Civil & Structural Engineers  Building Surveyors  Geo-Environmentalists   3KDVH,'HVN6WXG\  DW  :LGQHV5HFUHDWLRQDO*URXQG  

Liverpool T: 0151 227 3155 Manchester  T: 0161 817 5180  Wrexham  T: 01978 664071  London  T: 020 74 584136   Head Office 18-20 Harrington Street &OLHQW(&+DUULV Liverpool L2 9QA 2XUUHI/* T: 0151 227 3155 VW F : 0151 227 3156 'DWH 2FWREHU E: [email protected] www.sutcliffe.co.uk 26859LG Widnes Recreational Ground, Widnes

$33(1',;' (19,52&+(&.®5(3257

21 Envirocheck ® Report: Datasheet

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road Widnes WA8 7EY

Client Details: MR W Baldwin Sutcliffe Projects Ltd 18-20 Harrington Street Liverpool L2 9QA

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Contents

Report Section Page Number

Summary -

Agency & Hydrological 1

Waste 8

Hazardous Substances -

Geological 9

Industrial Land Use 15

Sensitive Land Use 18

Data Currency 19

Data Suppliers 25

Useful Contacts 26

Introduction

The Environment Act 1995 has made site sensitivity a key issue, as the legislation pays as much attention to the pathways by which contamination could spread, and to the vulnerable targets of contamination, as it does the potential sources of contamination. For this reason, Landmark's Site Sensitivity maps and Datasheet(s) place great emphasis on statutory data provided by the Environment Agency and the Scottish Environment Protection Agency; it also incorporates data from Natural England (and the Scottish and Welsh equivalents) and Local Authorities; and highlights hydrogeological features required by environmental and geotechnical consultants. It does not include any information concerning past uses of land. The datasheet is produced by querying the Landmark database to a distance defined by the client from a site boundary provided by the client.

In the attached datasheet the National Grid References (NGRs) are rounded to the nearest 10m in accordance with Landmark's agreements with a number of Data Suppliers.

Copyright Notice

© Landmark Information Group Limited 2013. The Copyright on the information and data and its format as contained in this Envirocheck® Report ("Report") is the property of Landmark Information Group Limited ("Landmark") and several other Data Providers, including (but not limited to) Ordnance Survey, British Geological Survey, the Environment Agency and Natural England, and must not be reproduced in whole or in part by photocopying or any other method. The Report is supplied under Landmark's Terms and Conditions accepted by the Customer. A copy of Landmark's Terms and Conditions can be found with the Index Map for this report. Additional copies of the Report may be obtained from Landmark, subject to Landmark's charges in force from time to time. The Copyright, design rights and any other intellectual rights shall remain the exclusive property of Landmark and /or other Data providers, whose Copyright material has been included in this Report.

Natural England Copyright Notice

Site of Special Scientific Interest, National Nature Reserve, Ramsar, Special Protection Area, Special Conservation Area, Marine Nature Reserve data (derived from Ordnance Survey 1:10000 raster) is provided by, and used with the permission of, Natural England who retain the copyright and Intellectual Property Rights for the data.

Ove Arup Copyright Notice

The Data provided in this report was obtained on Licence from Ove Arup & Partners Limited (for further information, contact [email protected]). No reproduction or further use of such Data is to be made without the prior written consent of Ove Arup & Partners Limited. The information and data supplied in the product are derived from publicly available records and other third party sources and neither Ove Arup & Partners nor Landmark warrant the accuracy or completeness of such information or data.

Peter Brett Associates Copyright Notice

The cavity data presented has been extracted from the PBA enhanced version of the original DEFRA national cavity databases. PBA/DEFRA retain the copyright & intellectual property rights in the data. Whilst all reasonable efforts are made to check that the information contained in the cavity databases is accurate we do not warrant that the data is complete or error free. The information is based upon our own researches and those collated from a number of external sources and is continually being augmented and updated by PBA. In no event shall PBA/DEFRA or Landmark be liable for any loss or damage including, without limitation, indirect or consequential loss or damage arising from the use of this data.

Radon Potential dataset Copyright Notice

Information supplied from a joint dataset compiled by The British Geological Survey and the Health Protection Agency.

Report Version v47.0

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Summary

Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Agency & Hydrological

Contaminated Land Register Entries and Notices pg 1 1

Discharge Consents pg 1 1 5

Enforcement and Prohibition Notices

Integrated Pollution Controls

Integrated Pollution Prevention And Control

Local Authority Integrated Pollution Prevention And Control

Local Authority Pollution Prevention and Controls

Local Authority Pollution Prevention and Control Enforcements

Nearest Surface Water Feature pg 2 Yes

Pollution Incidents to Controlled Waters pg 2 5 8

Prosecutions Relating to Authorised Processes

Prosecutions Relating to Controlled Waters

Registered Radioactive Substances

River Quality pg 4 1 1

River Quality Biology Sampling Points

River Quality Chemistry Sampling Points

Substantiated Pollution Incident Register

Water Abstractions pg 5 (*8)

Water Industry Act Referrals

Groundwater Vulnerability pg 6 Yes n/a n/a n/a

Bedrock Aquifer Designations pg 7 Yes n/a n/a n/a

Superficial Aquifer Designations pg 7 Yes n/a n/a n/a

Source Protection Zones pg 7 1

Extreme Flooding from Rivers or Sea without Defences n/a n/a

Flooding from Rivers or Sea without Defences n/a n/a

Areas Benefiting from Flood Defences n/a n/a

Flood Water Storage Areas n/a n/a

Flood Defences n/a n/a Waste

BGS Recorded Landfill Sites pg 8 2

Historical Landfill Sites pg 8 1 2

Integrated Pollution Control Registered Waste Sites

Licensed Waste Management Facilities (Landfill Boundaries)

Licensed Waste Management Facilities (Locations)

Local Authority Recorded Landfill Sites

Registered Landfill Sites

Registered Waste Transfer Sites

Registered Waste Treatment or Disposal Sites

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Summary

Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Hazardous Substances

Control of Major Accident Hazards Sites (COMAH)

Explosive Sites

Notification of Installations Handling Hazardous Substances (NIHHS)

Planning Hazardous Substance Consents

Planning Hazardous Substance Enforcements Geological

BGS 1:625,000 Solid Geology pg 9 Yes n/a n/a n/a

BGS Estimated Soil Chemistry pg 9 Yes Yes Yes Yes

BGS Recorded Mineral Sites pg 13 1

BGS Urban Soil Chemistry

BGS Urban Soil Chemistry Averages

Brine Compensation Area n/a n/a n/a

Coal Mining Affected Areas pg 13 Yes n/a n/a n/a

Mining Instability n/a n/a n/a

Man-Made Mining Cavities

Natural Cavities

Non Coal Mining Areas of Great Britain n/a n/a

Potential for Collapsible Ground Stability Hazards pg 13 Yes Yes n/a n/a

Potential for Compressible Ground Stability Hazards n/a n/a

Potential for Ground Dissolution Stability Hazards n/a n/a

Potential for Landslide Ground Stability Hazards pg 14 Yes Yes n/a n/a

Potential for Running Sand Ground Stability Hazards pg 14 Yes Yes n/a n/a

Potential for Shrinking or Swelling Clay Ground Stability Hazards pg 14 Yes Yes n/a n/a

Radon Potential - Radon Affected Areas pg 14 Yes n/a n/a n/a

Radon Potential - Radon Protection Measures n/a n/a n/a Industrial Land Use

Contemporary Trade Directory Entries pg 15 4 5 18

Fuel Station Entries

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Summary

Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Sensitive Land Use

Areas of Adopted Green Belt

Areas of Unadopted Green Belt

Areas of Outstanding Natural Beauty

Environmentally Sensitive Areas

Forest Parks

Local Nature Reserves

Marine Nature Reserves

National Nature Reserves

National Parks

Nitrate Sensitive Areas

Nitrate Vulnerable Zones pg 18 1

Ramsar Sites

Sites of Special Scientific Interest

Special Areas of Conservation

Special Protection Areas

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Contaminated Land Register Entries and Notices 1 Location: St Michael'S Golf Course, Dundalk Road, Widnes, Wa8 8te A8NE 528 1 350379 Notice Type: Environmental Protection Act (1990) Part II A Section 78C(1)(b) Designated (S) 385564 Special Site Reference: HBC015 Dated: 19th April 2007 Positional Accuracy: Positioned by the supplier Boundary Quality: Good Discharge Consents 2 Operator: Mclean Homes Nw & Cheshire Ltd A8NE 493 2 350500 Property Type: Domestic Property (Multiple) (S) 385600 Location: Mclean Res Development Swo, Dundalk Road, Widnes, Cheshire Authority: Environment Agency, North West Region Catchment Area: Not Given Reference: 016992021 Permit Version: 1 Effective Date: 2nd July 1986 Issued Date: Not Supplied Revocation Date: 1st July 1991 Discharge Type: Discharge Of Other Matter-Surface Water Discharge Freshwater Stream/River Environment: Receiving Water: Stewards Brook Status: Authorisation revokedRevoked Positional Accuracy: Located by supplier to within 100m Discharge Consents 3 Operator: Mclean Homes Nw & Cheshire Ltd A8SW 665 2 350100 Property Type: Sewerage Network - Sewers - Water Company (S) 385500 Location: Residential Development Swo, Netherfield, Widnes, Cheshire Authority: Environment Agency, North West Region Catchment Area: Not Given Reference: 016890873 Permit Version: 1 Effective Date: 1st July 1991 Issued Date: Not Supplied Revocation Date: 1st July 1991 Discharge Type: Discharge Of Other Matter-Surface Water Discharge Freshwater Stream/River Environment: Receiving Water: Stewards Brook Status: Authorisation revokedRevoked Positional Accuracy: Located by supplier to within 100m Discharge Consents 4 Operator: Land And Water Services Limited A8SW 727 2 350200 Property Type: Recreational & Cultural (S) 385400 Location: St Michaels Golf Course Dundalk Road, Widnes, ., Cheshire, Wa8 8bs Authority: Environment Agency, North West Region Catchment Area: Ditton Brook Reference: Eprbp3124gp Permit Version: 1 Effective Date: 16th June 2010 Issued Date: 16th June 2010 Revocation Date: 24th January 2011 Discharge Type: Trade Discharges - Site Drainage (Contam Surface Water, Not Tips) Discharge Onto Land/Into Watercourse Environment: Receiving Water: Groundwater Via Land Status: Surrendered under EPR 2010 Positional Accuracy: Located by supplier to within 100m Discharge Consents 5 Operator: United Utilities Water Plc A7SE 921 2 349800 Property Type: Sewerage Network - Sewers - Water Company (SW) 385340 Location: Alexander Dr, Halton, Widnes, Cheshire Authority: Environment Agency, North West Region Catchment Area: Not Given Reference: 016920990 Permit Version: 1 Effective Date: 19th March 2010 Issued Date: Not Supplied Revocation Date: Not Supplied Discharge Type: Public Sewage: Storm Sewage Overflow Discharge Freshwater Stream/River Environment: Receiving Water: Stewards Brook Status: Authorisation revokedRevoked Positional Accuracy: Located by supplier to within 10m

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 1 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Discharge Consents 5 Operator: United Utilities Water Plc A7SE 925 2 349810 Property Type: Sewerage Network - Sewers - Water Company (SW) 385330 Location: Alexander Dr, Halton, Widnes, Cheshire Authority: Environment Agency, North West Region Catchment Area: Dibbinsdale Brook Reference: 01HAL0005 Permit Version: 2 Effective Date: 1st January 1995 Issued Date: Not Supplied Revocation Date: Not Supplied Discharge Type: Public Sewage: Storm Sewage Overflow Discharge Freshwater Stream/River Environment: Receiving Water: Stewrads Brook Status: Post National Rivers Authority Legislation where issue date > 31/08/1989 Positional Accuracy: Located by supplier to within 100m Discharge Consents 5 Operator: United Utilities Water Plc A7SE 925 2 349810 Property Type: Sewerage Network - Sewers - Water Company (SW) 385330 Location: Alexander Dr, Halton, Widnes, Cheshire Authority: Environment Agency, North West Region Catchment Area: Not Supplied Reference: 01hal0005 Permit Version: 1 Effective Date: 10th January 1985 Issued Date: Not Supplied Revocation Date: 18th March 2010 Discharge Type: Public Sewage: Storm Sewage Overflow Discharge Freshwater Stream/River Environment: Receiving Water: Stewards Brook Status: Authorisation revokedRevoked Positional Accuracy: Located by supplier to within 10m Nearest Surface Water Feature A13SW 1 - 350334 (S) 386122 Pollution Incidents to Controlled Waters 6 Property Type: Not Given A14NW 278 2 350700 Location: Cheshire (NE) 386400 Authority: Environment Agency, North West Region Pollutant: Unknown Note: Stewards Brook; None Pollution Found Incident Date: 17th July 1995 Incident Reference: 95741785 Catchment Area: Ditton Brook Receiving Water: Not Given Cause of Incident: Other Incident/Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 7 Property Type: Private Sewage: Sewage Works And Septic Tanks A8NE 423 2 350600 Location: Cheshire (SE) 385700 Authority: Environment Agency, North West Region Pollutant: Sewage Sludge Note: Stewards Brook; Sewage Sludge Incident Date: 10th May 1996 Incident Reference: 96741005 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 8 Property Type: Private Sewage: Sewage Works And Septic Tanks A8NE 493 2 350500 Location: Cheshire (S) 385600 Authority: Environment Agency, North West Region Pollutant: Sewage Sludge Note: Stewards Brook; Sewage Sludge Incident Date: 18th June 1996 Incident Reference: 96741327 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 2 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Pollution Incidents to Controlled Waters 8 Property Type: Private Sewage: Sewage Works And Septic Tanks A8NE 498 2 350500 Location: Cheshire (S) 385595 Authority: Environment Agency, North West Region Pollutant: Sewage Sludge Note: Stewards Brook; Sewage Sludge Incident Date: 27th June 1996 Incident Reference: 96741424 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 8 Property Type: Connection To Surface Drains A8NE 499 2 350505 Location: Cheshire (S) 385595 Authority: Environment Agency, North West Region Pollutant: Miscellaneous - Other Note: Stewards Brook; Washing Water Crossed Connections Incident Date: 27th June 1996 Incident Reference: 96741425 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Wrong Connection Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 9 Property Type: Pollution Found Source Not Determined A8NW 506 2 350300 Location: Location Description Not Available (S) 385600 Authority: Environment Agency, North West Region Pollutant: Miscellaneous - Tip Leachate Note: Stewards Brook Incident Date: 14th November 1994 Incident Reference: 94742489 Catchment Area: Ditton Brook Receiving Water: Not Given Cause of Incident: Miscellaneous/Other Pollution Type Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 9 Property Type: Connection To Surface Drains A8NW 511 2 350300 Location: Cheshire (S) 385595 Authority: Environment Agency, North West Region Pollutant: Other Sewage Note: Stewards Brook; Sewage Incident Date: 10th May 1996 Incident Reference: 96741012 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Wrong Connection Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 10 Property Type: Tip Drainage A8SE 589 2 350400 Location: Location Description Not Available (S) 385500 Authority: Environment Agency, North West Region Pollutant: Miscellaneous - Tip Leachate Note: Stewards Brook Incident Date: 19th September 1994 Incident Reference: 94742098 Catchment Area: Ditton Brook Receiving Water: Not Given Cause of Incident: Inadequate Construction Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 11 Property Type: Tip Drainage A8SW 762 2 350100 Location: Location Description Not Available (S) 385400 Authority: Environment Agency, North West Region Pollutant: Miscellaneous - Tip Leachate Note: Tip Leachate Incident Date: 3rd May 1994 Incident Reference: 94740858 Catchment Area: Ditton Brook Receiving Water: Not Given Cause of Incident: Other Incident/Unknown Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 3 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Pollution Incidents to Controlled Waters 12 Property Type: Not Given A14SE 855 2 351300 Location: Cheshire (E) 386000 Authority: Environment Agency, North West Region Pollutant: Not Given Note: Not Supplied Incident Date: 29th August 1991 Incident Reference: 91430105 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 13 Property Type: Private Sewage (Non-PLC): Sewerage Systems A7SE 869 2 349800 Location: Location Description Not Available (SW) 385400 Authority: Environment Agency, North West Region Pollutant: Unknown Sewage Note: Stewards Brook Incident Date: 15th October 1991 Incident Reference: 91440086 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Unknown Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 13 Property Type: Private Sewage (Non-PLC): Sewerage Systems A7SE 873 2 349800 Location: Location Description Not Available (SW) 385395 Authority: Environment Agency, North West Region Pollutant: Unknown Sewage Note: Stewards Brook Incident Date: 27th November 1991 Incident Reference: 91440102 Catchment Area: Ditton Brook Receiving Water: Not Given Cause of Incident: Unknown Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 14 Property Type: Spillage; Accident In Transit A9SW 870 2 350800 Location: Location Description Not Available (SE) 385300 Authority: Environment Agency, North West Region Pollutant: Industrial Effluent Note: Not Supplied Incident Date: 8th November 1991 Incident Reference: 91430109 Catchment Area: Mersey - Tidal Receiving Water: Not Given Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m River Quality Name: Steward'S Bk A14NW 252 2 350727 GQA Grade: River Quality E (E) 386216 Reach: Qsl At Liverpool Road To Golf Club Estimated Distance .7 (km): Flow Rate: Flow less than 0.31 cumecs Flow Type: River Year: 2000 River Quality Name: Steward'S Bk A8SE 584 2 350387 GQA Grade: River Quality E (S) 385507 Reach: Golf Club To Fwl Estimated Distance 2 (km): Flow Rate: Flow less than 0.31 cumecs Flow Type: River Year: 2000

