean, simple, and deli- beef is swapped out for marinated from the traditional Chicago dog. cious. The menu changes seasonally; seitan to mimic the taste and texture Franks ’n’ Dawgs takes hot dog cui- entrées have ranged from foraged of the sandwich’s signature ingredi- sine to new levels with its hand- maitake mushrooms with homemade ent. You won’t miss the meat. —PM crafted artisan sausages topped kimchi and rutabaga dumplings to a L, D daily $$ with atypical extras. The Krazy country flatbread topped with med- Kimchi, a spicy beef sausage jool dates and squash purée, and DUKE OF PERTH topped with a braised short rib, sweet potato crepes. Reservations 773-477-1741 dukeofperth.com turnips, kimchi, wild rice, and ba- recommended. —PM 2913 N. Clark St. (Lincoln Park) sil; and the Tur-Doggin, a turkey- D daily $$ Duke of Perth looks like a typical and-date sausage topped with faux British pub with its menu of crispy duck confit, herb garlic aio- HANDLEBAR fish and chips, shepherd’s pie, li, pickled onion relish, and pick- 773-384-9546 and bangers and mash; large led carrots, are sublime. Don’t handlebarchicago.com dark wood bar; modest fire- forget the Lyonnaise fries, hand- 2311 W. North Ave. (Wicker Park) place; large deer head, an- cut French fries dolled up with Healthy fare and fine beers are the tique photos, and braised pig cheek, arugula, a specialty of this hip hangout for bi- poached egg, and a Dijon mustard cycle enthusiasts. The vegetarian- vinaigrette. —PM friendly menu is packed with L, D (Tue–Sun) $ interesting flavors. The vegan breakfast burrito with seitan cho- GOOSE ISLAND BREWING rizo; the Green Meanie, an avocado, COMPANY herbed goat cheese, spinach, toma- 312-915-0071 to, sprouts, and honey-mustard gooseisland.com sandwich served on multigrain 1800 N. Clybourn Ave. bread; and the BBQ seitan sandwich (Lincoln Park) are great for brunch and lunch. You’ll find this local Handlebar’s large back patio is per- brew in most bars and fect for summer days. —PM june 2013

| taverns around the city. B, L, D daily $$

But the original brewing company is an experi- HOT DOUG’S ence in itself and serves 773-279-9550 hotdougs.com as the perfect spot to 3324 N. California Ave. (Avondale) sample award-winning In a city known for encased meats, beers. Try a 60-to- Hot Doug’s variety of pop-culture- 90-minute brewery tour and inspired versions—like The Elvis The Roaring Buffalo tasting on the weekend; it in- (Polish sausage)—do not disappoint. at Franks ‘n’ Dawgs americanlibrariesmagazine.org

58 L, Ddaily menu of Mexican favorites. locations, at1132,offers anexpanded juice andflavor. The larger of thetwo thegrilledmeatsexplodewith tion, cilantro. Thoughsimpleinprepara burritos servedwith chile relleno,andtongue chicken, chorizo,barbacoa, steak, weekend. Thefood is after-hours Mexican fareevery are packed withpeopleawaiting andboth land/Division intersection, uated onthebusyMilwaukee/Ash Twolate-night set. A UkrainianVillage staplefor the (Ukrainian Village) 1132 and1140N.AshlandAve. pasadita.com 773-384-6537 and773-278-2130 LA PASADITA L, Ddaily — worth thewait. selection of craftbeersontapare soaked pears—andtheexcellent brie,andbourbon- ions, pancetta, meat toppedwithcaramelizedon the Minotaur burger—10ouncesof reach threehours,buttheLairof packed. Thewaittimefor atablecan ambiance. It’s alsoconsistently the originallocation’s menuand Northwest Side,Kuma’s Too shares acclaimed burgerbaronthecity’s An offshoot of Kuma’s Corner, an decibels, Kuma’s Too isyourplace. heavy metalmusicblaresatintense waitstaffwhile served byatattooed If youwantgourmethamburgers 666 W. DiverseyPkwy. 773-472-2666 KUMA’S TOO L (M–Sat) difficulty.little though mostpeoplegetseatedwith pared for longlinesandwaittimes, cionados farandwide.Sobepre holds cultstatusamonghotdogafi Doug’s eatfreefor life) tattoos and on personality(customerswithHot This cash-onlyemporium isheavy $ $$ $ —MP kumastoo.com PM locations aresit onions and basic: no-frills (Lakeview) tacos; and —PM ------several blocksaway, asdoesthe“I the University of Chicago campus Eclecticstatuaryevokesthroughout. their artworkhangsondisplay “Obama eatshere” T-shirts, and milkshake, orBYOB. Serverssport asoul-pleasingloose-leaf tea, it alldownwithfair-tradecoffee, the beeforgrilledveggiechili.Wash to order. Try theMoroccan ragoutor monsterpiece delisandwichesmade mon rolls,breads),salads,and baked delights (croissants,cinna (goatcheeseoptional),freshlypizza great Angusburgers,thinorpan that boastscomfort food withpizazz: A relaxedcoffeehouse atmosphere 1327 E.57thSt. 773-667-7394 MEDICI B, L,D(closedW) salad for under$10. enchiladas withrice,beans,and of threeorder agenerousplatter guacamole, orgetadventurousand the steakquesadillasanddelicious accompanyyourmeal. Trygreen, yourchoiceofspicy salsa, redor enchiladas andsoups(caldas).Hot, food, fromhuarachesandtacosto Inexpensive, authenticMexican 2881 W. Rd. Cermak 773-847-6998 nowebsite AND RESTAURANT LOS CORRALESTAQUERIA 27th Ward branch. stood asChicagoPublicLibrary’s Now abistro, Branch27once medici57.com (HydePark) $ —LB (Little Village)

