BOLAN-1N..ACTInv .PRATO SPECTACULAR

8 PAGE COUNTRY EXTRA RANDY NEWM MICHAEL JACKSON hits the Top 10 with his solo single THE MISFIT'S "Got To BeThere". And there's an LP on the way from the12 -year -oldstarof the Jackson Five. 2 RECORD MIRROR, April 1, 1972 Write to VAL Record Mirror 7 Carnaby St., Mirrormai London WIV IPG Don't knock David ! Does the BBC ban of Wings' HAS Lorraine Willcock encouragement, - but he (March 11) never said she doesn't owe us anything. disliked or disagreed with JOANNE SLATER, something and then tried SUZZANNE HERBERT, 'Irish' raise the question of it? GL ENNIS GILLIAN PULLEN, MURCOTT, 56 Castle St., DAWN MARTIN, and Walsall WS8 7PY. SOPHIE CLARK, 63 Huntingfield Rd., Putney, ... David wore a s.W.15. jumper, denim trousers ... David pays us back andhisfurrybootson bybothering to sing for Nation Wide. And usandputting up with remember when David was unloyal fans like Lorraine. struggling to make a Never mind we stilllove Freedom career out of acting you David. - SUE nobodyhelped himdid CL A R K E and they? He helped himself ELIZABETH WAYand and made his name stand E L I Z A B ET H out-itis only recently RISEBOU RGH, The that his fans have (maybe) Roseberry Hotel, Sea Rd., givenhim a littlemore Felixstowe.

of your last issues ofRM. the vast potential hit - Trite I am also very glad that makers on the Continent. of Song? SURELY we are alltired RM have had the sense to ROSS DAVIES (DJ), of the trite nonsense that awardthisgreatgroup Brooklin,FitzroyStreet. WITH THE BBC alltoooftenfillsyour with a gold disc for their Hull. still refusing to play letters page. 'Bolan is hit single 'Co Co'. 'GiveIrelandBack rubbish' in one letter and To me they seem to be 'BolantheIncomparable' the most under -estimated SuperbootTo TheIrish'by group inthe next is an all too inBritain.Could I THINK Jonathan King is Wings, even though you please print the familiar format - and the righttosayfootballers ithasnow made same applies for any address and info about the will take the place of our the Top Twenty, I group or singer. Are none Sweet's fan club. - so-called superstars. Why? is time of your readers capable ofJEFFREY NIMMO, 208 Because the average thinkit an objective viewpoint? New City Rd., superstarmightbeseen thattheirmotives Cowcaddens, Glasgow C.4. Whether theyfinally once or twice on behind this ban deciU yeaornay is television,ifhehasa unimportant,the VAL: In factitwas the ,record in the charts, and were queried. judgements they make on public through buying if he does a tour of the They say they the way to that decision Sweet's 'Co Co'single country(inother words willnotplaythe are what makes for good who createdthemillion appearingat15-20big reading. Comeonthe seller, for which we were towns). and you're lucky record as itis a topresent a gold 'silentmajority'- of RM glad enoughtolive near you politicalstatement. readers - prove that youdisc, Jeff. The address for might see him. However, is their do think about the meritSweet's fanclubisclo But footballers can be any the of the music you listen toChristine Wood, 17 seen at least once a week attitude and don't allow such CromfordRd., - and instead of waiting lessof a political WINGS: a complete banby the BBC and the GPO ... in a 'free democratic country'. banalityto mar such an Wandsworth, S. W.18. forthe excitement of a statement? two years out there and 'Look Wot You Dundee' otherwise excellent paper. record getting to number Paul McCartney is! After a - BARRIE WOODCOCK, What the BBC are dismalchartratingwith earnt every penny we got. and 'Hey Girl Dorft Europop one, you can watch your reallysayingisthatthis I wonder if McCartney Rotherham'. STUART 17 Churchview Road, footballer waiting for him hislastsingle 'Back Seat Twickenham TW2 5BT. songiscontrarytothe Of My Car' he has now cansaythesame?