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 4 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Water Abstractions Operator: Mckechnie(Widnes)Limited A3SW 1309 2 350200 Licence Number: 2569028004 (S) 384800 Permit Version: Not Supplied Location: Borehole, WIDNES, Cheshire Authority: Environment Agency, North West Region Abstraction: Cooling & Conveying Materials Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 2046 Yearly Rate (m3): 394234 Details: Additional Purpose: Conveying materials; Licence Status: Lapsed Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Halton Borough Council A10NE 1420 2 351800 Licence Number: 2569027002 (E) 385700 Permit Version: Not Supplied Location: Works In Widnes, WIDNES Authority: Environment Agency, North West Region Abstraction: Manufacturing Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 0 Yearly Rate (m3): 0 Details: Boreholes (2) Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Halton Borough Council (E) 1680 2 352100 Licence Number: 2569027002 385800 Permit Version: Not Supplied Location: Works In Widnes, WIDNES Authority: Environment Agency, North West Region Abstraction: Manufacturing Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 23 Yearly Rate (m3): 4546 Details: Boreholes (2) Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Albright & Wilson Limited A5NE 1811 2 351800 Licence Number: 2569027001 (SE) 384900 Permit Version: Not Supplied Location: Borehole, Anne Street, WIDNES, Cheshire Authority: Environment Agency, North West Region Abstraction: Cooling Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 2728 Yearly Rate (m3): 681900 Details: Licence Status: Revoked Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 5 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Water Abstractions Operator: Eternit U K Ltd A25SE 1904 2 351900 Licence Number: 2569027003 (NE) 387500 Permit Version: 100 Location: Boreholes (2) On Lh'S Premises At Derby Road, Widnes Authority: Environment Agency, North West Region Abstraction: Commercial/Industrial/Public Services: Drinking; Cooking; Sanitary; Washing; (Small Garden) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 2182 Yearly Rate (m3): 545520 Details: Llh'S Premises At Derby Road, Widnes Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st February 1990 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Eternit U K Ltd A25SE 1904 2 351900 Licence Number: 2569027003 (NE) 387500 Permit Version: 100 Location: Boreholes (2) On Lh'S Premises At Derby Road, Widnes Authority: Environment Agency, North West Region Abstraction: Other Industrial/Commercial/Public Services: Process Water Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 0 Yearly Rate (m3): 0 Details: Lh'S Premises At Derby Road, Widnes Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st February 1990 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Eternit U K Ltd (NE) 1999 2 352100 Licence Number: 2569027003 387400 Permit Version: 100 Location: Boreholes (2) On Lh'S Premises At Derby Road, Widnes Authority: Environment Agency, North West Region Abstraction: Commercial/Industrial/Public Services: Drinking; Cooking; Sanitary; Washing; (Small Garden) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Llh'S Premises At Derby Road, Widnes Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st February 1990 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Eternit U K Ltd (NE) 1999 2 352100 Licence Number: 2569027003 387400 Permit Version: 100 Location: Boreholes (2) On Lh'S Premises At Derby Road, Widnes Authority: Environment Agency, North West Region Abstraction: Other Industrial/Commercial/Public Services: Process Water Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Lh'S Premises At Derby Road, Widnes Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st February 1990 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Groundwater Vulnerability Soil Classification: Soils of High Leaching Potential (U) - Soil information for restored mineral A13NW 0 2 350323 workings and urban areas is based on fewer observations than elsewhere. A (NW) 386238 worst case vulnerability classification (H) assumed, until proved otherwise Map Sheet: Sheet 16 West Cheshire Scale: 1:100,000

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 6 of 26 Agency & Hydrological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Groundwater Vulnerability Soil Classification: Soils of Low Leaching Potential - Soils in which pollutants are unlikely to A13NE 0 2 350357 penetrate the soil layer because water movement is largely horizontal or they (S) 386188 have large ability to attenuate diffuse pollutants. Lateral flow from these soils contribute to groundwater recharge elsewhere in the catchment Map Sheet: Sheet 16 West Cheshire Scale: 1:100,000 Drift Deposits Drift Deposit: Low permeability drift deposits occuring at the surface and overlying Major and A13NE 0 2 350357 Minor Aquifers are head, clay-with-flints, brickearth, peat, river terrace deposits (S) 386188 and marine and estuarine alluvium Map Sheet: Sheet 16 West Cheshire Scale: 1:100,000 Bedrock Aquifer Designations Aquifer Desination: Principal Aquifer A13NE 0 3 350357 (S) 386188 Superficial Aquifer Designations Aquifer Designation: Unproductive Strata A13NE 0 3 350357 (S) 386188 Source Protection Zones 15 Name: Various A17SE 749 2 349707 Source: Environment Agency, Head Office (NW) 386768 Reference: Not Supplied Type: Zone III (Total Catchment): The total area needed to support the discharge from the protected groundwater source. Extreme Flooding from Rivers or Sea without Defences None Flooding from Rivers or Sea without Defences None Areas Benefiting from Flood Defences None Flood Water Storage Areas None Flood Defences None

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 7 of 26 Waste

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS Recorded Landfill Sites 16 Site Name: Dundalk Road A8NE 564 3 350432 Location: WIDNES, Cheshire (S) 385524 Authority: British Geological Survey, National Geoscience Information Service Ground Water: Information not available Surface Water: Information not available Geology: N/A Positional Accuracy: Positioned by the supplier Boundary Accuracy: Moderate BGS Recorded Landfill Sites 17 Site Name: McRechnie Chemicals Ltd A8SW 917 3 350226 Location: Ditton Rd, WIDNES, Cheshire (S) 385193 Authority: British Geological Survey, National Geoscience Information Service Ground Water: Threat to ground water Surface Water: Threat to surface water Geology: N/A Positional Accuracy: Positioned by the supplier Boundary Accuracy: Moderate Historical Landfill Sites 18 Licence Holder: Not Supplied A8NW 497 2 350056 Location: Widnes (SW) 385688 Name: Netherfield Road Operator Location: Not Supplied Boundary Accuracy: As Supplied Provider Reference: EAHLD35513 First Input Date: Not Supplied Last Input Date: Not Supplied Specified Waste Deposited Waste included Household Waste Type: EA Waste Ref: Not Supplied Regis Ref: Not Supplied WRC Ref: Not Supplied BGS Ref: Not Supplied Other Ref: Not Supplied Historical Landfill Sites 19 Licence Holder: Not Supplied A8NE 564 2 350400 Location: Dundalk Road, Lower House, Widnes (S) 385526 Name: St Michaels Golf Course Operator Location: Not Supplied Boundary Accuracy: As Supplied Provider Reference: EAHLD31934 First Input Date: Not Supplied Last Input Date: 31st December 1973 Specified Waste Deposited Waste included Inert, Industrial, Commercial and Special Waste Type: EA Waste Ref: Not Supplied Regis Ref: Not Supplied WRC Ref: Not Supplied BGS Ref: 1777 Other Ref: Not Supplied Historical Landfill Sites 20 Licence Holder: McKechnie Chemicals Limited A8SW 920 2 350234 Location: Ditton Road, Widnes, Cheshire (S) 385190 Name: McKechnie Chemistry Factory Operator Location: Ditton Road, Widnes Boundary Accuracy: As Supplied Provider Reference: EAHLD16970 First Input Date: Not Supplied Last Input Date: 30th June 1981 Specified Waste Deposited Waste included Inert, Industrial and Special Waste, and Liquid Type: Sludge EA Waste Ref: Not Supplied Regis Ref: Not Supplied WRC Ref: 0600/0007 BGS Ref: 1776 Other Ref: 60308 Local Authority Landfill Coverage Name: Halton Unitary Council 0 1 350357 - Has no landfill data to supply 386188

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 8 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS 1:625,000 Solid Geology Description: Permian and Triassic sandstones, undifferentiated,including Bunter and A13NE 0 3 350357 Keuper (S) 386188 BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13NE 0 4 350357 Soil Sample Type: Rural Soil (S) 386188 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SW 48 4 350187 Soil Sample Type: Rural Soil (W) 386177 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SE 88 4 350357 Soil Sample Type: Rural Soil (S) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SW 155 4 350200 Soil Sample Type: Rural Soil (SW) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NE 237 4 350000 Soil Sample Type: Rural Soil (W) 386188 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NE 251 4 349995 Soil Sample Type: Rural Soil (W) 386240 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration:

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 9 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NE 251 4 350000 Soil Sample Type: Rural Soil (W) 386275 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 274 4 349972 Soil Sample Type: Rural Soil (W) 386082 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 281 4 350000 Soil Sample Type: Rural Soil (SW) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 313 4 349962 Soil Sample Type: Rural Soil (SW) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8NE 428 4 350467 Soil Sample Type: Rural Soil (S) 385662 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 449 4 349871 Soil Sample Type: Rural Soil (SW) 385888 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration:

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 10 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 460 4 349802 Soil Sample Type: Rural Soil (W) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A7NE 527 4 350000 Soil Sample Type: Rural Soil (SW) 385680 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14NW 528 4 351000 Soil Sample Type: Rural Soil (E) 386188 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14SW 567 4 351000 Soil Sample Type: Rural Soil (E) 386000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8SW 608 4 350278 Soil Sample Type: Rural Soil (S) 385501 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NW 657 4 349617 Soil Sample Type: Rural Soil (W) 386427 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration:

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 11 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A18NE 720 4 350357 Soil Sample Type: Rural Soil (N) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A18NW 728 4 350219 Soil Sample Type: Rural Soil (N) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8SW 733 4 350182 Soil Sample Type: Rural Soil (S) 385399 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A18NW 755 4 350097 Soil Sample Type: Rural Soil (N) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A17NE 782 4 350000 Soil Sample Type: Rural Soil (NW) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14NE 784 4 351254 Soil Sample Type: Rural Soil (E) 386306 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel <15 mg/kg Concentration:

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 12 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8SW 882 4 350343 Soil Sample Type: Rural Soil (S) 385211 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A19NW 925 4 351000 Soil Sample Type: Rural Soil (NE) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A7SE 981 4 350000 Soil Sample Type: Rural Soil (S) 385198 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A17NW 992 4 349599 Soil Sample Type: Rural Soil (NW) 387000 Arsenic 15 - 25 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 120 - 180 mg/kg Concentration: Lead Concentration: <150 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Recorded Mineral Sites 21 Site Name: Greenfield Farm A12SE 237 3 350010 Location: , Ditton, Widnes, Halton (W) 386084 Source: British Geological Survey, National Geoscience Information Service Reference: 91048 Type: Opencast Status: Ceased Operator: Unknown Operator Operator Location: Unknown Operator Periodic Type: Quaternary Geology: Till, Devensian Commodity: Common Clay and Shale Positional Accuracy: Located by supplier to within 10m BGS Measured Urban Soil Chemistry No data available BGS Urban Soil Chemistry Averages No data available Coal Mining Affected Areas Description: In an area which may be affected by coal mining activity. It is recommended A13NE 0 5 350357 that a coal mining report is obtained from the Coal Authority. Contact details (S) 386188 are included in the Useful Contacts section of this report. Non Coal Mining Areas of Great Britain No Hazard Potential for Collapsible Ground Stability Hazards Hazard Potential: Very Low A13NE 0 3 350357 Source: British Geological Survey, National Geoscience Information Service (S) 386188

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 13 of 26 Geological

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potential for Collapsible Ground Stability Hazards Hazard Potential: Very Low A12NE 237 3 350000 Source: British Geological Survey, National Geoscience Information Service (W) 386188 Potential for Compressible Ground Stability Hazards Hazard Potential: No Hazard A13NE 0 3 350357 Source: British Geological Survey, National Geoscience Information Service (S) 386188 Potential for Compressible Ground Stability Hazards Hazard Potential: No Hazard A12NE 237 3 350000 Source: British Geological Survey, National Geoscience Information Service (W) 386188 Potential for Ground Dissolution Stability Hazards No Hazard Potential for Landslide Ground Stability Hazards Hazard Potential: Very Low A13NE 0 3 350357 Source: British Geological Survey, National Geoscience Information Service (S) 386188 Potential for Landslide Ground Stability Hazards Hazard Potential: Very Low A12NE 237 3 350000 Source: British Geological Survey, National Geoscience Information Service (W) 386188 Potential for Running Sand Ground Stability Hazards Hazard Potential: Very Low A13NE 0 3 350357 Source: British Geological Survey, National Geoscience Information Service (S) 386188 Potential for Running Sand Ground Stability Hazards Hazard Potential: Very Low A12NE 237 3 350000 Source: British Geological Survey, National Geoscience Information Service (W) 386188 Potential for Shrinking or Swelling Clay Ground Stability Hazards Hazard Potential: Very Low A13NE 0 3 350357 Source: British Geological Survey, National Geoscience Information Service (S) 386188 Potential for Shrinking or Swelling Clay Ground Stability Hazards Hazard Potential: Very Low A12NE 237 3 350000 Source: British Geological Survey, National Geoscience Information Service (W) 386188 Radon Potential - Radon Protection Measures Protection Measure: No radon protective measures are necessary in the construction of new A13NE 0 3 350357 dwellings or extensions (S) 386188 Source: British Geological Survey, National Geoscience Information Service Radon Potential - Radon Affected Areas Affected Area: The property is in an intermediate probability radon area, as between 1 and A13NE 0 3 350357 3% of homes are above the action level (S) 386188 Source: British Geological Survey, National Geoscience Information Service