- and walls.Goahead:Add“ala13” to was here” initialsadorning tables the décor. averse shouldlook elsewhere.) lively atmosphere.(Thenoise- of agreatpie,excellentbrew, anda created ameccafor thoseinsearch Nielsen (of CheapTrick fame) have Co-owners BillJacobs andRick beers thattheybrewthemselves. rotating selectionof Piece-brewed Haven–style anda thin-crustpizza Piece servesuphand-tossedNew Located insidearemodeledgarage, popular spotdoesbothreallywell. andbeeraretimelessthisPizza 1927 W. NorthAve. 773-772-4422 PIECE BREWERY ANDPIZZERIA L, Ddaily groups. won’t Great for hurtyourwallet. thisestablishmentneighborhood, location inthetrendyLincolnPark Anddespite itswiches todessert. thing Italian, frompastatosand Pequod’s offers bit of every alittle melized cheesearoundthecrust. witharingof cara deep-dish pizza, A uniquetake onChicago-style Ave.2207 N.Clybourn 773-327-1512 PEQUOD’S PIZZA B (M–F),Brunch(Sat,Sun),L,Ddaily —MP $$ —BG piecechicago.com pequodspizza.com (Wicker Park) (Wicker (Lincoln Park) - $$ - -

59 americanlibrariesmagazine.org | june 2013 ALA | Annual Conference Dining Guide

GETTING AROUND TRAVEL TIPS

THE BASICS Choose from white, red, or “plain” The Chicago Transit Authority (tomato sauce, no mozzarella) pizza. (CTA) now charges $5 for pay- Toppings range from the standard per-ride customers traveling (pepperoni, mushrooms, etc.) to the to or from O’Hare Internation- unique (white clams and mashed al Airport. Exempt are those potatoes). —SS who purchase a 1-day, 3-day, L, D daily $$ 7-day, or 30-day pass. A cab ride from O’Hare to downtown, by REVOLUTION BREWING comparison, can cost more than $50. 773-227-2739 revbrew.com For unlimited rides on all CTA buses and 2323 N. Milwaukee Ave. trains, consider purchasing a 1-day ($10), 3-day ($20), or 7-day ($28) pass. (Logan Square) Even though this establishment is a WATER TAXI TO CHINATOWN considerable hike away from McCor- Take a water taxi (chicagowatertaxi.com) from Michigan Ave. and the Chi- mick Place (approximately eight cago River to Chinatown for just $5. Cheaper than a cab and a great archi- miles), Revolution Brewing can sat- tectural view the whole route! Ends at Ping Tom Memorial Park. isfy your craving for a tasty craft beer and has good food to go along with it. TRANSIT APPS In 2012, The Reader, one of Chicago’s To make getting around the city a bit easier, the CTA’s App Center pro- alternative weeklies, voted Revolution vides a list of many transit applications available for computers, smart- Brewing as the city’s best pub grub phones, and other devices. Here are a few free ones we’ve used and find and best brewpub. Try the must-have reliable. bacon-fat popcorn for only $5. —KB n Transit Stop: CTA Tracker (iPhone) B, L, D daily $$ Offers current tracking information for all CTA train lines and most bus routes. URBAN VEGAN n Chicago Transit (Android) 773-472-8208 Tracks CTA train and bus times, as well as alerts. urbanveganchicago.com n Chicago Nearest Transit (iPhone) 1550 W. Fullerton Ave. Use your smartphone’s camera to direct you to the closest transit. (Lincoln Park, and other locations) Downside: There's no compass, which might present a challenge for Traditional Thai cuisine prepared some visitors. Also, this app is limited to train lines. with vegans and vegetarians in n Ride Chicago (Android) mind. Pad thai, radd narh, pad see- Provides real-time CTA and Pace (suburban) bus information. ew, orange chicken, seafood tom n Hailo (iPhone and Android) yum, all varieties of curry, and more Hail a cab via your phone’s GPS tracking system. Simply tap “Pick are available with marinated soy, Me Up Here” and wait. It even gives you an estimated arrival time. tofu, and seitan substitutes in the june 2013

| Program your credit/debit card information into the app for auto- place of chicken, beef, pork, and

matic payment; a receipt is emailed to you instantly. fish. Lunch and dinner combos that include brown rice, spring rolls, BUS TRACKING VIA TEXT and salad are a best bet. —PM If you don’t own a smartphone, you can still track bus arrival times using L, D (Tue–Sun) $ text messaging. Simply text “ctabus [stopID]” to 41411. Find the stop ID number at the bottom of the bus stop sign or on the CTA website, Compiled by Katie Bane, Laurie D. Bor- and you will receive a text with estimated times of arrival. Unfortunately, man, Beverly Goldberg, Phil Morehart, there’s nothing similar for trains. Mariam Pera, and Sanhita SinhaRoy. z americanlibrariesmagazine.org

60 From loading to cropping to scanning to editing. The ST ViewScan delivers amazing images from your microﬁlm with our simple to use Viewer/Scanner. See how much fun your microﬁlm can be!