- J. ASHBY, 68 The Drive, AFTER A dozen hitsin to score, and for the team view they think should be 24089357L/Cpl. Shoreham By Sea, Sussex. VAL: We always welcome Holland and many other towin. And most recorded a number which expressedandtherefore knew would be BARKER, ACC Attchd, letters that present a new, countriesaround the footballersnoware as he or at least well throught they will not play it. banned. The gimmick 1st Royal Anglians, world, including USA, good looking as superstars Whetherornotyou Tom hop out viewpoint, Barrie, valueof'Give Ireland Salamanga Bks, BFPO 53. Japan, South America, inpop. I knowI'llbe agree with the sentiments AS AN avid follower and rather than as you New Zealand, Africa and Back To The Irish' should admirerof Tom Jones, shouting on Ayr United's ofthisrecord,weare be sufficient to give Wings Bootlegs say simplySouth America, that Joe Filippi, Alex supposed to be living in a sinceIfirst saw him sing presenting a surface a top five hit, but doesn't AS THERE have been so 'Chills and Fever' amazingband Shocking McGregor and Davy free, democratic country, the music matter to Paul on opinion,withoutBlue look poised to Robertson. LENA many football songs 'Thank Your Lucky Stars', qualifying or in any way - and that means freedom and his friends anymore? smash the top fifty with HAMILTON, 12 Kingswell recently, how about these I have rated him as one of tospeak,sing and play - STEVEKIRKHAM,36 clarifyingthat-briefly 'OutofSight,Outof Avenue,Kilmarnock. suggestions for certain themostversatileand where possible. But any song we choose OrchardMeadow Walk, Mind'. Ayrshire, KA3 2EZ. interference teams: 'Ride AWhite dynamicsingersinthis basically thequalityof without any CastleVale, Birmingham Butisitreally worth from self-appointed Swansea','LeicesterMe, country and a great the letters page must the record company Roy's song censors.- IAN 35 7LU. LeicesterYou,Leicestej musical talent. inevitablyrestwiththe Polydor, botheringto Day',`ChesternutMare', Soinappreciation of readers; I look forward to ABRAHAMS, 305 SO McCARTNEY has release it, Radio One and ME AND PETER JONES HalfwayStreet,Sidcup, Torquayloshe Man', him in the near futureI receiving more letters been banned for his new Luxembourg will no - that's two of us who Kent. DAIS 8DP. 'Something's Burnley', will be planning to hold a from you on other doubt ignore it. And plumped for Roy Wood's record and a good thing 'Cowdenbeath the Blanket Tom Jones socialand subjects! recordshopsofcourse tunein theEurovision too.I would have thought Go'.'The MillwallsOf dance usingfulldisco will not stock it no matter eliminator.Wonder how but not he'd made enough money YourMind','The Witch sound equipment. Sweet how many people ask for he feels? Perhapsnot withoutcashinginon Queen Of Park Rangers', AllTomJonesfans everyone other people's mishaps. If it. humiliated,but alittle 'Hull In TheGround', interested in attending, he knows so much about Heart of tooth Countless other foreign saddened. I hope he 'This Old please write for details. - agrees Irelandlethim jointhe M i d lothian', I been releasesmeetwiththe releases it as his next solo 'Cambridge STEPHEN FRANZ HAVE never army for six months and gladderin my lifethan samefatehere.Isn'tit single. - PHILIP FOX, 27 OverTroubled Watford', MALY, 139St.Pancras the time Isaw the Sweetabout time the BBC and HeathdaleAve.,Burkby, with Paul seeifhestillholds the `Frozen Orient Juice', 'We Way, Camden Town, on the front page of onerecord shops woke up to Huddersfield. WHAT A shrewd fellow same beliefs. We've done Can Workington Out'. London N.W.1.