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 14 of 26 Industrial Land Use

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Contemporary Trade Directory Entries 22 Name: Widness Motor Co Ltd A13NW 30 - 350273 Location: 131, Liverpool Road, Widnes, Cheshire, WA8 7EZ (NW) 386291 Classification: Mot Testing Centres Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 23 Name: Maid 2 Iron A13NW 104 - 350198 Location: 134c Liverpool Rd, Widnes, Cheshire, WA8 7EZ (NW) 386344 Classification: Ironing & Home Laundry Services Status: Active Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 24 Name: Filterite Finishing Services A13NW 168 - 350112 Location: 160, Liverpool Road, Widnes, Cheshire, WA8 7JB (NW) 386347 Classification: Paint Spraying Equipment & Accessories Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 25 Name: Rapid Clean (Uk) Ltd A13SE 191 - 350505 Location: 50, Foxley Heath, Widnes, Cheshire, WA8 7EJ (SE) 385911 Classification: Commercial Cleaning Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 26 Name: George Grace & Co Ltd A13NW 259 - 350197 Location: 8, Looe Close, Widnes, Cheshire, WA8 7NW (NW) 386514 Classification: Engineers - General Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 27 Name: Abbey Cleaning Services A8NE 271 - 350505 Location: 10, Keats Close, Widnes, Cheshire, WA8 7EX (S) 385828 Classification: Cleaning Services - Commercial Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 28 Name: Ness Visual Technology A12NE 346 - 349957 Location: Kershaw Street, Widnes, Cheshire, WA8 7JH (NW) 386436 Classification: Photographic Processors Status: Inactive Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 29 Name: J & S A14SW 420 - 350870 Location: 139, Lower House Lane, Widnes, Cheshire, WA8 7DU (E) 386074 Classification: Scrap Metal Merchants Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 30 Name: Teasdale Bookbinders A17SE 486 - 349869 Location: 103, Heath Road, Widnes, Cheshire, WA8 7NU (NW) 386553 Classification: Bookbinders Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 31 Name: Glynn Andrews Car Sales Ltd A12NE 512 - 349732 Location: 231, Liverpool Road, Widnes, Cheshire, WA8 7HL (W) 386239 Classification: Car Dealers - Used Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 32 Name: Halton Refrigeration A18SW 534 - 350096 Location: 83, Lynton Crescent, Widnes, Cheshire, WA8 7NT (NW) 386771 Classification: Air Conditioning & Refrigeration Contractors Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 33 Name: Dust-Eee A14NW 534 - 351005 Location: 115, Leigh Avenue, Widnes, Cheshire, WA8 7EP (E) 386203 Classification: Cleaning Services - Domestic Status: Active Positional Accuracy: Automatically positioned to the address

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 15 of 26 Industrial Land Use

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Contemporary Trade Directory Entries 34 Name: Dampline Direct Ltd A14NW 553 - 351011 Location: 18, Addison Square, Widnes, Cheshire, WA8 7DF (E) 386365 Classification: Damp & Dry Rot Control Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 35 Name: Solution Transport A8NW 562 - 350126 Location: 4, Laleston Close, Widnes, Cheshire, WA8 8LG (S) 385599 Classification: Road Haulage Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 36 Name: Pm Heating & Plumbing A7NE 573 - 349920 Location: 10, Chilington Avenue, Widnes, Cheshire, WA8 8BP (SW) 385674 Classification: Boilers - Servicing, Replacements & Repairs Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 36 Name: Hammond & Mcnevin Plumbing & Heating Ltd A7NE 573 - 349920 Location: 10, Chilington Avenue, Widnes, Cheshire, WA8 8BP (SW) 385674 Classification: Boilers - Servicing, Replacements & Repairs Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 37 Name: Mantec Engineering Services Ltd A7NE 640 - 349681 Location: 63, Hale Road, Widnes, Cheshire, WA8 8DQ (SW) 385834 Classification: Engineers - General Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 38 Name: Highfield Print Services A14NE 685 - 351155 Location: 8, Shelley Road, Widnes, Cheshire, WA8 7DE (E) 386301 Classification: Printers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 39 Name: Curtain Wizard A18NW 801 - 350199 Location: 8, Limerick Close, Widnes, Cheshire, WA8 9SE (N) 387070 Classification: Tarpaulins Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 40 Name: Print Corp Solutions A18NE 905 - 350638 Location: 1, Cornforth Way, Widnes, Cheshire, WA8 9WB (N) 387134 Classification: Photocopiers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 41 Name: Intransit Distribution A18NE 910 - 350552 Location: 10, Wallsend Court, Widnes, Cheshire, WA8 9WE (N) 387162 Classification: Distribution Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 42 Name: Fleet Factors Ltd A8SE 914 - 350692 Location: Lower House Lane, Widnes, Cheshire, WA8 7AW (S) 385212 Classification: Commercial Vehicle Servicing, Repairs, Parts & Accessories Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 43 Name: Halton Dampcoursing Ltd A19SE 922 - 351297 Location: 61, Birchfield Road, Widnes, Cheshire, WA8 7TA (NE) 386652 Classification: Damp & Dry Rot Control Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 44 Name: Oakwood Services A15NW 968 - 351440 Location: 3 Wheat Close, Widnes, Cheshire, WA8 7JB (E) 386262 Classification: Domestic Appliances - Servicing, Repairs & Parts Status: Inactive Positional Accuracy: Manually positioned within the geographical locality

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 16 of 26 Industrial Land Use

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Contemporary Trade Directory Entries 45 Name: Kingsway Cleaning Centre A15SW 970 - 351409 Location: 49, Dickson Street, Widnes, Cheshire, WA8 6NX (E) 385964 Classification: Laundries & Launderettes Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 46 Name: Kumfy Kidz A19NW 978 - 350792 Location: 1, Westerhope Way, Widnes, Cheshire, WA8 9QA (NE) 387165 Classification: Children & Babywear - Manufacturers & Wholesalers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 47 Name: Westminster Fireplaces A9SW 985 - 350994 Location: 4, Moor Lane, Widnes, Cheshire, WA8 7AG (SE) 385278 Classification: Fireplaces & Mantelpieces Status: Inactive Positional Accuracy: Automatically positioned to the address

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 17 of 26 Sensitive Land Use

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Nitrate Vulnerable Zones 48 Name: Not Supplied A17SE 733 9 349718 Description: NVZ Area (NW) 386756 Source: Department for Environment, Food and Rural Affairs (DEFRA - formerly FRCA)

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 18 of 26 Data Currency

Agency & Hydrological Version Update Cycle

Contaminated Land Register Entries and Notices Knowsley Metropolitan Borough Council - Department of Planning and Development April 2013 Annual Rolling Update Warrington Borough Council - Environmental Health Department August 2013 Annually Liverpool City Council - Liverpool Environmental Health & Trading Standards Division February 2013 Annual Rolling Update St Helens Metropolitan Borough Council - Environmental Protection Department February 2013 Annual Rolling Update Halton Borough Council - Environmental Health Department January 2013 Annual Rolling Update Vale Royal Borough Council (now part of Cheshire West and Chester Council) - November 2008 Not Applicable Community Services Directorate Cheshire West and Chester Council - Environmental Health Department September 2012 Annually Discharge Consents Environment Agency - North West Region July 2013 Quarterly Enforcement and Prohibition Notices Environment Agency - North West Region March 2013 Quarterly Integrated Pollution Controls Environment Agency - North West Region October 2008 Not Applicable Integrated Pollution Prevention And Control Environment Agency - North West Region July 2013 Quarterly Local Authority Integrated Pollution Prevention And Control St Helens Metropolitan Borough Council - Environmental Health Department April 2013 Annual Rolling Update Cheshire West and Chester Council - Environmental Health Department August 2012 Annually Halton Borough Council - Environmental Health Department February 2013 Annual Rolling Update Vale Royal Borough Council (now part of Cheshire West and Chester Council) - June 2009 Not Applicable Environmental Health Department Knowsley Metropolitan Borough Council - Environmental Health and Consumer June 2013 Annual Rolling Update Protection Division Warrington Borough Council - Environmental Health Department September 2013 Annual Rolling Update Liverpool City Council - Liverpool Environmental Health & Trading Standards Division September 2013 Monthly Local Authority Pollution Prevention and Controls St Helens Metropolitan Borough Council - Environmental Health Department April 2013 Annual Rolling Update Cheshire West and Chester Council - Environmental Health Department August 2012 Annually Halton Borough Council - Environmental Health Department February 2013 Annual Rolling Update Vale Royal Borough Council (now part of Cheshire West and Chester Council) - June 2009 Not Applicable Environmental Health Department Knowsley Metropolitan Borough Council - Environmental Health and Consumer June 2013 Annual Rolling Update Protection Division Warrington Borough Council - Environmental Health Department September 2013 Annual Rolling Update Liverpool City Council - Liverpool Environmental Health & Trading Standards Division September 2013 Monthly Local Authority Pollution Prevention and Control Enforcements St Helens Metropolitan Borough Council - Environmental Health Department April 2013 Annual Rolling Update Cheshire West and Chester Council - Environmental Health Department August 2012 Annually Halton Borough Council - Environmental Health Department February 2013 Annual Rolling Update Vale Royal Borough Council (now part of Cheshire West and Chester Council) - June 2009 Not Applicable Environmental Health Department Knowsley Metropolitan Borough Council - Environmental Health and Consumer June 2013 Annual Rolling Update Protection Division Warrington Borough Council - Environmental Health Department September 2013 Annual Rolling Update Liverpool City Council - Liverpool Environmental Health & Trading Standards Division September 2013 Monthly Nearest Surface Water Feature Ordnance Survey July 2012 Quarterly Pollution Incidents to Controlled Waters Environment Agency - North West Region January 2000 Not Applicable Prosecutions Relating to Authorised Processes Environment Agency - North West Region March 2013 Quarterly Prosecutions Relating to Controlled Waters Environment Agency - North West Region March 2013 Quarterly

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 19 of 26 Data Currency

Agency & Hydrological Version Update Cycle

Registered Radioactive Substances Environment Agency - North West Region July 2013 Quarterly River Quality Environment Agency - Head Office November 2001 Not Applicable River Quality Biology Sampling Points Environment Agency - Head Office July 2012 Annually River Quality Chemistry Sampling Points Environment Agency - Head Office July 2012 Annually Substantiated Pollution Incident Register Environment Agency - North West Region - South Area July 2013 Quarterly Water Abstractions Environment Agency - North West Region July 2013 Quarterly Water Industry Act Referrals Environment Agency - North West Region July 2013 Quarterly Groundwater Vulnerability Environment Agency - Head Office January 2011 Not Applicable Drift Deposits Environment Agency - Head Office January 1999 Not Applicable Bedrock Aquifer Designations British Geological Survey - National Geoscience Information Service October 2012 Annually Superficial Aquifer Designations British Geological Survey - National Geoscience Information Service October 2012 Annually Source Protection Zones Environment Agency - Head Office July 2013 Quarterly Extreme Flooding from Rivers or Sea without Defences Environment Agency - Head Office August 2013 Quarterly Flooding from Rivers or Sea without Defences Environment Agency - Head Office August 2013 Quarterly Areas Benefiting from Flood Defences Environment Agency - Head Office August 2013 Quarterly Flood Water Storage Areas Environment Agency - Head Office August 2013 Quarterly Flood Defences Environment Agency - Head Office August 2013 Quarterly

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 20 of 26 Data Currency

Waste Version Update Cycle

BGS Recorded Landfill Sites British Geological Survey - National Geoscience Information Service June 1996 Not Applicable Historical Landfill Sites Environment Agency - North West Region - South Area July 2013 Quarterly Integrated Pollution Control Registered Waste Sites Environment Agency - North West Region October 2008 Not Applicable Licensed Waste Management Facilities (Landfill Boundaries) Environment Agency - North West Region - South Area July 2013 Quarterly Licensed Waste Management Facilities (Locations) Environment Agency - North West Region - South Area April 2013 Quarterly Local Authority Landfill Coverage Cheshire County Council (now part of Cheshire East Council) - Environmental Planning May 2000 Not Applicable Department Halton Borough Council - Environmental Health Department May 2000 Not Applicable Knowsley Metropolitan Borough Council May 2000 Not Applicable Liverpool City Council - Liverpool Environmental Health & Trading Standards Division May 2000 Not Applicable Merseyside Waste Disposal Authority May 2000 Not Applicable St Helens Metropolitan Borough Council May 2000 Not Applicable Vale Royal Borough Council (now part of Cheshire West and Chester Council) - May 2000 Not Applicable Environmental Health Department Warrington Borough Council - Environmental Health Department May 2000 Not Applicable Local Authority Recorded Landfill Sites Cheshire County Council (now part of Cheshire East Council) - Environmental Planning February 2005 Not Applicable Department Halton Borough Council - Environmental Health Department May 2000 Not Applicable Knowsley Metropolitan Borough Council May 2000 Not Applicable Liverpool City Council - Liverpool Environmental Health & Trading Standards Division May 2000 Not Applicable Merseyside Waste Disposal Authority May 2000 Not Applicable St Helens Metropolitan Borough Council May 2000 Not Applicable Vale Royal Borough Council (now part of Cheshire West and Chester Council) - May 2000 Not Applicable Environmental Health Department Warrington Borough Council - Environmental Health Department May 2000 Not Applicable Registered Landfill Sites Environment Agency - North West Region - South Area March 2003 Not Applicable Registered Waste Transfer Sites Environment Agency - North West Region - South Area March 2003 Not Applicable Registered Waste Treatment or Disposal Sites Environment Agency - North West Region - South Area March 2003 Not Applicable