In 2004 ST Imaging introduced the ﬁrst digital ﬁlm viewer and scanner. Come to the ALA Annual Conference in Chcago and see how in 2013 we set the standard all over again. BOOTH #420 PEOPLE | Announcements Currents

n July 1 Eileen G. Abels Library. She had previ- will become dean of the ously worked as assistant Simmons College Gradu- director and youth ate School of Library and services librarian at the Information Science in Ames Free Library in Pat Herndon Sara Jones Beverly Lewis Steven Mandeville- Boston. North Easton, Massachu- Gamble n In March Megan Allen setts. Dayton (Ohio) Metro n April 5 Roy Joynes became director of n March 1 Katie Cropper Library. retired as manager of libraries at Thomas Crane became children’s n May 2 Ruth Gaffey Prince George’s County Public Library in Quincy, librarian at Attica (Ind.) retired as head of chil- (Md.) Library System’s Massachusetts. Public Library. dren’s services at Walling- Laurel branch after 33 n April 15 Steven J. n March 1 Bret Davidson ford (Conn.) Public years of service. Bachman became became digital technolo- Library. n In mid-May, Scott executive director of Four gies development librar- n In April Linda J. Goff Kinney, former director County Library System in ian at North Carolina State retired after 25 years as of the Sweetwater County Vestal, New York. University Libraries in head of instructional ser- (Wyo.) Library System, n April 8 Jeff Barry Raleigh. vices at the university became director of Mobile became associate dean of n April 1 Meghan Day library of California State (Ala.) Public Library. university libraries at became head of youth ser- University, Sacramento. n June 1 Judith Kleven Seton Hall University in vices at Mamaroneck n In May Inese Gruber retired from her 26-year South Orange, New Jersey. (N.Y.) Public Library. retired as director of tenure as library director n May 20 Susan Brown n June 7 Eleanor Windham (Maine) Public of the Elizabeth Taber became director of Chapel Fairbanks will retire as Library after 23 years of Library in Marion, Massa- Hill (N.C.) Public Library. librarian for Margaret service. chusetts. n May 1 Bev Clarkson Ross Elementary School in n In March Pat Herndon n May 17 Beverly Lewis became director of Aliquippa, Pennsylvania, became director of Georgia retired as director of Raw- Pittsburg (Kans.) Public after 18 years with Libraries for Accessible lins Municipal Library in Library. Hopewell Area School Statewide Services in At- Pierre, South Dakota. n April 22 Catherine District. lanta, a network of regional n March 1 Steven Coyne became director of n April 7 Elaine Fultz libraries for people who Mandeville-Gamble Mansfield (Mass.) Public became teen specialist for are blind or otherwise became university librar- physically disabled. ian for University of Cali- n In May Lisa Jacobs fornia, Riverside became assistant director Libraries. CITED of the Longwood Public n March 1 Ray McBride Library in Middle Island, stepped down as library New York. director of Florence june 2013

n | March 4 Jason Jeffries County (S.C.) Library Sys- n Susan Livingston, librarian at South Florida became coordinator of tem to become director State College in Avon Park for more than 12 years, North Carolina Literary for the Lake City (S.C.) received a Librarian Emerita certificate on May 2 Festival at North Carolina Community Museum before her May 6 retirement. State University Libraries Society. n Kathleen D. Roe, director of archives and rein Raleigh. n March 18 Helen cords management operations at the New York n July 8 Sara Jones will McManus became public State Archives, has been elected 2014–2015 presi- become director of Marin policy and management dent of the Society of American Archivists. County (Calif.) Free studies liaison librarian at