EDITORIAL DIRECTOR Mike Hennessey CARDFONT PUBLISHERS LTD. 1972 EDITOR Peter Jones Published by Cardfont Publishers Ltd., 7 Carnaby ASSOCIATE EDITOR (NEWS) Nigel Hunter St.,W1V 1PG. DistrubutedbyTheNational RECORDMIRROR PRODUCTION EDITOR Terry Chappell Magazine DistributorsLtd.,22ArmouryWay, Press Ltd., COUNTRY MUSIC EDITOR Mike Clare London, SIN18. Produced by Pensord 7 Carnaby St, London W1V 1PG. Tel: 01-437 8090 Old Tram Road, Pontllanfraith, Mon., and printed by STAFF WRITERS Lon Goddard Valerie Mabbs Celtic Press Ltd., Industrial Trading Estate, Dowlais, A BILLBOARD PUBLICATION Merthyr Tydfil, Glamorgan. U.S. OFFICES: Bill McAllister 165 West 46th St., New York NY 10036 and 9000 CONTRIBUTING EDITORS Rob Partridge Sunset Boulevard California, 90069 USA Max Needham bpi Tony Cummings James Hamilton PRESIDENT INTERNATIONAL PHOTOGRAPHER John McKenzie Other Billboard Music Magazines- Keith Ellis OPERATIONS Mort Nasatir ADVERTISING DIRECTOR Billboard (USA) ADVERTISING MNGR. Anne Marie Barker Discografia Internazionale (Italy) CLASSIFIEDS DEPT. Marion Fudger Music Labo (Japan) PUBLISHING DIRECTOR Andre de Vekey CIRCULATION MANAGER Ben Cree Record & Tape Retailer (UK) RECORD MIRROR, April 1, 1972 3 RANDY Newman wrote 'Simon Smith and the Amazing Dancing Bear' and if that is all you know about him, it is not enough. Heisoneof those contemporary American composers like Nilsson who have much of their work sung and often bastardised by other artistsWill Randy like Jack Jones who did a sort of musical job on `Love Story'. You really have to hear Randy Newman sing his songs toappreciatehissongstoappreciatejustwhathis intentions are and how often those lyrics are imbued with kind of compassionate but twisted irony which he delivers soeffectivelywitha deadpan face and apposite piano style. For example 'Lonely At The Top' sung by Sinatra for whom it was writtenis the kind of 'you can't buy everbea love' number Frank would have you believe. Sung by Newman it becomes a musical satire as it was intended. "Barbra Streisand told me she wanted to do that song but wasfrightenedthateveryonewouldtakeher seriously." Randy told me during an interview athis London Hotel from which I am still recovering. IfI have met a more amusing subject in ten years of interviewing music people Ican't remember it and the irony of that is that his humour is so often impossible to relay due to his unique delivery and timing. superstar? When I met Randy he was installed in the Savoy Hotel where he was proud of his reputation for good conductof hurting anyone's feelings. does not look the part. "Y'know I went on a although he revealed that his dignity has been somewhat I performeditonce ata "However". said Randy.radio show in California and hurt by an incident during his last stay: Catholic University, 'Notre "Recently he was called outproposedthatpolicyand "I've really been very well looked after here and I'veDame', Indianna and didn't toseeRodStewartandthe DJ wouldn't take me triedtokeepupappearances",hesaid."Afteran getstruckdown once. I after seeing him in the fleshseriously. Then he asked me unblemishedrecord duringrollstar overnight. It cameguess ifIdidn't get struckhe said he felt better abouthow I feltaboutthe down there I'm not goingme being in the business."imminent nuclear test in the RANDY NEWMAN: why did he put his wife's feet in my last stayI was makingout sounding like a bad 'Big the oven while she was asleep? my way out of the lobby toBrother And The Holdingto getstuckdown Lurkingattractively inarea and Itold him I was a car which was taking me Company' anditwasso anywhere! the background during thelookingforward tothe was Randy's to the airport and afucking loud I couldn't hear "People listen to 'Maybe interview show. He said,'But what conductor and that he shitless-they're 'bellboy' came running upthe voice at all.It was theI'm DoingIt Wrong' andGerman wife Rosevita whoabout the seals?' would makea 'fucking good constipated men." provedsplendidly immune to me with a pair of dirtyworst record I've ever they immediately conclude conductor!' I thinkitwas atthis to underpants and a sock I'dmade!" `Oh it's about fucking' but herhusband's unveiled "Just give me that stick pointthat I felloff my tryingtosay leftin the room.Igot in Although his songs like 'I I'mreally insults. Apparently she had and let me get at 'em", he chairwithlaughingorit that car so fast ... Think It'sGonnaRain something broader. A lot ofreached a similar conclusion`Bacharach affirmed pausing to enquire. mighthavebeenshortly Today', 'The Last Cowboy',my songs are like that. to that of some of Randy's "D'you ever see Burt afterMrNewman'snext "'Love Story'isa very criticswhomaintain he `SoHardLivingWithout scared me Bacharach conduct.Ihave. revelation that he was You','I'llBe