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 21 of 26 Data Currency

Hazardous Substances Version Update Cycle

Control of Major Accident Hazards Sites (COMAH) Health and Safety Executive August 2013 Bi-Annually Explosive Sites Health and Safety Executive March 2013 Bi-Annually Notification of Installations Handling Hazardous Substances (NIHHS) Health and Safety Executive November 2000 Not Applicable Planning Hazardous Substance Enforcements Vale Royal Borough Council (now part of Cheshire West and Chester Council) August 2009 Not Applicable St Helens Metropolitan Borough Council August 2013 Annual Rolling Update Liverpool City Council December 2012 Annual Rolling Update Warrington Borough Council - Environmental and Regeneration January 2013 Annual Rolling Update Cheshire County Council (now part of Cheshire East Council) - Planning Department July 2008 Annual Rolling Update Halton Borough Council July 2012 Annual Rolling Update Knowsley Metropolitan Borough Council July 2013 Annual Rolling Update Cheshire West and Chester Council - Planning Department October 2012 Annually Planning Hazardous Substance Consents Vale Royal Borough Council (now part of Cheshire West and Chester Council) August 2009 Not Applicable St Helens Metropolitan Borough Council August 2013 Annual Rolling Update Liverpool City Council December 2012 Annual Rolling Update Warrington Borough Council - Environmental and Regeneration January 2013 Annual Rolling Update Cheshire County Council (now part of Cheshire East Council) - Planning Department July 2008 Annual Rolling Update Halton Borough Council July 2012 Annual Rolling Update Knowsley Metropolitan Borough Council July 2013 Annual Rolling Update Cheshire West and Chester Council - Planning Department October 2012 Annually

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 22 of 26 Data Currency

Geological Version Update Cycle

BGS 1:625,000 Solid Geology British Geological Survey - National Geoscience Information Service August 1996 Not Applicable BGS Estimated Soil Chemistry British Geological Survey - National Geoscience Information Service January 2010 Variable BGS Recorded Mineral Sites British Geological Survey - National Geoscience Information Service April 2013 Bi-Annually Brine Compensation Area Cheshire Brine Subsidence Compensation Board August 2011 Not Applicable Coal Mining Affected Areas The Coal Authority - Mining Report Service January 2012 As notified Mining Instability Ove Arup & Partners October 2000 Not Applicable Non Coal Mining Areas of Great Britain British Geological Survey - National Geoscience Information Service February 2011 Not Applicable Potential for Collapsible Ground Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Potential for Compressible Ground Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Potential for Ground Dissolution Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Potential for Landslide Ground Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Potential for Running Sand Ground Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Potential for Shrinking or Swelling Clay Ground Stability Hazards British Geological Survey - National Geoscience Information Service February 2011 Annually Radon Potential - Radon Affected Areas British Geological Survey - National Geoscience Information Service July 2011 As notified Radon Potential - Radon Protection Measures British Geological Survey - National Geoscience Information Service July 2011 As notified

Industrial Land Use Version Update Cycle

Contemporary Trade Directory Entries Thomson Directories May 2013 Quarterly Fuel Station Entries Catalist Ltd - Experian August 2013 Quarterly

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 23 of 26 Data Currency

Sensitive Land Use Version Update Cycle

Areas of Adopted Green Belt Halton Borough Council August 2013 As notified Knowsley Metropolitan Borough Council August 2013 As notified Liverpool City Council August 2013 As notified St Helens Metropolitan Borough Council August 2013 As notified Vale Royal Borough Council (now part of Cheshire West and Chester Council) August 2013 As notified Warrington Borough Council August 2013 As notified Areas of Unadopted Green Belt Halton Borough Council August 2013 As notified Knowsley Metropolitan Borough Council August 2013 As notified Liverpool City Council August 2013 As notified St Helens Metropolitan Borough Council August 2013 As notified Vale Royal Borough Council (now part of Cheshire West and Chester Council) August 2013 As notified Warrington Borough Council August 2013 As notified Areas of Outstanding Natural Beauty Natural England July 2013 Bi-Annually Environmentally Sensitive Areas Natural England July 2013 Annually Forest Parks Forestry Commission April 1997 Not Applicable Local Nature Reserves Natural England July 2013 Bi-Annually Marine Nature Reserves Natural England July 2013 Bi-Annually National Nature Reserves Natural England July 2013 Bi-Annually National Parks Natural England July 2013 Bi-Annually Nitrate Sensitive Areas Department for Environment, Food and Rural Affairs (DEFRA - formerly FRCA) February 2012 Not Applicable Nitrate Vulnerable Zones Department for Environment, Food and Rural Affairs (DEFRA - formerly FRCA) February 2013 Annually Ramsar Sites Natural England July 2013 Bi-Annually Sites of Special Scientific Interest Natural England July 2013 Bi-Annually Special Areas of Conservation Natural England July 2013 Bi-Annually Special Protection Areas Natural England July 2013 Bi-Annually

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 24 of 26 Data Suppliers

A selection of organisations who provide data within this report

Data Supplier Data Supplier Logo

Ordnance Survey

Environment Agency

Scottish Environment Protection Agency

The Coal Authority

British Geological Survey

Centre for Ecology and Hydrology

Countryside Council for Wales

Scottish Natural Heritage

Natural England

Health Protection Agency

Ove Arup

Peter Brett Associates

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 25 of 26 Useful Contacts

Contact Name and Address Contact Details

1 Halton Borough Council - Environmental Health Telephone: 0151 424 2061 Department Fax: 0151 471 7304 Website: www.halton.gov.uk Grosvenor House, Halton Lea, Runcorn, Cheshire, WA7 2GW

2 Environment Agency - National Customer Contact Telephone: 08708 506 506 Centre (NCCC) Email: [email protected] PO Box 544, Templeborough, Rotherham, S60 1BY

3 British Geological Survey - Enquiry Service Telephone: 0115 936 3143 Fax: 0115 936 3276 British Geological Survey, Kingsley Dunham Centre, Keyworth, Email: [email protected] Nottingham, Nottinghamshire, NG12 5GG Website: www.bgs.ac.uk

4 Landmark Information Group Limited Telephone: 0844 844 9952 Fax: 0844 844 9951 Imperium, Imperial Way, Reading, Berkshire, RG2 0TD Email: [email protected] Website: www.landmarkinfo.co.uk

5 The Coal Authority - Mining Report Service Telephone: 0845 7626848 Email: [email protected] 200 Lichfield Lane, Mansfield, Nottinghamshire, NG18 4RG

6 Knowsley Metropolitan Borough Council Telephone: 0151 489 6000 Fax: 0151 443 2298 Archway Road, Huyton, Liverpool, Merseyside, L36 9YU Website: www.knowsley.gov.uk

7 Halton Borough Council Telephone: 0151 424 2061 Fax: 0151 471 7302 Municipal Buildings, Kingsway, Widnes, Cheshire, WA8 7QF Website: www.halton.gov.uk

8 Natural England Telephone: 0845 600 3078 Fax: 01733 455103 Northminster House, Northminster Road, Peterborough, Cambridgeshire, Email: [email protected] PE1 1UA Website: www.naturalengland.org.uk

9 Department for Environment, Food and Rural Affairs Telephone: 0113 2613333 (DEFRA - formerly FRCA) Fax: 0113 230 0879 Government Buildings, Otley Road, Lawnswood, Leeds, West Yorkshire, LS16 5QT

- Health Protection Agency - Radon Survey, Centre for Telephone: 01235 822622 Radiation, Chemical and Environmental Hazards Fax: 01235 833891 Email: [email protected] Chilton, Didcot, Oxfordshire, OX11 0RQ Website: www.hpa.org.uk

- Landmark Information Group Limited Telephone: 0844 844 9952 Fax: 0844 844 9951 Imperium, Imperial Way, Reading, Berkshire, RG2 0TD Email: [email protected] Website: www.landmarkinfo.co.uk

Please note that the Environment Agency / SEPA have a charging policy in place for enquiries.

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 26 of 26 Groundwater Vulnerability

Site Sensitivity Context Map - Slice A

Order Details 2UGHU1XPEHU BB &XVWRPHU5HI /* 1DWLRQDO*ULG5HIHUHQFH  6OLFH $ 6LWH$UHD +D   6HDUFK%XIIHU P   Site Details /LYHUSRRO5RDG:LGQHV:$(<

7HO  )D[  :HE ZZZHQYLURFKHFNFRXN

$/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY6HS 3DJHRI Bedrock Aquifer Designation

Site Sensitivity Context Map - Slice A

Order Details 2UGHU1XPEHU BB &XVWRPHU5HI /* 1DWLRQDO*ULG5HIHUHQFH  6OLFH $ 6LWH$UHD +D   6HDUFK%XIIHU P   Site Details /LYHUSRRO5RDG:LGQHV:$(<

7HO  )D[  :HE ZZZHQYLURFKHFNFRXN

$/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY6HS 3DJHRI Superficial Aquifer Designation

Site Sensitivity Context Map - Slice A

Order Details 2UGHU1XPEHU BB &XVWRPHU5HI /* 1DWLRQDO*ULG5HIHUHQFH  6OLFH $ 6LWH$UHD +D   6HDUFK%XIIHU P   Site Details /LYHUSRRO5RDG:LGQHV:$(<

7HO  )D[  :HE ZZZHQYLURFKHFNFRXN

$/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY6HS 3DJHRI Source Protection Zones

Site Sensitivity Context Map - Slice A

Order Details 2UGHU1XPEHU BB &XVWRPHU5HI /* 1DWLRQDO*ULG5HIHUHQFH  6OLFH $ 6LWH$UHD +D   6HDUFK%XIIHU P   Site Details /LYHUSRRO5RDG:LGQHV:$(<

7HO  )D[  :HE ZZZHQYLURFKHFNFRXN

$/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY6HS 3DJHRI Sensitive Land Uses

Site Sensitivity Context Map - Slice A

Order Details 2UGHU1XPEHU BB &XVWRPHU5HI /* 1DWLRQDO*ULG5HIHUHQFH  6OLFH $ 6LWH$UHD +D   6HDUFK%XIIHU P   Site Details /LYHUSRRO5RDG:LGQHV:$(<

7HO  )D[  :HE ZZZHQYLURFKHFNFRXN

$/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY6HS 3DJHRI Site Sensitivity Map - Segment A13

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 1 of 1 Site Sensitivity Map - Slice A

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 1 of 3 Flood Map - Slice A

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 2 of 3 For Borehole information please refer to the Borehole .csv file which accompanied this slice.

A copy of the BGS Borehole Ordering Form is available to download from the Support section of www.envirocheck.co.uk.

Borehole Map - Slice A

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 3 of 3 Estimated Soil Chemistry Arsenic - Slice A

Order Details Order Details: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 1 of 5 Estimated Soil Chemistry Cadmium - Slice A

Order Details Order Details: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 2 of 5 Estimated Soil Chemistry Chromium - Slice A

Order Details Order Details: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 3 of 5 Estimated Soil Chemistry Lead - Slice A

Order Details Order Details: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 4 of 5 Estimated Soil Chemistry Nickel - Slice A

Order Details Order Details: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 5 of 5 Envirocheck ® Report: Historical Data Report Datasheet

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road Widnes WA8 7EY

Client Details: MR W Baldwin Sutcliffe Projects Ltd 18-20 Harrington Street Liverpool L2 9QA

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Contents

Report Section Page Number

Summary -

Historical Building Plans Information -

Historical Land Use Information 1

Historical Tanks and Energy Facilities -

Historical Map List 8

Useful Contacts and Further Information 10

Introduction

The Environment Act 1995 has made site sensitivity a key issue, as the legislation pays as much attention to the pathways by which contamination could spread, and to the vulnerable targets of contamination, as it does the potential sources of contamination. For this reason, Landmark's Site Sensitivity maps and Datasheet(s) place great emphasis on statutory data provided by the Environment Agency and the Scottish Environment Protection Agency; it also incorporates data from Natural England (and the Scottish and Welsh equivalents) and Local Authorities; and highlights hydrogeological features required by environmental and geotechnical consultants. It does not include any information concerning past uses of land. The datasheet is produced by querying the Landmark database to a distance defined by the client from a site boundary provided by the client.

In the attached datasheet the National Grid References (NGRs) are rounded to the nearest 10m in accordance with Landmark's agreements with a number of Data Suppliers.

Copyright Notice

© Landmark Information Group Limited2013. The Copyright on the information and data and its format as contained in this Envirocheck® Report ("Report") is the property of Landmark Information Group Limited ("Landmark") and several other Data Providers, including (but not limited to) Ordnance Survey, British Geological Survey, the Environment Agency and Natural England, and must not be reproduced in whole or in part by photocopying or any other method. The Report is supplied under Landmark's Terms and Conditions accepted by the Customer. A copy of Landmark's Terms and Conditions can be found with the Index Map for this report. Additional copies of the Report may be obtained from Landmark, subject to Landmark's charges in force from time to time. The Copyright, design rights and any other intellectual rights shall remain the exclusive property of Landmark and /or other Data providers, whose Copyright material has been included in this Report.

Report Version v47.0

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Summary

Page On Site 0 to 250m 251 to 500m 501 to 1000m Data Type Number Historical Building Plans Information

Areas Cleared Due To Enemy Action

Above Ground Fuel Tanks (100m) n/a n/a

Asbestos (100m) n/a n/a

Benzene/Benzole/Naphtha, Naphthalene/Kerosene (100m) n/a n/a

Electricity Generation (100m) n/a n/a

Electricity Sub-Stations (100m) n/a n/a

Gas Industry (100m) n/a n/a

Gas Storage (100m) n/a n/a

Gas Use (100m) n/a n/a

Oil Industry (100m) n/a n/a

Oil Storage (100m) n/a n/a

Oil Use (100m) n/a n/a

Paint based Oils (100m) n/a n/a

Paraffin (100m) n/a n/a

Petrol and Diesel Industry (100m) n/a n/a

Petrol and Diesel Storage (100m) n/a n/a

Petrol and Diesel Use (100m) n/a n/a

Potential Fuel Gas (100m) n/a n/a

Potential Fuel Oil (100m) n/a n/a

Potential Fuel Use (100m) n/a n/a

Potential Petrol and Diesel (100m) n/a n/a

Potential Tanks (100m) n/a n/a

Potentially Fuel-related Tanks (100m) n/a n/a

Underground Fuel Tanks (100m) n/a n/a Historical Land Use Information

Former Marshes

Historical Flood Liabilities

Potentially Contaminative Industrial Uses (Past Land Use) pg 1 1 3 19

Potentially Infilled Land (Non-Water) pg 2 1 1 1

Potentially Infilled Land (Water) pg 2 9 18 75

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Summary

Page On Site 0 to 250m 251 to 500m 501 to 1000m Data Type Number Historical Tanks and Energy Facilities