americanlibrariesmagazine.org Library. Arlington (Va.) Campus

62 PEOPLE | Announcements

Library of George Mason OBITUARIES University. n May 13 Stacey Mulli- gan, who has worked in n Caroline Feller Bauer, 77, chil- Pennsylvania State University, Uni- libraries at an elementary dren’s librarian, author, and educator, versity of North Texas, and Oklahoma school and the Central died April 15 in Miami, Florida. She State University, from which he re- Intelligence Agency, be- received her PhD from the University tired after 17 years as the Doris Neus- came director of Middle- of Oregon, where she also was an as- tadt Professor and Dean of Libraries. town (Pa.) Public Library. sociate professor of library science. In In 2004, he was honored as a Library n June 30 Dick Murphy, recent years she lived in Bhatiari, Legend by the Oklahoma Library library system director for Bangladesh, where she established a Association and received its Distin- Prince William County, play park, library, and arts and crafts guished Service Award. Virginia, will retire after center for children. n Sharad Karkhanis, 78, former 27 years of service. n Jack Gerts, 59, print manager of librarian at Kingsborough Community n In March Brinda Patel ALA’s Reprographics unit, died May 5 College in Brooklyn, New York, died became the children’s in DeKalb, Illinois. He had worked at March 28. He was one of the founders librarian at New Provi- the Association for 41 years. of the Asian Pacific American Librar- dence (N.J.) Memorial n Susan Gilroy, online librarian for ians Association, and served as its Library. American Public University System first president, from 1980 to 1982. He n April 15 Christine (APUS), died March 13. Her work over was also president of the Library Perkins became director the past six years supported schools of Association of the City University of of Whatcom County Education and Public Service and New York from 1967 to 1969. (Wash.) Library System. Health. Gilroy came to APUS after n Ellen V. LiBretto, 66, died May 4 n March 4 Susan serving as library director at Travis after a brief illness. After holding Permahos became direc- Air Force Base near Fairfield, Califor- managerial positions in New York City tor of Summit (N.J.) Free nia, and was library director of the public libraries coordinating young Public Library. Institute of American Indian Arts in adult services, LiBretto joined Ran- n April 29 Constance Santa Fe, New Mexico. dom House as library marketing man- Schuett became director n Edward R. Johnson, 72, died April ager for Ballantine Books, where she of Juneau (Wis.) Public 25 in Angel Fire, New Mexico. He held worked with such authors as Ray Library. a master’s degree and a doctorate Bradbury, Elizabeth Berg, Anne Perry, n May 1 David Seleb from the University of Wisconsin. He and Colin Powell. After leaving Ran- became executive director served as an academic library admin- dom House, she consulted on library of Oak Park (Ill.) Public istrator at five universities: University marketing for several independent Library. of Colorado, University of Iowa, publishers. n April 30 Phyllis Self retired as dean of Western Illinois University Libraries in Macomb after nearly 50 n June 30 Suzanne Tho- Vespa will become direc- At ALA years in librarianship. rin will step down as dean tor of library services of n May 24 Angela Maycock n

April 15 Dale Spindel of libraries at Syracuse Mississauga Library Sys- resigned as assistant june 2013

became director of (N.Y.) University. tem in Ontario. director of the Office for |

Springfield (N.J.) Free n April 20 Frances Veit n June 17 David R. Intellectual Freedom after Public Library. became manager of Woken will become histo- five years. Dakota County (Minn.) ry and Latin American n April 5 Patrick Murphy Library’s Robert Trail studies librarian at the resigned as exhibit man- branch in Rosemount. University of Oregon ager with Conference n June 10 Rosemary Libraries, Eugene. Services.

David Seleb Phyllis Self Send notices and color photographs for Currents to Mariam Pera, [email protected]. americanlibrariesmagazine.org

63 PROFESSIONAL DEVELOPMENT | Youth Matters The Whole Library Approach

Every staffer should be capable of serving every patron by Linda W. Braun

t’s probably no surprise to All staff members should be ready to how to do something in a real-life you that sometimes library work with anyone who comes into situation is much more helpful than staffers prefer to work with the library. The paper discusses the learning about it in a workshop. one age group over another. importance of administrative sup- Young adult staffers can make a point IChildren’s services staff members port, and how to work together of letting colleagues observe their may love working with kids but across departments to benefit all positive conversations with teens. may not be so crazy about work- members of a community. Modeling how to handle difficult sit- ing with teens or adults; young A whole library approach to serv- uations can help demystify how to adult staffers may be wild about ing children and teens needs to en- work with an unfamiliar age group. teenagers, but preschoolers and compass broad training in topics n Discussion of challenging adults may be another story; and from child development to teens’ situations during staff meetings. adult services staffers might love acquisition of developmental assets, Being open, honest, and direct adults and teens, but not children. connecting each age group to mate- about difficult situations staffers Still, all staff members in a public rials and information they need, face when working with different library should be ready, willing, and communicating successfully. age groups creates opportunities to able, and How do library staffers get this learn new techniques. Training trained to training? Options include: n Collaboration with other staffers work with all n Turnkey training, which is library departments. When dif- ages. Adult available from a variety of sources. ferent departments develop col- to work services staff- For example, YALSA offers two laborative projects (say, teen with all ers don’t nec- training kits (ala.org/yalsa/young- services and reference staff mem- age groups is key. essarily have adults-deserve-best), one on teen bers working together on meeting to be able to behavior and the other on teens and adolescents’ homework needs), discuss the latest pop-culture trend technology. Both include Power- they help each other understand with a teen, but they should be Point presentations that can be used their respective needs and how to familiar with teen behaviors and by a workshop facilitator. They also create high-quality services for a interests and not be susceptible to include video samples and ideas for less familiar audience. making rash judgments about those small and large group activities. It The whole library approach can behaviors and interests. might be exactly what your library benefit every public library. Every Of course it’s not easy to guaran- needs to help staffers learn how to administrator can help prepare ev- tee all staffers are open to serving all work successfully with teens. ery library staff member to support june 2013

age groups. That’s where the whole n Webinars and videos on the needs of patrons of all ages. It’s |

library approach comes in. In 2011 working with different populations. the best way to assure that all library the Young Adult Library Services YALSA, the Association for Library users receive the high level of ser- Association (YALSA) released The Service to Children, the Public vice they deserve. z Importance of a Whole Library Ap- Library Association, and other ALA proach to Public Library Young Adult divisions provide such training, as LINDA W. BRAUN is an educational Services, outlining what it takes to do many library schools in their technology consultant for LEO: Librarians help all library staffers support continuing education offerings. and Educators Online, professor of practice n at Simmons College GSLIS in Boston, and a young adults. Despite the white pa- Regular modeling of success- past president of ALA’s Young Adult Library per’s YA focus, its message is clear: ful techniques. For many, seeing Services Association. americanlibrariesmagazine.org

