OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC209882
C6orf201 (NM_206834) Human Tagged ORF Clone Product data:
Product Type: Expression Plasmids Product Name: C6orf201 (NM_206834) Human Tagged ORF Clone Tag: Myc-DDK Symbol: C6orf201 Synonyms: MGC87625, dJ1013A10.5 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC209882 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC
ATGGCCAGTGGGCCTCTGGGACCCGGGGCCCGGCCCACCCGCCTCCACCCTCCATTCCCACCGCCTGCTC ACATCAAGCCAGGAGCACCGCCCGGTGAGAATCCTGAACTCTCTGGCTTAGAAAGAATCTTAGCAAGACA TCAGTTGCCAAAAGAGATTAATCTGACCCCAAAGCCGAACAGAATGCCCCCGTGGAAAAGAAAAATCATC AACAATGTAACTGACGGGTGGAAGAAATGTCACTTGTTGAAGAGAAACACGAAAGAGCCTCCAATGTCCA CCATAGTTGTCAGAAAACTTATTCAAAAAAATGTACCCAGAAGACACAGCCTAAGGAATACAAGCAGGAA ACTGAGAAACCTGCCAACAACAGCTAAAGGGACACAAACAGAA
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC209882 protein sequence Red=Cloning site Green=Tags(s)
MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLPKEINLTPKPNRMPPWKRKII NNVTDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPTTAKGTQTE
myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6529_f06.zip Restriction Sites: SgfI-MluI
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 C6orf201 (NM_206834) Human Tagged ORF Clone – RC209882
Cloning Scheme:
Plasmid Map:
ACCN: NM_206834 ORF Size: 393 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 C6orf201 (NM_206834) Human Tagged ORF Clone – RC209882
RefSeq: NM_206834.1, NP_996665.1 RefSeq Size: 2418 bp RefSeq ORF: 395 bp Locus ID: 404220 MW: 14.7 kDa
Product images:
Western blot validation of overexpression lysate (Cat# [LY404234]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209882 using transfection reagent MegaTran 2.0 (Cat# [TT210002]).
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3