Home' and straightforwardstorybut meanseverythinghesays shortlytobegiven'the `I really justtryingto He scared the shit out of `OldMan'aresimplicity I'mreally but some things he means me man. Scared me worse Father of the Year award' point out that people don'tmore than others. worse than because just before leaving themselves and Randy's "If you're goingto be than Vietnam!" try to be most recent Kinney albumhave to have such meagre home he had sneaked is my answer to Yoko you've Mr Newman than gave a featuresjusthimanda aspirations.'Linda' like Vietnam' downstairs in the middle of that too, just about a somejust go to act more socially passing goodimitationof piano he confesses a thenightand drunkthe aware",hechastisedher. Mr Bacharachat work in fashionable'yearning for something young kid who is just too entire bottle of his baby's lazy to get out of the way"We've got to work up this Mrs Newman revealed towhich it appears there is a moreelaborateinspiteof great deal of gesticulating ofcough mixture because he of the beach truck. hatething.First of all I me for some obscure reason could not sleep! he sighed those critics who revere his want to Hitleriantypeand much simple approach. "I'm really not trying to advocate thatthat Randy and his friends Not since Al Bowlly sung intellectually browbeateveryoneunderfivefeethad once put her feet in anarm waving and pointing. "Fuck'em",hesays "You know why he has'My Canary's Got Circle's characteristically. "The nextanyone. My songs are ofteneleven inchesshouldbeoven while she was asleep - Under His Eyes' in fact. "They are amazingly just cartoons, pictures aboutpainfullyeliminatedfromMr Newman did not denyall those little tinkling efficient here though. Ileftalbum is going to have full saxophones on his records", people who are oftenthegeneticpool-Paulthis. MT Newman further orchestra- I getbored James a tee shirt here on my last misfits.It's the misfit whoSimon'stooshorttobe declaredthat his onerevealed Mr Newman. "It's visit - an orange tee shirtwithmyself and justthe because they are all scared Craig pianoupthereonstage. interests me more than theworth a shit anyway! ambition in life was to be a with mushrooms onit. I guy who hasit altogether. come back a year later andThere are a lot of my songs thefirstthing sent up tolike'DavidTheFatboy' my room is my orange teewhich would benefit from an orchestral treatment." `Mick shirt- wanna seeit?" I declined gracefully. It'sdifficult at times to Randy sturdily maintainsknow how to take Randydidn't ring that he is really trying veryorhissongsbutasmile neverhurtand whenin hardtobeasuperstar again' HUNT, although he is constantly bedoubt a laugh is not a bad... foiled by his tendency tobet - unless you want to laugh about 'Old Man' and "I didtheEngelbert look like a worn-out John Humperdinck show here - I Lennon. then you just might meet a verbal knuckle sandwich. actually got to like his voice "I reallytry tobe by the end of the show. I fashionable", he signed. "I performed 'Lonely At LUNT & mean he was bending notes "Really I get theclothesTheTop' once in and the hair together and IPhiladelphia to an audienceeffectively better than a lot ofso-called tryto be like Mick Jaggerand no one laughed", professionals but it all falls apart. Once Irecalled Randy morosely. "I back in LA. He really has quite a good voice, but the recordedanumbercalled swore I'd never play there `Last Night I Had A Dream'again. audience there is something CUNNINGHAM else.Isang 'Simon Smith' which I was convinced "Song's like 'God's Song' would make me a rock andI do without any intentionand everyone politely clappedso I said'Here's anotherone'sthatmildly amusing'." AtthispointRandy MEANWHILE received acardfrom the estimable Derek Taylor at Kinney Records which congratulatedhimon previousnight'shis BACK IN performance with the words `Not since Jolson'. Mr Newman venturedasmile which reachedhis eyesif not his lips. "Mickdidn'tring... THE FOREST again", he said philosophically."Nordid the Queen", he added disappointedly. Randy 000 revealedthathe and Jack Neitsche weretheRolling Stones on 'The Performance' album and left it at that. Randy confesses himself 7N 45125 inadequateto the task of becomingapop star and that maybe he didn't look the part. His father who is a doctorinLA andoften [0] calledouttogiveaidto BANDY NEWMAN with ALAN PRICE; showing a thoseexhausted and RECORDS younger(?) and less fashionable Randy. Alan was one of sufferingelementsofthe RYE RECORDS (SALES) LTD. the first artists to pick up on the Newman songbook rockbusiness iswontto A.T.V. HOUSE. GREAT CUMBERLAND PLACE. LONDON W.1. 'Tickle Me' and 'Simon Smith'. remind Randy that he just 4 RtCORO MIRROR,April1, 1972' WAXIE'S WORLD BY MAX NEEDHAM 'What about Feathers, youtag -happy rockers?'