64 Banned Books Week September 22–28, 2013

elebrate the freedom to read in your school, bookstore, or library during Banned Books Week with these new Cdesigns that encourage you to “discover what you're missing.” Banned Books Week highlights the beneﬁ ts of free and open access while drawing attention to the harms of censorship by spotlighting actual or attempted bannings of books across the United States. Use these products to help emphasize the importance of the First Amendment and the power of uncensored literature. For more information about Banned Books Week, please visit www.ala.org/bbooks.

2013 Banned Books Week Poster

2013 Banned Books Week Bookmark 2013 List of Banned Books

2013 Banned Books Week Disappearing Mug Pour hot liquid into this mug and the redactions disappear, 2013 Banned Books allowing you to discover what you’re missing. Week Buttons

2013 Banned Books Week T-shirt

Order your Banned Books Week items now. Visit alastore.ala.org/bbw for more details and to order.

BBWad.indd 1 5/13/2013 10:01:54 AM PROFESSIONAL DEVELOPMENT | Books Librarian’s Library

Bridging the Digital Divide by Karen Muller

opular wisdom says if you for effective research We must zation, and library want to learn how to use writing. The essayists reserves. The topi- your latest piece of con- cover aspects of the be able to cal arrangement al- sumer technology, you challenge, analyzing work with lows for pursuing a Pfind an 8-year-old to teach you. what NextGen students subject in detail, but library users In “The Children of Cyberspace: know or don’t know the extensive index Old Fogies by Their 20s” (New York and reviewing possible wherever they are enables zeroing in Times, Jan. 9, 2010), Brad Stone ways to teach concepts on the technology on a detail. A table looked at how children view tech- and skills. They also continuum. in the appendix nology differently than adults, look at research on the shows when US and how children even just a few ways academic libraries can trans- works pass into the public domain. years apart in age view technol- form their digital interfaces to en- INDEXED. PURDUE UNIVERSITY PRESS. 228 P. ogy differently from one another. hance student learning. PBK. $24.95. 978-1-55753-639-6 (ALSO AVAILABLE What this means for libraries, of INDEXED. INFORMATION TODAY FOR THE AMERI- AS AN EBOOK.) course, is that besides being able CAN SOCIETY FOR INFORMATION SCIENCE AND to keep track of the latest in read- TECHNOLOGY. 416 P. $59.50. 978-1-57387-475-5 Electronic re- ers’ advisory, cataloging rules, (ALSO AVAILABLE AS AN EBOOK.) sources are critical or the financial policies of our components in a governing bodies, we must also Just as the rules library’s ability to be able to work with library users for accessing in- deliver thorough, wherever they are on the technol- formation are targeted content to ogy continuum, from total novice changing, so too users. But market- to tech-savvy 8-year-old. In this are the copyright ing is vital if the issue, we look at recent titles that rules for using resources will be used to their fullest. help us stay up to date with both that information Marketing Your Library’s Electronic Re- technology and library services. in print, course- sources: A How-to-Do-It Manual for ware, web-based Librarians by Marie R. Kennedy and The New Digital delivery, and archives. Although Cheryl LaGuardia offers an overview, Scholar: Exploring copyright isn’t a new invention, new practical suggestions, bibliographies and Enriching the technology has the ability to com- for further reading, worksheets, and Research and Writ- plicate our understanding of copy- sample plans. The authors, both aca- ing Practices of right. Laura N. Gasaway, who has demic librarians, go through the june 2013

| NextGen Students, written and spoken about the issue steps of determining the purpose of

edited by Randall for decades, has collected updated the marketing plan, its development McClure and versions of columns she published and implementation, and finally its James P. Purdy, during a 15-year period in Copyright evaluation and possible refinement tackles the question of how to teach Questions and Answers for Informa- and relaunch. information literacy skills to digital tion Professionals: From the Columns INDEXED. ALA NEAL-SCHUMAN. 200 P. PBK. $60. natives—those who have always lived of Against the Grain. Using real ques- 978-1-55570-889-4 in an internet age but need to learn tions submitted to her through the how to locate in-depth information years, Gasaway has grouped by topic Now in its eighth edition, Library and

americanlibrariesmagazine.org and how to capture and integrate it issues such as permissions, digiti- Information Center Management, edit-