Electrical Sub Station Facilities (100m) n/a n/a

Electricity Industry Facilities (100m) n/a n/a

Gas Industry Facilities (100m) n/a n/a

Gas Monitoring Facilities (100m) n/a n/a

Miscellaneous Power Facilities (100m) n/a n/a

Oil Industry Facilities (100m) n/a n/a

Petroleum Storage Facilities (100m) n/a n/a

Potential Tanks (100m) n/a n/a

Tanks (100m) n/a n/a

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Contaminative Industrial Uses (Past Land Use) 1 Use: Clay bricks & tiles [manufacture] A13SW 186 1 350051 Date of Mapping: 1894 (W) 386144 Potentially Contaminative Industrial Uses (Past Land Use) 2 Use: Factory or works - use not specified A12NE 408 1 349927 Date of Mapping: 1990 (NW) 386501 Potentially Contaminative Industrial Uses (Past Land Use) 3 Use: Railways A12SE 418 1 349825 Date of Mapping: 1894 - 1955 (W) 386082 Potentially Contaminative Industrial Uses (Past Land Use) 4 Use: Clay bricks & tiles [manufacture] A9NW 498 1 350776 Date of Mapping: 1928 (SE) 385727 Potentially Contaminative Industrial Uses (Past Land Use) 5 Use: Railways A18NW 598 1 350196 Date of Mapping: 1894 - 1990 (N) 386863 Potentially Contaminative Industrial Uses (Past Land Use) 6 Use: Railways A8SE 684 1 350473 Date of Mapping: 1908 (S) 385405 Potentially Contaminative Industrial Uses (Past Land Use) 7 Use: Railways A18NE 698 1 350542 Date of Mapping: 1894 - 1987 (N) 386945 Potentially Contaminative Industrial Uses (Past Land Use) 8 Use: Railways A8SE 701 1 350450 Date of Mapping: 1896 (S) 385387 Potentially Contaminative Industrial Uses (Past Land Use) 9 Use: Railways A8SE 719 1 350416 Date of Mapping: 1896 (S) 385369 Potentially Contaminative Industrial Uses (Past Land Use) 10 Use: Hospitals A19SE 739 1 351139 Date of Mapping: 1987 (NE) 386558 Potentially Contaminative Industrial Uses (Past Land Use) 11 Use: Railways A8SW 768 1 350230 Date of Mapping: 1896 (S) 385348 Potentially Contaminative Industrial Uses (Past Land Use) 12 Use: Quarrying of sand & clay, operation of sand & gravel pits A14SE 797 1 351219 Date of Mapping: 1849 (E) 385930 Potentially Contaminative Industrial Uses (Past Land Use) 13 Use: Railways A7SE 805 1 350003 Date of Mapping: 1895 - 1954 (SW) 385381 Potentially Contaminative Industrial Uses (Past Land Use) 14 Use: Road haulage A9SW 877 1 350710 Date of Mapping: 1928 (S) 385256 Potentially Contaminative Industrial Uses (Past Land Use) 15 Use: Road haulage A9SW 891 1 350696 Date of Mapping: 1956 (S) 385237 Potentially Contaminative Industrial Uses (Past Land Use) 16 Use: Railways A8SW 906 1 350251 Date of Mapping: 1896 - 1954 (S) 385201 Potentially Contaminative Industrial Uses (Past Land Use) 17 Use: Heap, unknown constituents A8SW 917 1 350209 Date of Mapping: 1987 (S) 385196 Potentially Contaminative Industrial Uses (Past Land Use) 18 Use: Factory or works - use not specified A15NW 937 1 351400 Date of Mapping: 1987 (E) 386373 Potentially Contaminative Industrial Uses (Past Land Use) 19 Use: Road haulage A9SW 969 1 350998 Date of Mapping: 1987 (SE) 385300 Potentially Contaminative Industrial Uses (Past Land Use) 20 Use: Road haulage A9SW 978 1 350986 Date of Mapping: 1956 (SE) 385282 Potentially Contaminative Industrial Uses (Past Land Use) 21 Use: Railways A3NE 993 1 350536 Date of Mapping: 1896 - 1954 (S) 385100

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 1 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Contaminative Industrial Uses (Past Land Use) 22 Use: Heap, unknown constituents A7SE 998 1 349728 Date of Mapping: 1928 (SW) 385292 Potentially Contaminative Industrial Uses (Past Land Use) 23 Use: Factory or works - use not specified A9SW 998 1 350915 Date of Mapping: 1987 (SE) 385214 Potentially Infilled Land (Non-Water) 24 Use: Unknown Filled Ground (Pit, quarry etc) A13SW 186 1 350051 Date of Mapping: 1987 (W) 386144 Potentially Infilled Land (Non-Water) 25 Use: Unknown Filled Ground (Pit, quarry etc) A9NW 498 1 350776 Date of Mapping: 1987 (SE) 385727 Potentially Infilled Land (Non-Water) 26 Use: Unknown Filled Ground (Pit, quarry etc) A14SE 797 1 351219 Date of Mapping: 1987 (E) 385930 Potentially Infilled Land (Water) 27 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NW 4 1 350242 Date of Mapping: 1956 (W) 386224 Potentially Infilled Land (Water) 28 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 85 1 350375 Date of Mapping: 1894 (S) 386019 Potentially Infilled Land (Water) 29 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 88 1 350505 Date of Mapping: 1849 (NE) 386321 Potentially Infilled Land (Water) 30 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 94 1 350200 Date of Mapping: 1928 (SW) 386064 Potentially Infilled Land (Water) 31 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 105 1 350293 Date of Mapping: 1928 (S) 386029 Potentially Infilled Land (Water) 32 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NW 149 1 350346 Date of Mapping: 1956 (N) 386428 Potentially Infilled Land (Water) 33 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 162 1 350539 Date of Mapping: 1956 (SE) 385966 Potentially Infilled Land (Water) 34 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 212 1 350611 Date of Mapping: 1956 (NE) 386401 Potentially Infilled Land (Water) 35 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NW 227 1 350191 Date of Mapping: 1928 (NW) 386478 Potentially Infilled Land (Water) 36 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 300 1 350098 Date of Mapping: 1849 (SW) 385885 Potentially Infilled Land (Water) 37 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 317 1 350431 Date of Mapping: 1849 (S) 385771 Potentially Infilled Land (Water) 38 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 331 1 350458 Date of Mapping: 1849 (S) 385758 Potentially Infilled Land (Water) 39 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NW 337 1 350805 Date of Mapping: 1908 (E) 386184 Potentially Infilled Land (Water) 40 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 369 1 350111 Date of Mapping: 1849 (SW) 385804 Potentially Infilled Land (Water) 41 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18SE 371 1 350373 Date of Mapping: 1956 (N) 386648 Potentially Infilled Land (Water) 42 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 402 1 350108 Date of Mapping: 1908 (SW) 385770

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 2 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Infilled Land (Water) 43 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SW 404 1 350777 Date of Mapping: 1928 (SE) 385875 Potentially Infilled Land (Water) 44 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 421 1 350328 Date of Mapping: 1928 (S) 385681 Potentially Infilled Land (Water) 45 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NW 444 1 350860 Date of Mapping: 1849 (NE) 386457 Potentially Infilled Land (Water) 46 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SW 447 1 350913 Date of Mapping: 1849 (E) 386154 Potentially Infilled Land (Water) 47 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 461 1 350080 Date of Mapping: 1928 (SW) 385717 Potentially Infilled Land (Water) 48 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NW 466 1 350815 Date of Mapping: 1928 (SE) 385821 Potentially Infilled Land (Water) 49 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18SW 481 1 350278 Date of Mapping: 1894 (N) 386759 Potentially Infilled Land (Water) 50 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 481 1 349758 Date of Mapping: 1928 (W) 386189 Potentially Infilled Land (Water) 51 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 483 1 350630 Date of Mapping: 1895 (SE) 385648 Potentially Infilled Land (Water) 52 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 493 1 350244 Date of Mapping: 1849 (S) 385632 Potentially Infilled Land (Water) 53 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 494 1 350118 Date of Mapping: 1955 (SW) 385670 Potentially Infilled Land (Water) 54 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 503 1 350281 Date of Mapping: 1849 (S) 385609 Potentially Infilled Land (Water) 55 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 535 1 350435 Date of Mapping: 1849 (S) 385554 Potentially Infilled Land (Water) 56 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 552 1 350502 Date of Mapping: 1956 (S) 385541 Potentially Infilled Land (Water) 57 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SW 553 1 351007 Date of Mapping: 1928 (E) 386074 Potentially Infilled Land (Water) 58 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 553 1 349705 Date of Mapping: 1849 (W) 386348 Potentially Infilled Land (Water) 59 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 559 1 350866 Date of Mapping: 1956 (NE) 386636 Potentially Infilled Land (Water) 60 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NW 567 1 350717 Date of Mapping: 1908 (SE) 385598 Potentially Infilled Land (Water) 61 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 586 1 349673 Date of Mapping: 1908 (W) 385992 Potentially Infilled Land (Water) 62 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NW 589 1 350912 Date of Mapping: 1908 (SE) 385746 Potentially Infilled Land (Water) 63 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NE 591 1 350015 Date of Mapping: 1849 (SW) 385603

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 3 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Infilled Land (Water) 64 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 595 1 351067 Date of Mapping: 1894 (E) 386247 Potentially Infilled Land (Water) 65 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SE 605 1 349878 Date of Mapping: 1955 (NW) 386729 Potentially Infilled Land (Water) 66 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18SE 607 1 350640 Date of Mapping: 1956 (NE) 386823 Potentially Infilled Land (Water) 67 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NW 616 1 350761 Date of Mapping: 1849 (SE) 385567 Potentially Infilled Land (Water) 68 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 616 1 349677 Date of Mapping: 1955 (NW) 386478 Potentially Infilled Land (Water) 69 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 629 1 349608 Date of Mapping: 1955 (W) 386131 Potentially Infilled Land (Water) 70 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 629 1 350169 Date of Mapping: 1956 (S) 385516 Potentially Infilled Land (Water) 71 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 636 1 349624 Date of Mapping: 1955 (W) 386365 Potentially Infilled Land (Water) 72 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SE 637 1 351096 Date of Mapping: 1908 (E) 386093 Potentially Infilled Land (Water) 73 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 658 1 351033 Date of Mapping: 1849 (SE) 385818 Potentially Infilled Land (Water) 74 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SW 665 1 350705 Date of Mapping: 1849 (SE) 385482 Potentially Infilled Land (Water) 75 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 665 1 349574 Date of Mapping: 1849 (W) 386110 Potentially Infilled Land (Water) 76 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SE 669 1 351125 Date of Mapping: 1849 (E) 386070 Potentially Infilled Land (Water) 77 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 670 1 349581 Date of Mapping: 1955 (W) 386302 Potentially Infilled Land (Water) 78 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 682 1 349564 Date of Mapping: 1955 (W) 386259 Potentially Infilled Land (Water) 79 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SE 701 1 351143 Date of Mapping: 1894 (E) 386011 Potentially Infilled Land (Water) 80 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SE 707 1 349698 Date of Mapping: 1955 (NW) 386693 Potentially Infilled Land (Water) 81 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 710 1 351176 Date of Mapping: 1849 (E) 386332 Potentially Infilled Land (Water) 82 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 725 1 349554 Date of Mapping: 1849 (W) 386455 Potentially Infilled Land (Water) 83 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 732 1 349507 Date of Mapping: 1955 (W) 386100 Potentially Infilled Land (Water) 84 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SE 739 1 350017 Date of Mapping: 1908 (SW) 385445

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 4 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Infilled Land (Water) 85 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SW 745 1 350149 Date of Mapping: 1849 (S) 385399 Potentially Infilled Land (Water) 86 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SE 752 1 350581 Date of Mapping: 1908 (S) 385351 Potentially Infilled Land (Water) 87 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18NE 769 1 350617 Date of Mapping: 1849 (N) 386999 Potentially Infilled Land (Water) 88 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SE 776 1 349692 Date of Mapping: 1894 (NW) 386791 Potentially Infilled Land (Water) 89 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SE 778 1 350605 Date of Mapping: 1908 (S) 385329 Potentially Infilled Land (Water) 90 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 784 1 351063 Date of Mapping: 1928 (SE) 385623 Potentially Infilled Land (Water) 91 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 795 1 349515 Date of Mapping: 1955 (NW) 386553 Potentially Infilled Land (Water) 92 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 801 1 349503 Date of Mapping: 1955 (W) 386539 Potentially Infilled Land (Water) 93 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 808 1 349492 Date of Mapping: 1849 (W) 386532 Potentially Infilled Land (Water) 94 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SE 814 1 350579 Date of Mapping: 1908 (S) 385287 Potentially Infilled Land (Water) 95 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NW 815 1 349648 Date of Mapping: 1928 (SW) 385587 Potentially Infilled Land (Water) 96 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 825 1 351201 Date of Mapping: 1849 (SE) 385788 Potentially Infilled Land (Water) 97 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SE 835 1 350520 Date of Mapping: 1849 (S) 385258 Potentially Infilled Land (Water) 98 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 848 1 351198 Date of Mapping: 1928 (SE) 385722 Potentially Infilled Land (Water) 99 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 853 1 351199 Date of Mapping: 1908 (SE) 385713 Potentially Infilled Land (Water) 100 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 853 1 349422 Date of Mapping: 1849 (W) 386459 Potentially Infilled Land (Water) 101 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SW 868 1 350999 Date of Mapping: 1895 (SE) 385431 Potentially Infilled Land (Water) 102 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19NW 874 1 350935 Date of Mapping: 1928 (NE) 386981 Potentially Infilled Land (Water) 103 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 892 1 349547 Date of Mapping: 1955 (NW) 386802 Potentially Infilled Land (Water) 104 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NE 900 1 351281 Date of Mapping: 1849 (SE) 385786 Potentially Infilled Land (Water) 105 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NW 903 1 349442 Date of Mapping: 1928 (SW) 385723

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 5 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Infilled Land (Water) 106 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SE 904 1 351120 Date of Mapping: 1895 (SE) 385500 Potentially Infilled Land (Water) 107 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SE 909 1 349709 Date of Mapping: 1955 (SW) 385411 Potentially Infilled Land (Water) 108 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A15NW 911 1 351383 Date of Mapping: 1849 (E) 386274 Potentially Infilled Land (Water) 109 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SE 912 1 349801 Date of Mapping: 1955 (SW) 385349 Potentially Infilled Land (Water) 110 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SE 915 1 351078 Date of Mapping: 1895 (SE) 385439 Potentially Infilled Land (Water) 111 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19NW 920 1 350818 Date of Mapping: 1956 (NE) 387093 Potentially Infilled Land (Water) 112 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A11SE 920 1 349323 Date of Mapping: 1955 (W) 386046 Potentially Infilled Land (Water) 113 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 921 1 351231 Date of Mapping: 1894 (NE) 386763 Potentially Infilled Land (Water) 114 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 924 1 351202 Date of Mapping: 1849 (NE) 386806 Potentially Infilled Land (Water) 115 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SW 926 1 350233 Date of Mapping: 1954 (S) 385184 Potentially Infilled Land (Water) 116 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SE 939 1 349829 Date of Mapping: 1955 (SW) 385305 Potentially Infilled Land (Water) 117 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A15NW 953 1 351395 Date of Mapping: 1849 (E) 386480 Potentially Infilled Land (Water) 118 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SE 955 1 351122 Date of Mapping: 1895 (SE) 385427 Potentially Infilled Land (Water) 119 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A3NE 958 1 350401 Date of Mapping: 1956 (S) 385131 Potentially Infilled Land (Water) 120 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 960 1 349376 Date of Mapping: 1849 (NW) 386649 Potentially Infilled Land (Water) 121 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NW 962 1 349419 Date of Mapping: 1849 (SW) 385644 Potentially Infilled Land (Water) 122 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A3NE 973 1 350449 Date of Mapping: 1954 (S) 385115 Potentially Infilled Land (Water) 123 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SW 973 1 349523 Date of Mapping: 1908 (SW) 385489 Potentially Infilled Land (Water) 124 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A3NE 981 1 350454 Date of Mapping: 1954 (S) 385108 Potentially Infilled Land (Water) 125 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SW 990 1 349640 Date of Mapping: 1955 (SW) 385361 Potentially Infilled Land (Water) 126 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A6NE 996 1 349303 Date of Mapping: 1955 (W) 385806

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 6 of 10 Historical Land Use Information

Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site

Potentially Infilled Land (Water) 127 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SE 997 1 351205 Date of Mapping: 1895 (SE) 385457 Potentially Infilled Land (Water) 128 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A11SE 997 1 349268 Date of Mapping: 1849 (W) 385915

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 7 of 10 Historical Map List

No Historical Building Plans information available.