Gaffer - give me a full page. YOO-HOO, CATS, Oh Lordy, Lordy! Iwanna this is me - get a real gas groove going. drape -jacketed Waxie Come on, you rock soljahs, this is "Waxie's World". Maxie. Now y'awl, I Ready? I'll clamber inside the gottatellyathis is cockpitoftheRemingtion gonna be another and be off - whee, whoo, frantic, free-for-all, whoopee-eeee! gloves -offgabfestfor JUDY McBAIN, a pert, thickear rock -era firm -breasted,littlebrunette veterans, whoclout hadmarble -firmhips,slim buttocks,andareputation damn -fooldisbelievers for being wild. She was one plugged -in ofthosegirlswho always - showed too much cleavage of progressive whatch- her large chest. Judy wore a a macallits - with transparent blouse, black bra, wallopstothenose andatight,slitskirtthat showedalotof hersoft and throat- brown thighs and well shaped whummp!whummp! legs. She parked the van, cut whummp! - and bash theengine,gotout,and CHARLIE FEATHERS walkedslowlytowardsthe squealing skinheads doorofWally'sHotBun ..142.10* with oak clubs! humdinger". Lastly, I TransportCafe.Inside,she Wanna hear it? blinkowlishly and bawlfoundherselfamongst a Okay, Ihollar at you, at you, Three:- "If, aftercrowd of greasers. Feathers was, with Carl You Come Around'. Q. What were a few things about him She told the waitress, "I'm One:-"Ifyou'vebeen scanningthisfar,you Perkins, Sonny Burgess, and are his parents names? - A. she didn'tlikethe look of; figure youcanforgetJudy McBain - Biff Croaker later Eddie Bond, a leading Leonard and Lucy Feathers. his curious habit of drinking poisoned by over- ismeeting me here."She about today's brain -strain, pioneer figure in the birth of Q. Which label did he record teaoutofthesaucer; his amplified horse -manure glanced at the Hell's Angel at 'rock -a -billy' music. forafter brow -furrowing King?- A. Kay strangedelightinsloshing music, you mustcalla claptrapthe next table. He really was He made his first Records. Q. Did he record for lashings of H.P. Sauce over vet". Then, I yell, Two:-musicians- mod a tastylookinggeezer,so professionalTV appearance any otherlabels? - A. hisgrub;hismethodof meatballs - you shouldbloody sexy, she was (singing'Tongue TiedJill') Yes. Memphis - 'Wild Wild mopping up the gravy with a "Whileyouarewaiting thinking. He appeared to be with Wink Martindale, on a cut the malarky and deal Party'; Walmay - 'South Of piece of Mother's Pride. for the medic to take a arguingwithashort -haired yourself in". show called 'Dance Party', for Chicago'; Holiday Inn- She kept her face in a Cyd looksee, you can, youth. The Ton -Up Ted was Channel13,Memphis TV. 'Deep Elm Blues'.Q. What Charisse smile as she took a Youand me-we're however, swivel bloodshot leaningtowardstheyoung Atthatmomentanother wasthename he recorded forkfromthetable,and gonna have ourselves a ballsyteenager, shouting loudly, his schleppedinto peepers towards this time. Take offyour Hell'sAngel under for Walmay Records? stuckitsharplyintothe black glovedfinger stabbing the cafe; a tall, mean -looking A.CharlieMorgan.Q. trespassing hand of the lorry OXO-laden knee-length jackets and, - week's the kid in the chest. "Tags, bike -boy with an Edward G. WhatisSun231?- A. driver President of the labels;the R&R Movement Robinsonface,withblack 'DefrostYourHeart'c/w Wandering Hand Society.lie hasalways beentag -happy. eyes andamop of thick, `Wedding Gown Of White'. Q. Everybody has to be slotted, jumped up and shot through curlyblackhair.He wore He recorded 'Why Don't You' the door -likehe'd been Waxie's Bop has tofitin certain musical blackleathergloves on his (Kay)withJodyChastain, given an extra large dose of pockets baloney! I - bah, hands, and like the first Hell's JerryHoffman, and -? A. Andrews. Judy dropped mean, how often have you Angel,heworeastudded Ramon Mauphin. heard it said, or said yourself: some sugar in her coffee, and Flakes leatherjacket withaNazi Q. Name thefirstradio nibbledatthefried bacon 'Who was thegreatest rock emblem on the back. stationhe broadcast for? -sandwich. Both were 'n'roller?'