66 management specialist fortheALALibrary. KAREN MULLER 1-55570-897-9 TECHSOURCE. 232P.INDEXED. ALA PBK.$70.978- toolsaddapracticalcomponent. lytics on 14 of thecurrentlyavailableana to know. Thecasestudiesanddetails nicate thefindingstothosewhoneed sults tomake decisionsandcommu the authorsreviewhowtousere behavior canbeanalyzedandhow, introduction towhatkindsof web Professionals, Analytics StrategiesforInformation address thesepointsandmorein Tabatha Farney andNina McHale throughs toelectronicresources? click- Or but whataboutwebusage? lation statistics, counts andcircu customed todoor We’reused. ac your libraryis mation abouthow having theinfor tegic planningis A key partof stra $55. 978-1-59884-989-9 INDEXED. LIBRARIESUNLIMITED.489P. PBK. and strategicplanning. andmoveintoissues ofment, change principles andhistoryof manage offerment, ageneraloverview of the importanceof excellentmanage fiscal issues.Theybeginbystating and resources, leading,assessment, areas of planning,organizing,human library managementconcernsinthe selves, presentissuesandanswersto editors, allseasonedmanagersthem ager needingafreshperspective.The andtheman facing anewproblem, enced manager ager, theexperi for thenewman but alsoaresource not onlyatextbook dia J. Morner, is andClau Stueart, Moran, RobertD. ed byBarbaraB.

z aLITA Guide.Afteran is librarianandknowledge ------Web ------he didforthe Talk oftheTown andCommentpieces called OneMan’s Meatandtheshorter ones hewrote for admire hisessays,especiallythelonger dren’s books,ofcourse,butmostallI thing else,forthatmatter. Ilovehischil E. B.Whitewritingaboutdogs.Orany die. Thatallchanges,however, whenit’s too heartbreaking whenthedamndogs cially whenthedamndogstalk)andway I sniffing life,andenjoyingit.” that mighthavediminishedher curiosity andspoiledhertaste.Shedied Take Daisy, who“never tookpainstodiscover, conclusively, thethings also anabundanceofjoy. Thetwo,welearn,are sometimesinseparable. stated yetpalpable,poursfrom thepagelikesweat. ning hiscorrosive grin.”Whenthepoorpigdies,White’s grief,under his own…ahappyquack,writingvillainousprescriptions andgrin chance tovisitthepigwithme,andhemademanyprofessional callson save asickpigonhisfarm.Fred isWhite’s assistant:“Henevermisseda “Death ofaPig,”whichdescribestheauthor’s unsuccessfulattemptto I amquiteattachedtohim,inahalf-regretful way.” uninterrupted annoyancetome,yetheissuchanengagingoldfoolthat matter entirely: “Hisactivitiesandhischaracterconstituteanalmost cost whatitdid.”Fred, “theCecilB.DeMilleofdogs,”wasanother and saidso;butshehadasmallcircle offriendswhosawthrough her, who knewheronlyslightlyregarded herasanopinionatedlittlebitch, 12, 1932:“Herlifewasfullofincidentbutnotaccomplishment.Persons memorably inherobituary, whichappeared inthe Both DaisyandFred makemultipleappearanceshere, Daisymost went from citydogtocountrywhentheWhitesmovedMaine. spent herlifeinManhattan,andtheinimitableFred, adachshundwho together essays,shortcomments,andlettersinwhichdogsplayarole. ately. EditedbyWhite’s granddaughter, Martha,thecollectionbrings Dogs of toleranceandwearydisdain).Sowhenabookcalled conviction thattheylookupontheirhumancompanionswithamixture dachshunds), andhewrote aboutdogswithgreat respect (andafirm multiple breeds overtheyears(butalwayswithaspecialfondnessfor and objectsswayinginperfectrhythm. suming beauty, pristineintheirsimplicity, aparadeofsubjects,verbs, his sentencesare thingsofquiet,unas style isasucker’s game.I’llsayonlythat decades. Trying toanalyzeWhite’s prose a fanofdogbooks:toosmarmy(espe have nobeefagainstdogs,butI’mnot There isplentyofgriefinhiswritingaboutdogs,too,butthere is Fred playsasupportingrole inwhatisperhapsWhite’s bestessay, Perhaps White’s twomost“famous”dogswere Daisy, aScottiewho Dogs were oneofWhite’s favoritesubjects.Heshared hislifewith landedonmydesktheotherday, Inaturallygrabbeditimmedi THE GRIEFANDJOYOFMAN’SBESTFRIEND BILL OTT ROUSING READS New Yorker Harper’s is theeditorandpublisher ofALA’s Booklist. over many inacolumn - - - - New Yorker E. B.Whiteon , March - - -

67 americanlibrariesmagazine.org | june 2013 68 americanlibrariesmagazine.org | june 2013

Solutions Services and SHOWCASE | SHOWCASE <<< on theircomputersandmobiledevices. use, andshareIngram-distributed e-textbooksanddigitalcontent porate sectorsacrosstheworld the abilitytosearch,download, in thehighereducation,K–12,healthcare,government,andcor based teachingprogram,givingthe8millionDesire2Learnusers VitalSource BookshelfwillbeintegratedintoDesire2Learn’scloud- by partneringwithlearningsolutionsproviderDesire2Learn. has expandedthereachofitsVitalSourceBookshelfplatform solution forpublishers,academicinstitutions,andstudents— VitalSource Technologies—IngramContentGroup’se-textbook desire2learn.com libraries institutedownloadlimitsforpatrons. of musictitlesare$1.49orless.Ifnecessary,Hooplalets diobook andvideotitles,93%are$1.99orless,99% Prices rangefrom99centsto$2.99pertitle.Ofitsau only forwhatpatronsconsumeonaper-circulationbasis. fees, orsubscriptioncharges.Rather,librariesarecharged browsers. Therearenosetupcosts,annualmaintenance devices withFirefox,Safari,Chrome,orInternetExplorer on iOSandAndroidsmartphonestablets,aswell patron-driven acquisition.Hooplacontentcanbeaccessed ously, alleviatingholdsfordigitalcontentandcreatingtrue Hoopla titlesareavailabletomultiplepatronssimultane streamed ordownloadedforaspecificloanperiod.All content isstreamed,whilemusicandaudiobookscanbe 200,000 musicalbums,includingnewreleases.Video and televisionshows,9,000audiobooks,morethan platform offersacollectionofmorethan2,500movies video, music,andaudiobookcontent.Thecloud-based allows librarypatronstoinstantlystreamordownload Midwest Tape’snewdigital-contentservice,Hoopla, library.hoopladigital.com To haveanewproduct considered for thissection,contactPhilMorehart at