The following mapping has been analysed for Historical Land Use Information:

1:10,560 Mapsheet Published Date Lancashire And Furness 114_00 1849 Lancashire And Furness 115_00 1849 Cheshire 015_00 1881 Lancashire And Furness 114_NE 1894 Lancashire And Furness 115_NW 1894 Lancashire And Furness 115_SW 1895 Lancashire And Furness 114_SE 1896 Cheshire 015_SE 1899 Cheshire 015_SW 1899 Lancashire And Furness 114_NE 1908 Lancashire And Furness 114_SE 1908 Lancashire And Furness 115_NW 1908 Lancashire And Furness 115_SW 1908 Cheshire 015_SE 1911 Cheshire 015_SW 1911 Lancashire And Furness 114_NE 1928 Lancashire And Furness 114_SE 1928 Lancashire And Furness 115_NW 1928 Lancashire And Furness 115_SW 1928 Cheshire 015_SE 1938 Cheshire 015_SW 1938 Ordnance Survey Plan SJ48SE 1954 Ordnance Survey Plan SJ58SW 1954 Ordnance Survey Plan SJ48NE 1955 Ordnance Survey Plan SJ58NW 1956 1:10,000 Mapsheet Published Date Ordnance Survey Plan SJ48SE 1984 Ordnance Survey Plan SJ58NW 1987 Ordnance Survey Plan SJ48NE 1990 Ordnance Survey Plan SJ58SW 1994

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 8 of 10 Historical Map List

The following mapping has been analysed for Historical Tanks and Energy Facilities:

1:2,500 Mapsheet Published Date Ordnance Survey Plan SJ5085 1958 Ordnance Survey Plan SJ5086 1958 Ordnance Survey Plan SJ5085 1969 1:1,250 Mapsheet Published Date Ordnance Survey Plan SJ5086NE 1957 Ordnance Survey Plan SJ5086NW 1957 Ordnance Survey Plan SJ5086SE 1957 Ordnance Survey Plan SJ5086SW 1957 Ordnance Survey Plan SJ5085NE 1958 Ordnance Survey Plan SJ5085NW 1958 Ordnance Survey Plan SJ5086NW 1966 Ordnance Survey Plan SJ5085NW 1972 Ordnance Survey Plan SJ5086SE 1972 Ordnance Survey Plan SJ5086NE 1973 Ordnance Survey Plan SJ5086SW 1973

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 9 of 10 Useful Contacts and Further Information

Contact Name and Address Contact Details

1 Landmark Information Group Limited Telephone: 0844 844 9952 Fax: 0844 844 9951 Imperium, Imperial Way, Reading, Berkshire, RG2 0TD Email: [email protected] Website: www.landmarkinfo.co.uk

Historical Building Plans Information

This data set contains potentially contaminative features such as asbestos, petrol, oil and tanks captured from Historical Building Plans. The Historical Building Plans were produced by the London-based firm Charles E. Goad Ltd. as fire insurance plans, dating back to 1885. The firm ceased production of fire insurance plans in 1970. Most of the important towns and cities of the British Isles are covered. Historical Building Plans are usually at the scales of 1:480 (1 inch to 40 feet) for the British Isles. They were updated every 5-6 years by means of revision sheets designed to be pasted on to the original plans.

It should be noted that Historical Building Plans are only available for certain major towns and cities and in some cases there may only be partial coverage of the search area. It cannot therefore be assumed that the absence of responses under the Historical Building Plans section of this report indicates that no hazards exist. Please check the Historical Building Plans Map List table in the Historical Map List section of this report to establish if Historical Building Plans are available for this search area.

Historical Land Use Information

Landmark's Historical Land Use Data is the result of combined analysis of historical map data captured at 1:10,560 and 1:10,000. A unique comprehensive database of Historic Land Use from the 1840's to 1996 it includes 67 different types of potentially contaminated past industrial land use. This entailed analysing over 60,000 maps and is drawn from at least four, and up to six historical map editions. In addition a seventh layer was also created, known as the land use layer, containing areas of infilled land which are plotted via comparison between two or more map editions.

Historical Tanks and Energy Facilities

In addition to HLUD, additional analysis uncovered some of the most dangerous sources of contamination (past and present tanks, petrol storage, oil, gas, electricity, miscellaneous facilities). This data set covers over 390,000 Historical Tanks and Energy facilities in Great Britain and was captured from post war 1:2500 and 1:1250 Ordnance Survey historical mapping covering a period from 1943 to 1996.

Order Number: 49159151_1_1 Date: 13-Sep-2013 rpr_ec_datasheet v47.0 A Landmark Information Group Service Page 10 of 10 Historical Data Report - Segment A13

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Plot Buffer (m): 100 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 1 of 1 Historical Data Report - Slice Map A

Order Details Order Number: 49159151_1_1 Customer Ref: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

A Landmark Information Group Service v47.0 13-Sep-2013 Page 1 of 1 26859LG Widnes Recreational Ground, Widnes

$33(1',;( *(2/2*<5(3257

22 Geology 1:50,000 Maps Legends

Superficial Geology Geology 1:50,000 Maps Map Lex Code Rock Name Rock Type Min and Max Age This report contains geological map extracts taken from the BGS Digital Colour Geological map of Great Britain at 1:50,000 scale and is designed for users carrying out preliminary site assessments who require geological maps for TFD Tidal Flat Deposits Clay, Silt and Sand Holocene - the area around the site. This mapping may be more up to date than Holocene previously published paper maps. The various geological layers - artificial and landslip deposits, superficial TILLD Till, Devensian Diamicton Devensian - geology and solid (bedrock) geology are displayed in separate maps, but Devensian superimposed on the final 'Combined Surface Geology' map. All map SSA Shirdley Hill Sand Sand Flandrian - legends feature on this page. Not all layers have complete nationwide Formation Devensian coverage, so availability of data for relevant map sheets is indicated below. Geology 1:50,000 Maps Coverage Map ID: 1 Bedrock and Faults Map Sheet No: 097 Map Name: Runcorn Map Lex Code Rock Name Rock Type Min and Max Age Map Date: 1987 Bedrock Geology: Available Colour Superficial Geology: Available Artificial Geology: Not Available Faults: Available CPB Chester Pebble Beds Pebbly (Gravelly) Scythian - Scythian Landslip: Not Available Formation Sandstone Rock Segments: Available KNSF Kinnerton Sandstone Sandstone Scythian - Scythian Formation WLSF Wilmslow Sandstone Sandstone Scythian - Scythian Formation Faults

Geology 1:50,000 Maps - Slice A

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

v15.0 13-Sep-2013 Page 1 of 5 Artificial Ground and Landslip Artificial ground is a term used by BGS for those areas where the ground surface has been significantly modified by human activity. Information about previously developed ground is especially important, as it is often associated with potentially contaminated material, unpredictable engineering conditions and unstable ground.

Artificial ground includes:

- Made ground - man-made deposits such as embankments and spoil heaps on the natural ground surface. - Worked ground - areas where the ground has been cut away such as quarries and road cuttings. - Infilled ground - areas where the ground has been cut away then wholly or partially backfilled. - Landscaped ground - areas where the surface has been reshaped. - Disturbed ground - areas of ill-defined shallow or near surface mineral workings where it is impracticable to map made and worked ground separately.

Mass movement (landslip) deposits on BGS geological maps are primarily superficial deposits that have moved down slope under gravity to form landslips. These affect bedrock, other superficial deposits and artificial ground. The dataset also includes foundered strata, where the ground has collapsed due to subsidence.

Artificial Ground and Landslip Map - Slice A

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

v15.0 13-Sep-2013 Page 2 of 5 Superficial Geology Superficial Deposits are the youngest geological deposits formed during the most recent period of geological time, the Quaternary, which extends back about 1.8 million years from the present.

They rest on older deposits or rocks referred to as Bedrock. This dataset contains Superficial deposits that are of natural origin and 'in place'. Other superficial strata may be held in the Mass Movement dataset where they have been moved, or in the Artificial Ground dataset where they are of man-made origin.

Most of these Superficial deposits are unconsolidated sediments such as gravel, sand, silt and clay, and onshore they form relatively thin, often discontinuous patches or larger spreads.

Superficial Geology Map - Slice A

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

v15.0 13-Sep-2013 Page 3 of 5 Bedrock and Faults Bedrock geology is a term used for the main mass of rocks forming the Earth and are present everywhere, whether exposed at the surface in outcrops or concealed beneath superficial deposits or water.

The bedrock has formed over vast lengths of geological time ranging from ancient and highly altered rocks of the Proterozoic, some 2500 million years ago, or older, up to the relatively young Pliocene, 1.8 million years ago.

The bedrock geology includes many lithologies, often classified into three types based on origin: igneous, metamorphic and sedimentary.

The BGS Faults and Rock Segments dataset includes geological faults (e.g. normal, thrust), and thin beds mapped as lines (e.g. coal seam, gypsum bed). Some of these are linked to other particular 1:50,000 Geology datasets, for example, coal seams are part of the bedrock sequence, most faults and mineral veins primarily affect the bedrock but cut across the strata and post date its deposition.

Bedrock and Faults Map - Slice A

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

v15.0 13-Sep-2013 Page 4 of 5 Combined Surface Geology The Combined Surface Geology map combines all the previous maps into one combined geological overview of your site.

Please consult the legends to the previous maps to interpret the Combined "Surface Geology" map. Additional Information More information on 1:50,000 Geological mapping and explanations of rock classifications can be found on the BGS website. Using the LEX Codes in this report, further descriptions of rock types can be obtained by interrogating the 'BGS Lexicon of Named Rock Units'. This database can be accessed by following the 'Information and Data' link on the BGS website. Contact British Geological Survey Kingsley Dunham Centre Keyworth Nottingham NG12 5GG Telephone: 0115 936 3143 Fax: 0115 936 3276 email: [email protected] website: www.bgs.ac.uk

Combined Geology Map - Slice A

Order Details: Order Number: 49159151_1_1 Customer Reference: 26589LG National Grid Reference: 350360, 386190 Slice: A Site Area (Ha): 3.01 Search Buffer (m): 1000 Site Details: 99, Liverpool Road, Widnes, WA8 7EY

Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk

v15.0 13-Sep-2013 Page 5 of 5 26859LG Widnes Recreational Ground, Widnes

$33(1',;) 6(59,&(6  

23

8QLWHG8WLOLWHV:DWHU3/& Property Searches Ground Floor Grasmere House Lingley Mere Business Park 6XWFOLIIH3URMHFWV/WG Great Sankey (ODLQH+ROO\RDN Warrington  +DUULQJWRQ6WUHHW WA5 3LP /LYHUSRRO DX 715568 Warrington 0HUVH\VLGH Telephone7 0870 751 0101 /4$ Fax Number 0870 7510102 3URSHUW\VHDUFKHV#XXSOFFRXN

Your Ref: Our Ref: 13/ 967371 )$2 6+$/( Date: 28/09/2013

Dear Sirs

/RFDWLRQ :,'1(65(&5($7,21$/*5281'/,9(5322/52$':,'1(6:$(<

I acknowledge with thanks your request dated 24/09/13 for information on the location of our services.

Please find enclosed plans showing the approximate position of our apparatus known to be in the vicinity of this site. I attach General Condition Information sheets, which details contact numbers for additional services (i.e. new supplies, connections, diversions) which we are unable to deal with at this office. In addition you should ensure they are made available to anyone carrying out any works which may affect our apparatus. I trust the above meets with you requirements and look forward to hearing from you should you need anything further If you have any queries regarding this matter please telephone us on 0870 7510101.

Yours Faithfully,

Sue McManus Operations Manager Property Searches

88:DWHU3/& 8QLWHG8WLOLWLHV:DWHU3/& 5HJLVWHUHGLQ(QJODQG :DOHV1R 5HJLVWHUHG2IILFH+DZHVZDWHU+RXVH 7(506$1'&21',7,216:$67(5:$7(5 :$7(5',675,%87,213/$16/LQJOH\0HUH%XVLQHVV3DUN/LQJOH\*UHHQ $YHQXH These provisions apply to the public sewerage, water distribution and telemetry systems*UHDW 6DQNH\ (including :DUULQJWRQ :$ sewers /3 which are the subject of an agreement under Section 104 of the Water Industry Act 1991 and mains installed in accordance with the agreement for the self construction of water mains) (UUW apparatus) of United Utilities Water PLC (“UUW”).

7(506$1'&21',7,216 1. This Map and any information supplied with it is issued subject to the provisions contained below, to the exclusion of all others and no party relies upon any representation, warranty, collateral contract or other assurance of any person (whether party to this agreement or not) that is not set out in this agreement or the documents referred to in it.

2. This Map and any information supplied with it is provided for general guidance only and no representation, undertaking or warranty as to its accuracy, completeness or being up to date is given or implied.

3. In particular, the position and depth of any UUW apparatus shown on the Map are approximate only. UUW strongly recommends that a comprehensive survey is undertaken in addition to reviewing this Map to determine and ensure the precise location of any UUW apparatus. The exact location, positions and depths should be obtained by excavation trial holes.

4. The location and position of private drains, private sewers and service pipes to properties are not normally shown on this Map but their presence must be anticipated and accounted for and you are strongly advised to carry out your own further enquiries and investigations in order to locate the same.

5. The position and depth of UUW apparatus is subject to change and therefore this Map is issued subject to any removal or change in location of the same. The onus is entirely upon you to confirm whether any changes to the Map have been made subsequent to issue and prior to any works being carried out.

6. This Map and any information shown on it or provided with it must not be relied upon in the event of any development, construction or other works (including but not limited to any excavations) in the vicinity of UUW apparatus or for the purpose of determining the suitability of a point of connection to the sewerage or other distribution systems.

7. No person or legal entity, including any company shall be relieved from any liability howsoever and whensoever arising for any damage caused to UUW apparatus by reason of the actual position and/or depths of UUW apparatus being different from those shown on the Map and any information supplied with it.

8. If any provision contained herein is or becomes legally invalid or unenforceable, it will be taken to be severed from the remaining provisions which shall be unaffected and continue in full force and affect.

9. This agreement shall be governed by English law and all parties submit to the exclusive jurisdiction of the English courts, save that nothing will prevent UUW from bringing proceedings in any other competent jurisdiction, whether concurrently or otherwise.