. Nowadays, most A. WMPS Radio, Memphis. Q. 1-11'YA PUSSYCATS 'N' TIGERS! Ton -up Teds like to load all delicious. It wasn't long Watch for Joe Turner LP, 'GreatestHits',(Atco) which SQUIRMED How many tracks did he cut beforeshesmiled acrossat has not been releasedin Britain yet - nit you like a their r -n -r eggs in the forKingRecords?- A. shotgun fired at close quarters! No brag. You'll shoot into Lewis -Cochran musical the Charlie Feathers fanatic, orbit with tracks like 'TV Mama', Widnight Cannonball', "Can Iquiz you two cats Eight. Q. How many brothers showinghimSignal -cleaned 'Sweet 16,' and 'Honey Hush'. Sample it... The Vintage egg -basket. about Charlie Feathers?" he and sisters does he have? - white teeth, set in a pair of Idig those two Rock & Roll Appreciation Society is a top class operation, "Much as asked. The youngster A. Sixbrothersandone Barbara Stanwyck lips. catering for buckos interestedin'50s rock 'n'roll.Neil ding-dongdaddiosofrock sister. Q. Who co -wrote Foster, the society's secretary sends word that membership squirmed uncomfortably. His eyes were roving over and roll, f find one particular 'Dinky John' with Charlie? - hershapelypins.Hewas is 75p per year. C'mon, cats, this is the address to bombard "Well I guessso".The with your Biro-ed grenades: Neil Foster, 16 Coniston Ave., artistdoes seem to get - A. Quinton Claunch. Q. When good-looking Hell's Angel smacking his lips suggestively Prescot, Lancs ... Reports coining from RCA's Barry Holt neglected - Charlie (Arthur) did he recordfor King (wearing his Hank Janson trenchcoat) indicate the Arthur grunted. It was going to be a -andtherewas egg and Feathers.I,for one, do not Record? - A.1957/58. Q. sauce on his mouth. Her first 'Big Boy' Crudup LP, 'Father Of Rock & Roll,' (RCA) is think we hear enough of this difficultquiz.Hecouldn't scoring one socko review after another. ("Right on, Barry, extricate himself. It went like WhatisKing 5043? - A. instinct was to throw a crust m'boy!") truly fantasticentertainer, 'Too Much Alike' c/w 'When ofbreadathim, butshe whosediskshit CF -addicts this:Q. When and what did The Chuck WillisLP, 'GreatestHits' (Atco) includes he record for.the 'Flip' label? You Come Around'. Q. When decided against that method 'HangUp My RockAndRollShoes,' KansasCity,' likeasalvo of mulekicks to was heinhospitalfor one of bloke -pulling. He grinned, the head! I kid you not, pal". -A.`Peepin'Eyes,' I've 'Thunder & Lightning', and'C. C. Rider'.('Just a Been Deceived' - 1954. Q. year? - A. 1953. Q. His'I banged his fist on the table, suggestion, cats - you should also keep peepers peeled for ToRemember To the LaVern Baker LP, 'GreatestRecordings' - Atco.It Whereandwhendidhe Forgot stubbed hisfagoutinthe Forget' w contains 'Jim Dandy,'Shake A Hand,'Tra La La,' and appear on the same billas monster hit for sugar bowl, and walked 'Tweedle Dee' ") ... Outlook for Rosko's massive Sunday DEBUT which ar A. Elvis boldlyacrosstohertable. rock and roll shows looks good. Your main man's problem Eddie Bond, Jerry Lee Lewis, Presley a will befinding enough timetoreadthe thousands of and BillyLee Riley?- A. "So what do you sayto request cards which are expected to be lobbed in from all "CHARLIEFEATHERS, EllisAuditorium,Memphis, ride on my iron -horse, over the country - latch on, daddios, latch on! ... The April, 1957. Q. Which record GORILLA dreamboat?" Judy stared at grapevine tom-toms signal the upcoming Houseshakers LP, although born in Mississippi, him, 'Demolition Rock' (Contour)willbe a 86 -Proof slab to (Holly Springs, June 12, company did he record for FROM WHERE shesat deliberately safeguard with padlock and chain!