New Products / vitalsource.com <<<

- - - <<< of WashingtoninSeattlewhopreviouslyworked an, andCentralAsianstudiesfromtheUniversity translator withamaster’sinRussian,EastEurope Fairweather-Vega, acertifiedRussian-to-English speaking patrons.ThefirmwasfoundedbyShelley public, andcollegelibrariesbetterserveRussian- agency withaspecificmission:tohelpschool, FairVega RussianLibraryServicesisaconsulting fairvega.com short-term projects. each library’sneedsandwelcomesbothlong- Russian collections.FairVegatailorsprogramsto Russian-speaking patronsidentifyitems;andweed rial; addCyrillictransliterationstocatalogshelp and updatecatalogingofRussian-languagemate magazines, andfilms;enhancepresentcollections helps librariesselectandpurchaseRussianbooks, on Russianliterature,culture,andlanguage.It The agencyactsasasinglesourceofexpertise acquisitions atMultnomahCounty(Oreg.)Library. pmorehart @ ala.org . Continued onp.70 - - 69 americanlibrariesmagazine.org | june 2013 70 americanlibrariesmagazine.org | june 2013 SHOWCASE | SHOWCASE Continued fromp.68 tion managementprocesses.Bluecloudcomprisesthreecomponents: streamline alibrary’sadministration,discovery,acquisition,andcollec designed forusewithSirsiDynix’sHorizonandSymphonysystemsto build allfutureproducts.BluecloudSuiteisacloud-basedprogram services platformthatithailsasthearchitectureuponwhichwill Library automationsolutionsproviderSirsiDynixhaslaunchedanew sirsidynix.com/bluecloud-suite house localservers. upkeep formostoftheBluecloudfeatures,anditcanbeimplementedasasoftware-as-a-serviceprogramoronin- bile, desktop,andsocial-mediaapplications.Alibrary’sexistingHorizonSymphonymaintenancefeescoverthe (3) “Discovery”allowsstaffandpatronstosearchcontentviamo managed place;and (2) “Marketplace”gatherstoolsforcontentacquisitioninoneeasily serials, andstaffworkflow; (1) “Staff”letslibrariansmanageanalytics,cataloging,acquisitions, really explore theirinterests atthelibrary.” degree ofpersonalizedinformationsothatuserscan ratings andreviews, forexample—aswellastheright management forourusers,and interactive groups— Search, forsure, but wealsowantedsuperbaccount our users.Itneededtoprovide uswithcertainfeatures. just goodbutverygood,andithadtobeintuitivefor technology forKingstonFrontenac. “Ithadtolooknot director ofoutreach and ery,” saidLesterWebb, ence does—anddiscov what agoodwebpres keting—which isreally presence forbothmar become ournewweb natural moveforward. vice andawebsitewas between adiscoveryser Creating aseamlesslink advisory portal,ofsorts. website asareaders’ had cometoviewthe was essential.Patrons integrating thelibrarywebsiteintonewplatform discovery service,staff membersknewthatsuccessfully W “The platformhadto decided toreplace itstraditionalcatalogwitha hen KingstonFrontenac (Ont.)PublicLibrary

New Products

- - - -

KINGSTON FRONTENACINVESTSINIGUANA discovery platform. Infor’s Iguanaservicemerges alibrary’s webpresence withits CASE STUDY <<< in one—hasbeen agreat experiencefor our users.” tion betweenthewebsiteanddiscovery—it really isall said Webb. “Thefactthatthere isessentiallynotransi with theexperience.“We enjoyedworkingwithInfor,” and mobiledevices. search collectionsandservicesontheirsmartphones provided amobilewebprofile thatallowsusersto one engaginginterfacethatpersonalizesitselfforeach merged theelementsKingstonFrontenac neededinto mation solutionscompanyInfor. Infor’s Iguanaservice Overall, KingstonFrontenac PublicLibraryispleased Kingston Frontenac foundapartnerinlibraryauto- - - interesting. Iguanaalso keep contentfresh and Kingston Frontenac to agement systemallowed easy-to-use contentman tions. Iguana’s complete, and learnaboutpromo overlaid onGoogleMaps, tion andopeninghours information suchasloca lists, accesskeylibrary selections, create reading collections, rateandreview can search printanddigital into anaccount.Patrons patron whenheorshelogs -