Copyright © United Utilities Water PLC 2011-08-02 33 !( !( !( !(

/ / 1 !(

!(

/ 29

JUBILEE WAY / !( / !( /

7 !( / !( 18

13 !( HEATH ROAD

!( !( / Pond

!( A

19 110mm PE 2000

14 // // 14 !( † !(!(/ !( 1 K !(

/ !(/ // * / !(/ !( !( !( 63 mm!(!(!( PE!(!( 2000 12 !( !( / PLAC E!( !( / / /

/ / / /!( / / *

25 !( Pond !(

!( * / A !( 9 / !(

!( /

!( /

90mm PE 1997 !(/

2 / !(

!( / !( !( !( !( !( !( 6721 !( !( A !( !(

!(

158a

A 146 160

158 !( !( // / !(

/ //

90 mm PE 2000iA /

!( !( !( !( !( !(!( !( / 134 124 LB / A !( A

!(!( A !( !( 132 !(!(!( A

Wa rd !(Bdy!( / * 12" CI 1911 A !( 24.1m A A

A 6720 A !( !( A 130 !( !( !( / !( !( !( !( / * 194092 194095 !( ` / !(!( LIVERPOOL` ROAD``

/ !( 159 A

i / A 194094 * 167 (MORRISON) SITE MF JLIVERPOOL ROAD /

!( / 116

!( / !( /

!( 194093 151 !( !(

!( !( 155a / / /

/ !( 141 // !(!( / 15 7 A 15 5 15 3 / 22.6m 15 5 CF / 110 mm PE 2000 !( / !( 108

131 / !(

12" CI 1970 / !( Bowling Green

21.0m

* !( A

6" CI 1932

Ditton Primary School 6716

J A * i * A

7 CW 12" CI 1934 110 mm PE 2000

/!( Pavilion

J Club

8 17.4mA 4" DI 1972

R MROSE PRI Bowling Green

CLOSE / / FS 2 !( 4 !( / 1

/ / WIDNES !(/ !(/

Bowling Greens / Recreation Ground / 15 / !( J 42061 / !( 2 !(/ i!( / !( / !(/ /!( 14

/!( 63K mm PE 1996 !(

!( SPENSER CLOSE/ / 11 A 1 !( / !( !( / 15

/ !(

1 5

Chestnut Lodge Special School 63 mm PE 1996 16 TOFT CLOSE /

17 !( A / !( !(

!(/ / Drain 2 / 10

!(/ / !( /

!( /!( / !( !(/ /

/ !( !( / 2 !( MARLOWE!( CLOSE A / 63 mm PE 1995 23 Path /!( !(/ /

22 / !( HAZELWOO D P1 SITE

/ 1 1

!(

K !( 7 /

2 !( A / HOLKHAM FOXLEY HEATH / / !( / !( !(// !(!( CLOSE LYN N E 80720

80721 !( / / / 6 / Path !( 63 mm80723 PE 1998 / !(/

`!( 12 K !(

/ ` 25 !(

HAZELWOOD P2 PERSIMMON SITE COLERIDGE GROVE 20 71312 `!( / !( !( ` / 10 8 !(

!( 2 / / 16 ` 114511 / 30 !( !( / / !(/ 80722 ` COLERIDGE70400/ GROVE (!/

80724 71262

!(

!( !( / !(

` !( !( !( !( * / 38 ` 80725 ` !( A A / /!(

!( !( 9 /!( K!( 80328 / / ` 63 mm PE 1996

!( / J 1 /!(!( /

` 33 !( 26 !(

!( / 80716 / 34 21

K 18 !(/ 80326 !( !(/

` 35 80717 2O

` 80327 !(/ `!( !(

/ !( !( / 32 21 80718 FOXLEY HEATH SITE ` A

COLERIDGE63 mm GROVE PE 1998 28

!( 80719 !( !( * / ` / / !( 110 mm PV 1998 !( / / ` 1 !( 3 / !( /

!( / !( 41 / 80877!(

!(!( 21 !( !( / / / !( !( 80876 / `` !(

/ !( 31 / / 63 mm PE 1996 / 11 !( !( /!( !(

18 37 MILLINGTON !( 73 !(/ 15 CLOSE !(/ FOXLEY HEATH P2 SITE !(/ /

/ / 2 // !( !( !( Plot !( / 71 / 72 Sures tar t !( 42 / 70 / / Nursery !( / 69 K !( Path 63 mm PE 1998 / 12 68 / K !( !( Path 67 !( !( / / // !( 66 A / FOXLEY HEATH

!( / !(/ !( / 14 / / 66 !( / 45 64 !(/ !( 160 mm PV 1996 75 CAPESTHORNE/ CLOSE 1 !( 2 / !(

LEGEND Printed By : PH Date: 28/09/2013

Extract from Map Of Water Mains

Widnes Recreational Ground Liverpool Rd Widnes ABANDONED PIPE

The position of underground apparatus shown on this plan is approximate only and is given in accordance with the best information currently available. The actual positions may be different from those shown on the plan and private service pipes may be shown by a blue broken line. United Utilities will not accept any liability for any damage caused by the actual positions being different from those shown.

United Utilities 2001. The plan is based upon the Ordnance Survey Map with the sanction of the controller of H.M.Stationery Office. Crown and United Utilities copyrights are reserved. Unauthorised reproduction will infringe these copyrights. Polypropylene of ABANDONED PIPE ABANDONED U Unspecified 11 Date: 28/09/2013 Date: SJ5086SW DIPVC Ductile Iron Chloride Polyvinyl CISI Cast Iron ST Spun Iron VC Steel VitrifiedPP Clay PF PitchMAC Fibre Coursed Masonry, MAR Masonry, Random 27 Nodes Sheet LEGEND SEWER RECORDS TR Trapezoidal AR Arch BA Barrel HO HorseShoe UN Unspecified Scale: 1: 1250 1: Scale: OS SheetNo: Thisplan is Office. based upon H.M.Stationary theof Ordnance Controller Survey the of mapwithsanction the Unauthorised preserved. reproduction Copyright infringes copyright. Crown WASTE WATER SYMBOLOGY WATER WASTE Foul Surface Water Combined PSC Composite Plastic/Steel SEWER MATERIAL SEWER ACBR Asbestos Cement PE Brick RP Polyethylene ReinforcedCO Plastic Matrix Concrete Bolted CSB Segment Concrete Unbolted CSU Segment Concrete CC Concrete Box Culverted GRC Glass Reinforced Concrete GRP Glass Reinforced Plastic MANHOLE FUNCTION MANHOLE FO SW CO OV Overflow SEWER SHAPE CI CircularEG Egg OV Oval FT Flat Top RE Rectangular SQ Square Len gt h Grad

Len gt h Re fno Co ver Fu nc Inve rt Size.x Size.y Sha pe Ma tl Gra d Refno Cover Func Invert Size.x Shape Size.y Matl 01010201 22.33 CO0202 23.82 18.25 CO 22.86 3000203 225 24.15 CO CI 0204 CI 24.07 CO 0205 VC 0 VC 23.54 227.26 CO 0206 23.65 2218.29 CO 225 3000301 23.55 CO CI 0302 CI 24.3320.92 CO 14 2250303 VC VC 24.4 50.99 0401 CI 1 80.4 24.41 CO CO 18.91 0402 23.31 VC CO 225 1101 23.4 CI 6 CO CO 9 1201 5 VC 1302 0 23.08 23.09 CO 1402 23.91 150 CO 1403 23.53 CO 21.7 CI 0 1404 23.47 CO 225 1 VC 2301 23.35 34.06 CO CI 4001 23.1 VC CO 4002 20.45 17.18 69.87 SW 225 22 4003 15.63 16.29 FO CI 150 4201 16.33 SW VC CO CI 0403 142.4 3 CO 0404 19.68 1301 CO 675 19.16 33.43 CO 1401 9 225 CI CO CI CO 8.25 VC 2 58.05 0 4 ! 10 12 ! 4003 4002 T T

150 26 4201 T 4001 T ! Bowling Green

COLERIDG! E GROVE 20

FS 16

34

Cl ub

YNE LYNN HAZE LWOOD P2 PERSIMMON SITE PERSIMMON P2 LWOOD HAZE 4901 38 T

! Path 21.0m Pavilion

108 Drain Recreation Ground Recreation Pond

225 VC

11 6

22.6m 131 WIDNES

124

130

132 2 2301 T

LIVERPOOL ROAD

14 12 SJ5086SW !

18 14 141 1302 T

134 ! HEATH ROAD

30

19

9 29 W 1402 T Path !

38

Ward Bdy Ditton Primary School

Scale: 1: 1250 1: Scale: 28/09/2013 Date: CF

146

OS Sheet No:

33 151

W 15 3 1101

CW T 15 5 1201

T 150 VC 13 !

15 5 PRIMROSE CLOSE 158 !

5 a 155 1403

T

7

A 5 a 158 !

LB

160 15

8 15 7

LIVERPOOL ROAD 25

(MORRISON) SITE MF 1404 T 159 !

z 45 0402 T

225 VC Chestnut Lodge Special School ! ! 1 24.1m

167

7 1

0401 CO 675 Bowling Green T JUBILEE WAY JUBILEE 37

z 1 47 0101 T

0206 PLACE T

!

0302 T 2

!

0303 T

Ball Pathway Ball 0204 !

T 10

! 28 (PH)

! 174 ! PRINCES 0205

GREEN LANE T

2 1

9 The Ball Hotel 28 26

32

24

36 12

0301 T 2 !

177 57

1 16

300 VC 300

2 225 VC 225

181

6

188 38

7 1 1 2 0202

T

Plot Flat 1-8 Flat Plot PLOT !

7 12 8 1 to 8 to 1

2a 192

24 0203 0201

T PLACE T GLENN 10 Terrace Thomas St PH By: Printed

2 ! ! Polypropylene of ABANDONED PIPE ABANDONED U Unspecified 11 Date: 28/09/2013 Date: SJ5086SE DIPVC Ductile Iron Chloride Polyvinyl CISI Cast Iron ST Spun Iron VC Steel VitrifiedPP Clay PF PitchMAC Fibre Coursed Masonry, MAR Masonry, Random 89 Nodes Sheet LEGEND SEWER RECORDS TR Trapezoidal AR Arch BA Barrel HO HorseShoe UN Unspecified Scale: 1: 1250 1: Scale: OS SheetNo: Thisplan is Office. based upon H.M.Stationary theof Ordnance Controller Survey the of mapwithsanction the Unauthorised preserved. reproduction Copyright infringes copyright. Crown WASTE WATER SYMBOLOGY WATER WASTE Foul Surface Water Combined PSC Composite Plastic/Steel SEWER MATERIAL SEWER ACBR Asbestos Cement PE Brick RP Polyethylene ReinforcedCO Plastic Matrix Concrete Bolted CSB Segment Concrete Unbolted CSU Segment Concrete CC Concrete Box Culverted GRC Glass Reinforced Concrete GRP Glass Reinforced Plastic MANHOLE FUNCTION MANHOLE FO SW CO OV Overflow SEWER SHAPE CI CircularEG Egg OV Oval FT Flat Top RE Rectangular SQ Square Len gt h Grad

Len gt h Re fno Co ver Fu nc Inve rt Size.x Size.y Sha pe Ma tl Gra d 20.1 SW 18.57 150 CI VC 28.65 1 Refno Cover Func Invert Size.x Shape Size.y Matl 6111 SW 225 CI VC 40.06 7402 SW 8001 8002 168101 16.69 CO CO 8102 15.54 16.68 CO 2258201 17.61 15.49 CO 150 CI8202 18.21 CO 8203 CI 16.86 VC 18.26 18.03 CO 2258204 16.64 VC 19.1 31.06 CO 225 CI8205 19.22 CO SW 225 CI8401 VC 65.33 8402 1 VC 20.54 SW 15.59 900119.08 2 21.5 1509002 CO 17.2 20.47 CO 9201 CI 4 16.99 14.85 44.36 CO 225 225 9202 1 VC 19.55 CI CI 35.23 CO 9203 19.6 VC VC CO 16.01 9204 64.03 CO 17.27 890 CO 22 9301 300 630 2 9302 EG 20.8 CI 9401 CO 20.8 BR 3 17.15 VC CO 9402 39.46 22.61 CO 26.25 600 1 CO 9403 CI 8004 23.55 CO VC CO8005 70.21 15.09 3 1 CO 8103 150 14.9 CO 7403 225 CI 14.6 SW 8003 675 CI 900 VC 5 CO CI 18.03 CI VC 31.06 VC 54.08 95.98 1 2 5 7401 5001 5002 16.59 SW 5003 16.45 SW 5004 16.32 SW 5005 16.02 SW 5006 15.84 SW 5007 15.59 FO 5008 16.43 FO 5009 16.31 FO 5010 16.05 FO 5011 15.88 FO 5012 16.82 SW 15.42 1505013 16.73 SW CI 5014 16.66 FO 15.3 14.75015 16.09 FO 150 150 5101 16.09 SW CI 12.68 CI 5102 16.88 SW VC VC 5103 16.76 SW 33.68 34.65 5104 16.92 FO 0 5105 16.83 FO 5106 3 17.2 2 SW 5201 15.59 17.13 150 FO 6001 18.6215.05 CI CO FO 6002 150 16.74 150 VC FO 225 22.91 6003 CI CI FO 6004 CI VC VC 15.85 FO 23.02 6005 VC 91.41 FO 6006 1 FO 6007 SW 225 6008 1 SW CI 6009 6 SW VC 6010 18.92 SW 6011 SW 6012 SW 6101 6102 16.19 CO6103 15.73 SW 6105 15.73 013.87 SW 1500 6106 17.19 CI FO 225 6107 16.71 15.09 FO CO CI 1506108 16.69 11.05 SW 6109 CI VC 16.19 43.99 SW 611015.59 17.34 VC SW 225 FO 15.74 26.1 150 0 225 CI6201 CI 23 CI 6202 17.35 VC VC CO 37.12 28.06 CO 7001 VC 22.61 2 7102 15.04 CO7103 13.25 16.12 CO 300 2 7104 14.08 16.92 CO 225 1 7201 CI 16.19 CO 15.9 CO7202 CI VC 150 69.58 7203 16.15 SW VC 0 CI 88.57 CO7204 VCSW 7205 225 49.16 0 SW 7301 6 CI 7302 225 19.09 7 SW VC 37.06 7303 CO CI 3 CO 7304 VC 0 95.66 7305 18.61 SW CO 31 225 0 CI 62 VC 150 24.19 CI VC 21 22 13

!

1 38 7 11

89 68 10 66

128

! 9203 T

9204 T

225 VC 225 14 ! VC 225 9002

36 T

CLAYTON CR ESCENT ! 21

7

127

15 71 9403 T !

24 50 35 LEIGH AVE NUE AVENUE 9402 T

300 VC

!

10

Hollybank Court Hollybank 138 9 SQUI RES 9301 T

22.9m 1 to 4 to 1

8 !

HIGHFIELD ROAD HIGHFIELD 14 7

6

5 33 21.0m

2 TC B 45 137

9302 T 25 58 ! 9202 T 146 9001 T !

9401 132 T LB

!