- - -

Richard Ford,KatherineKellgren, andmore! go to http://ala13.ala.org/scheduler full listofauthorsandreaders, as well asappearance timesanddetails, throughout theday onSunday, June30andMonday, July1. To seethe of the2013Printz andOdyssey awards booth(#1817) at theBooklist 2013 nalists, alongwiththewinningandhonor authorsandreaders theAndrew editors Carnegie willinterview forBooklist Medals Excellence Don’t miss Annual Conference? Want an“award-winning” Where jobseekersandemployers getresults your requirements are posted you whennewjobsmatching alert and more by positiontype, employer, location, Save Post Search andsort job seekers

your résumé for employers your search asanRSSfeed to The #1source andInformation for Science jobsinLibrary and Technology Booklist hundreds ofjobads HRDR ’ s interviews of Nick Lake, s joblist.ala.org and search “BKLinterviews.”and professionals andstudents ALA reaches themostengaged Simplify Strengthen employers Connect Review advertising for onlineandprint advertising posted résumés with candidates recruitment—one-stop recruitment—one-stop your candidate pool—

71 americanlibrariesmagazine.org | june 2013 COMMENTARY | Will’s World Reading Mom Like a Book

A precious glimpse into the life of her mind by Will Manley

uring my senior year books. A few hours Her books the Jewish Publica- of high school, just as into this chore, I re- tion Society’s 1985 football season was alized that her books told her life translation of the overlapping basketball told her life story. story. Holy Scriptures. Dseason, we whimpered off the I started in the Clearly she was pon- field at halftime like lost little basement, where I dering these during dogs. The score was 28 Them, found a large wooden box nailed the three years of her terminal illness. 3 Us. Our coach launched into a shut. Inside was a complete series of On her bedroom nightstand was tirade in the locker room: “La- the Bobbsey Twins and the Bunny an 1875 edition of the King James dies, I’d like to start with the Brown stories. Inside each book was Bible, bearing the inscription of her fundamentals. This is a football.” an inscription from my mother’s paternal grandfather. Inside was a Then he held up a basketball grandmother marking Christmases letter I had written to her shortly af- and said, “This is not a football. and my mother’s birthdays from ter learning of her diagnosis. In her Those who want to play basket- 1924 (when she turned 3) to 1935. attic was an extensive collection of ball, go through that door to the Family lore had it that my mother New Age religious works dating gym. Those who want to play could read by age 3, which those in- from the mid-1960s to 2001. Who football, go through that door scriptions confirm. knew Mom was such a freethinker? to the gridiron.” All but three Upstairs, on the bookshelves Within the pages of many of her of us headed for the gridiron adorning the formal living room, books were family photos dating where the slaughter continued. was a full collection of the famous from the mid-19th to the early 21st This long-lost memory came to Heritage Press classics. My mother century, postcards and letters (some mind this past August, when I was inscribed each book with her name from college boyfriends!), and cleaning out my mother’s rambling and the date. She had collected and bookmarks ranging from prayer old house a few days after she died. read these books during the first 10 cards, grocery receipts, and party My sister was in charge of furniture, years of her 55-year marriage. They invitations to torn bits of newspa- my brother took care of business re- were dusty and did not seem to have per. Many were marked with her cords, and I sorted through her had any recent use. underscores and marginalia. In the adjacent, In reflecting on my archeological more informal dig of my mother’s life, one thing sunroom—her dawned on me: how lucky I am that favorite—was a my mother lived in the glue-and- haphazard pile of paper-books era. To paraphrase my june 2013

| books, mostly spir- old football coach, an ebook is not a

itual in nature: book at all. Real books survive the Pope Benedict XVI years and hold stories within sto- writing about ries. But ebooks are nothing more Christ, St. Teresa of than fleeting electronic files. z Ávila’s mystical

classic The Interior WILL MANLEY has furnished provocative Castle, Thomas commentary on librarianship for more than 30 years and has written nine books on the Merton’s Zen and lighter side of library science. Contact him at [email protected]. americanlibrariesmagazine.org the Birds of Appetite,

72 TOP 10 LIBRARY SCIENCE GRADUATE PROGRAM IN THE COUNTRY* The iSchool, College of Information Science & Technology at Drexel University

MASTER’S DEGREES AND POST-MASTER’S CERTIFICATES AVAILABLE ONLINE

VISIT US AT THE 2013 ALA ANNUAL CONFERENCE AND EXHIBITION: BOOTH #1563

Drexel University online library science courses are taught by on-campus faculty from the College of Information Science and Technology.

FEATURED PROGRAMS: • Master’s in Library and Information Science • Post-Master’s Archival Studies Specialist Program • Post-Master’s Digital Libraries Studies Specialist Program • Post-Master’s Youth Services Specialist Program • Post-Master’s Competitive Intelligence/ Knowledge Management Studies Specialist Program

20% DISCOUNT FOR ALA MEMBERS

GET STARTED TODAY: DREXEL.COM/LIBRARIAN *U.S.News & World Report “Best Graduate Schools 2013” SHOUT! SHOUT! LET IT ALL OUT! THESE ARE THE THINGS YOU CAN'T DO WITHOUT!

Sierra Library Services Platform Only one platform empowers users to select just the functionality they need, delivered in any manner they want.

Imagine with Sierra.

Discover Sierra at sierra.iii.com

Inn vative www.iii.com » [email protected] » 800+878+6600