! VC 600 3 4 11 8 9201

T 106 1a 15

19.5m 104

! 98

8204

T

13

6 5 BR 630 x 890

!

900 x 640 BR 640 x 900 8102

T z LOWER HO USE LANE USE HO LOWER

900 VC 900 225 VC

18.0m Court !

8 7 Cavendish BR 620 x 900

1 1 w

16.5m

2 155

145

2

137

225 VC 135 127

8203 225VC T !

The Bu ngalo w

1

6 50 1a 25 PH 8202

T 1b Widnes Golf Club ! 8402 8002 T T 8205

T

! ! Plot 1,2 Plot

8201 23 T !

! 1

2

3 8401

T 133 225 VC

11 145 ! z 7

FS VEN E E NU AV

8101 225 225 T

!

150 VC 150 5

150 VC 14 z

! WOODLAND 80

HOOD ROAD

3 7204 90 7401 T T 8001 7103 T T ! !

7304 7305

T T

! 4

! VC 150 !

38 121 7301 T

21 1

! 13

7203 T

15 52

150 VC 150 !

26 58

6 T A D'SSTE WAR AV E ENU

150 VC 150 60 7205

T 150 VC 150 300 VC 7001 17.1m T

! 70 ! 7102 T 7303 T !

7302

T

! 77

87

109 !

97 0 Issues 7104 Track T ! u 7202 T 7402 T

! 225 VC 225 ! 675 7201 T

LIVERPOOL ROAD LIVERPOOL 29

! osB ook Br Moss

Steward's Brook SJ5086SE

x Track 6101 T ! Sinks 6202 T RC Church St Raphael's ! Foot Bridge Foot Steward's Bridge Steward's

6102 1500 CO T Issues q ! Scale: 1: 1250 1: Scale: 28/09/2013 Date: ! 6103 T

11 OS Sheet No:

8 15 6201 T Sinks ! 6111 6009 T T 6003 6010 T T

6110 21 ! ! T 6008 T ! !

!

! 1 ! 225 VC S104 VC ! 225

1 2 CLOSE 6007 T 6004 T ! !

1 6011 T HOLK HA M 2O ! !

6001

T 6

TOF T C LOS E 6005 T 6012 6109 T T 17.4m

Pond 11 15 225 VC S104 23 18 ! ! 17 6108 ! T !

! 2

! 4 ! 5103 T 5002 T 5102 ! !

T 300 VC S104 ! ! ! ! 6105

T

! !

2 25 O E H ATH HE LEY FOX

5003 16 T 22 !

5101

5001 T

14 T

! 375 CO S104 CO 375 1 ! 33

150 VC ! S104 5105 5004 T T

2 !

SPENSER CLOSE ! 2

5013

T 5010 150 VC S104 VC 150 T 5201 5012 T T 5005 ! T !

! ! 30 ! !

MARLOWE CLOSE

1

5 150 1 ! 5011 T

Bowling Greens 10 2

300 VC S104

COLERIDG! E GROVE ! 7 5015 T 8

5014

T

9 HAZELWOOD P1 SITE P1 HAZELWOOD Printed By: PH By: Printed   7KHVHJHQHUDOFRQGLWLRQVDQGSUHFDXWLRQVDSSO\WR WKHZDWHUGLVWULEXWLRQV\VWHPRI8QLWHG8WLOLWLHV     3OHDVHHQVXUHWKDWDFRS\RIWKHVHFRQGLWLRQVLV (c) No explosive should be used within 32 metres of SDVVHGWR any United Utilities apparatus without prior \RXUUHSUHVHQWDWLYHDQGFRQWUDFWRURQVLWH consultation with United Utilities.  1. United Utilities provides approximate locations of (d) Where it is proposed to carry out piling within 15 its water mains or apparatus according to its records. metres of any water main United Utilities should be These records are not necessarily accurate or consulted so that the affected main may be surveyed. complete nor do they normally show the positions of private service pipes from the mains to properties. 4. During any excavation, it is important that Where service pipes are shown, a blue broken line measures should be taken to ensure continued indicates their approximate position. No person or support for any water main: company shall be relieved from liability for any damage caused by reason of the actual positions (a) Where excavation of trenches adjacent to any and/or depths being different from those indicated. water main is likely to affect its support, the main must be supported to the satisfaction of United 2. Special requirements relative to our apparatus Utilities. may be indicated. United Utilities employees will visit any site at reasonable notice to assist in the location (b) Where a trench is excavated crossing or parallel of its underground water apparatus and advise any to the line of a water main, the backfill should be precautions that may be required to obviate any adequately compacted to prevent any settlement damage. To arrange a visit or for further information which could subsequently cause damage to the regarding new supplies, connections, diversions, main. In special cases it may be necessary to provide costing, future proposals for construction of company permanent support to a main which has been apparatus or any notification required under these exposed over the length of the excavation before General Conditions, please telephone us on back-filling and reinstatement is carried out. No back- or write to United Utilities, PO Box filled concrete should contact the main. 453, Warrington, WA5 3QN. 5. No other apparatus should be laid over and along 3. In order to achieve safe working conditions the line of a water main irrespective of clearance. A adjacent to any water apparatus the following should minimum clearance of 450 millimetres should be be observed; allowed between any plant being installed and an existing main, to facilitate maintenance and repair, (a) All water apparatus should be located by hand whether the adjacent plant is parallel to or crossing digging prior to the use of mechanical excavation. the main. No manhole, chamber, or other obstruction should be built over or around a water main. (b) During construction work where heavy plant may have to cross the line of a water main, and the main 6. Where a water main is coated with special is not under a carriageway of adequate standard of wrapping and the wrapping is damaged, even to a construction, crossing points should be suitably minor extent, United Utilities must be notified, and the reinforced with sleepers, steel plates or a specially excavation must be left open for ready access so that constructed reinforced concrete raft as necessary. repairs can be made. In case of any material damage These crossing points should be clearly indicated to the main itself causing leakage, or weakening of and crossing the line of the water main at other the mechanical strength of the pipe, the person or places should be prevented. United Utilities body responsible should immediately notify United employees will advise on the type of reinforcement Utilities in order that the necessary remedial work necessary. This is particularly important on can be carried out. The full cost of the necessary agricultural or open land, where tilling or erosion may remedial work will be charged to the person or body have significantly reduced the original cover. responsible for the damage.

  7. If you propose to change existing levels over water 7UHHSODQWLQJUHVWULFWLRQVRYHUZDWHUPDLQV mains you will need to inform us. We will need  specific locations to be identified together with a) Poplar and willow trees have extensive root precise details as to the scale of the proposed systems and should not be planted within 10 metres changes to existing ground levels. Changes to of any water main. existing levels may require the diversion of our apparatus at your cost. However, in certain b) The following trees and those of a similar size, circumstances we may wish to leave our apparatus whether they are deciduous or evergreen, should not where it is. On these occasions you will usually be be be planted within six metres of any water main: required to protect our apparatus by means of a • Ash, beech, birch, elm, horse chestnut, lime, oak, concrete raft and either raise or lower any surface sycamore; boxes affected. • Apple trees and pear trees; • Most conifers. 8. Under no circumstances should our surface boxes be either buried or left in a situation where they are c) United Utilities requires access to the route of its raised above finished ground levels. You should re- mains at all times to inspect for leaks and carry out use and re-set any surface boxes affected by your surveys. works into the new surface so that they align over the We recommend that no shrubs or bushes which water apparatus below. You will be responsible for might obstruct or interfere with our access should be the cost of repairing any damage to our apparatus as planted within one metre of the centre line of any a result of your works. water main.

9. Where proposals involve resurfacing, you must d) There may be instances when both United Utilities notify United Utilities if your excavation will be greater and the landowner will wish to plant shrubs or bushes than 750mm in the highway and 300mm in a close to the water main for screening or other footpath, verge or other location. purposes. The following shallow rooting shrubs would be suitable for this purpose: 10. For information regarding easements, deeds, • Blackthorn, broom, cotoneaster, elder; grants, licences or wayleaves, please write to United • Hazel, laurel, privet, quickthorn, snowberry; Utilities Property Solutions, Coniston Buildings, • Most ornamental flowering shrubs. Lingley Mere Business Park, Lingley Green Avenue, Great Sankey, Warrington WA5 3UU e) In areas where soft fruit is grown, blackcurrant, (7HO). raspberries and gooseberries may be planted close to the main, provided that a path is left clear for inspection access and surveys. United Utilities can give additional advice where required in particular circumstances.                              

      3OHDVHHQVXUHWKDWDFRS\RIWKHVHFRQGLWLRQVLV 5. Where there is a public sewer along the line of a SDVVHGWR\RXUUHSUHVHQWDWLYHDQGFRQWUDFWRURQVLWH proposed development/building, arrangements shall be  made by the developer at his cost to divert the sewer 1. United Utilities provides the approximate locations of its around the development. Where this is not possible and as sewers according to its records. These records are not a last resort, a “Building Over Agreement” will need to be necessarily accurate or complete nor do they normally completed under section 18 of the Building Act 1984. The show the positions of every sewer culvert or drain, private developer shall design building foundations to ensure that connections from properties to the public sewers or the no additional loading is transferred to the sewer and submit particulars of any private system. No person or company such details both to the Local Authority’s Building Control shall be relieved from liability for any damage caused by Officer and to United Utilities for approval/acceptance. reason of the actual positions and/or depths being different United Utilities on a rechargeable basis would normally from those indicated. The records do indicate the position of undertake all aspects of design work associated with the the nearest known public sewer from which the likely length diversion of any part of the operational wastewater network. of private connections can be estimated together with the For further advice please call asset protection on  need for any off site drainage rights or easements.  2. Special requirements relative to our sewers may be indicated. United Utilities employees or its contractors will 6. Where there is a non-main river watercourse/culvert visit any site at reasonable notice to assist in the location of passing through the site, the landowner has the its underground sewers and advise any precautions that responsibility of a riparian owner for the watercourse/culvert may be required to obviate any damage. To arrange a visit and is responsible for the maintenance of the fabric of the or for further information regarding new supplies, culvert and for all works involved in maintaining the connections, diversions, costing, or any notification required unrestricted flow through it. Building over the under these General Conditions, please call us on  watercourse/culvert is not recommended. The developer . must contact the local authority before any works are carried out on the watercourse/culvert. Where it is 3. Where public sewers are within a site which is to be necessary to discharge surface water from the site into the developed and do not take any drainage from outside the watercourse/culvert the developer shall make an area, they are from an operational viewpoint redundant. assessment of the available capacity of the The developer must identify all redundant sewers affected watercourse/culvert (based on a 1 in 50 year event) and by the development and apply to United Utilities in writing ensure that the additional flow to be discharged into the for these sewers to be formally closed. The developer shall watercourse/culvert will not cause any flooding. In bear all related costs of the physical abandonment work. appropriate cases, flooding may be prevented by on-site storage. The developer shall submit the relevant details 4. Public sewers within the site that are still live outside the required to substantiate his development proposals. Details area will be subject to a “Restricted Building zone”. This of any outfall proposed shall also be submitted to the would normally be a surface area equivalent to the depth of Environment Agency, PO Box 12, Richard Fairclough the sewer measured from the centre line of the sewer on House, Knutsford Road, Warrington, Cheshire, WA4 1HT either side. No construction will be permitted within that for their approval. zone. The developer should also note that deep and wide rooted trees must not be planted in close proximity to live 7. Where there is a main river watercourse/culvert passing sewers. Access to public sewers must be maintained at all through the site, the developer shall submit all proposals times and no interference to manholes will be permitted affecting the river to the Environment Agency at the during construction work. address stated in paragraph 6 for approval/acceptance.     8. Your attention is drawn also to the following: &RPELQHGVHZHUVVKRZQFRORXUHGUHGcarries both surface water and foul sewage, especially in areas where ‡3ULYDWHGUDLQVRUVHZHUVZKLFKPD\EHZLWKLQWKHVLWH there is no separate surface water sewerage system. On 1 October 2011 all privately owned sewers and lateral drains which communicate with (that is drain to) an existing )RXOVHZHUVFRORXUHGEURZQmay also carry surface public sewer as at 1 July 2011 will become the water and there may be no separate surface water system responsibility of the sewerage undertaker. This includes indicated in the immediate area. Both combined and foul private sewers upstream of pumping stations that have yet sewers carry wastewater to our treatment works before it to transfer, but excludes lengths of sewer or drain that are can safely be returned to the environment. the subject of an on-going appeal or which have been excluded from transfer as a result of an appeal or which are 6XUIDFHZDWHUVHZHUVFRORXUHGEOXHon our drawings are on or under land opted-out by a Crown body. The transfer intended only to carry uncontaminated surface water (e.g. specifically excludes sewers and lateral drains owned by a rainfall from roofs, etc) and they usually discharge into local railway undertaker. Sewers upstream of such assets, watercourses. It is important for the protection of the however, are transferred. Such assets may not be environment and water quality that only uncontaminated recorded on the public sewer record currently as it was not surface water is connected to the surface water sewers. a requirement to keep records of previously private sewers Improper connections to surface water sewers from sink and drains. wastes, washing machines and other domestic use of water can cause significant pollution of watercourses. ‡$SSOLFDWLRQVWRPDNHFRQQHFWLRQVWRWKHSXEOLFVHZHU The developer must write to United Utilities requesting an 3XPSHGPDLQVULVLQJPDLQVDQGVOXGJHPDLQVwill all application form that must be duly completed and returned. be subject to pumping pressures and are neither suitable No works on the public sewer shall be carried out until a nor available for making new connections. letter of consent is received from United Utilities. +LJKZD\GUDLQVZKHQLQFOXGHGVKRZDVEOXHDQG • 6HZHUVIRUDGRSWLRQ EODFNGDVKHGOLQHVHighway drains are not assets If an agreement for the adoption of sewers under Section belonging to United Utilities and are the responsibility of 104 of the Water Industry Act 1991 is being contemplated, local authorities. a submission in accordance with “Sewers for Adoption”, Seventh Edition, published by the Water Research Centre 10. For information regarding future proposals for (2001) Plc, Henley Road, Medmenham, PO Box 16, construction of company apparatus please write to United Marlow, Buckinghamshire, SL7 2HD will be required, taking Utilities, PO Box 453, Warrington, WA5 3QN. into consideration any departures from the general guide stipulated by United Utilities. 11. For information regarding easements, deeds, grants or wayleaves please write to United Utilities Property ‡)XUWKHUFRQVXOWDWLRQZLWK8QLWHG8WLOLWLHV Solutions, Coniston Buildings, Lingley Mere Business Park, Developers wishing to seek advice or clarification regarding Lingley Green Avenue, Great Sankey, Warrington WA5 sewer record information provided should contact United 3UU (7HO). Utilities to arrange an appointment. A consultation fee may be charged, details of which will be made available at the time of making an appointment. Conditions and in

9. Combined sewers, foul sewers, surface water sewers, and pumped mains. These are shown separately in a range of colours or markings to distinguish them on our drawings, which are extracts from the statutory regional sewer map. A legend and key is provided on each extract for general use, although not all types of sewer will be shown on every extract.