("Isuggest progressive 1932)has made his home after leaving Sun? -- A. Saul withagorillaofatruck misunderstanding. freaks with dandruff resembling flakypastry had better (with his wife, Rosemary, and andLesterBihari'sMeteor driver -ham-thighedand "lronhorse?" drop to all fours and ask Houseshakers fans to whup some He sighed and rolled his sense into them!") children, Wanda Rose. Records.Q. Name atleast ox -like throughchestand Charles, and Ricky) in three of his songs that were shoulders - squeezing her left eyesinmockamusement. Terry King & Associates now handling the Rock & Roll kneecap,Judy caught "Aw, come off it, baby," he Allstars. In short, promoters and social secs who want to Memphis, Tenessee.He has recorded by other artists? - an pull big crowds and coin should phone: 01-930-1771. So been playing rhythm guitar, A. 'LovingLil,"Running occasionalglimpseofthe drawled like Bogart. "You're I figured herewe are,beset by theusualspaceproblems. My singing, and writing songs - Away', and 'How Come You dishy Hell's Angel as he sat built for speed so represent only a fractionof the bopflakes I could have 'Peepin' Eyes,'Tongue Tied Do Me Like You Do'. with his gloved hands clasped you like to ride - and how!" bashed outifRM pages were 2miles wide. Perhaps I They both fell about should just mention the Bob Wills & Tommy Duncan LP, Jill'etc-withimpressive Q. Namefourofthe underhisjuttingchin.His 'Hall Of Fame' (UA) - it's got items like 'Li'l Liza Jane,' facilitysince he was 12. He tracks he cut for King eating irons lay astride a plate laughing. 'Boot Heel Rag,' Blues For Dixie,' and 'San Antonio Rose'. made his debut in 1954, he Records?- A. 'Nobody's of half -eaten nosh - 2 eggs, Excuse haste,Igotta leap Try it. No more babble left. was 22, andtheplace was Woman,'One Hand Loose,' chips, baked beams, spaghetti, over to the boozer and tank Florence,Alabama.Charlie 'Bottle To The Baby,' When and tinned tomatoes. There up with Worthington -`E'.

RAysrfEvENs SINGLE CBS7634 ALBUM Turn Your Ra U 64760 . RECORD MIRROR, April 1, 1972 5 6 RECORD MIRROR, April 1, 1972 ONTheARGENT STAY FOR DUE to their current success in Britain BOXES with 'Hold Your Head Up', Argent have postponed theirBRITISH FANS American tour THE TOP originally planned for May, untilAugust FORTY DJs and September. Releaseof'HoldYour Head Up'issetfor next AS promised we begin this week with month in America,and the full Top 40 placings in the recent manager Don Broughton Record Mirror Pop PollDisc Jockey says of the postponement of thetour: "We feel we DAVE CHRISTIAN section. owe a lot to the public in 1 JIMMY SAVILE 21 TONY PRINCE 2 TONY BLACKBURN22 DAVE GREGORY thiscountry and want to(16); Manchester Free Trade 3 NOEL EDMUNDS 23 DAVID SIMMONS spend as much time here asHall(17);Newport 4 JOHN PEEL 24 CRISPIAN ST. JOHN Kensington Club (20); 5 DAVE LEE TRAVIS25 ROB EDEN possible at thepresent 6 ROGER DAY 26ANNE NIGHTINGALE moment. The U.S. tour isLiverpoolMandarinClub 7 ROSKO 27PAUL MAY obviously important, but a(21); Leeds University (22); 8 STUART HENRY 28PETE MUR RAY postponementwon'tpose Dundee Caird Hall (23); and 9 JOHNNIE WALKER 29PAT CAMPBELL Cardiff University (26). 10 ALLAN FREEMAN 30TONY BRANDON any problems." 11 KID JENSEN 31PETE DRUMMOND Recordingsof live 12 BOB HARRIS 32ALAN BLACK appearanceshavealready Lux win RM gets into drag 13 JOHNNY MORAN 33ALAN WEST the 14 DAVE ROGERS 34JIMMY YOUNG beencompletedfor Eurovision 15 MARK WESLEY 35DON ALLEN group'sfirstlive album, RECORD MIRROR takesspecial 208 Dragster, drivenfeaturing a dragster in their 16 TERRY WOGAN 36 MIKE RAVEN expected for release in July.THE 1972 Eurovision Songyetanotherstepforwardby Dennis Priddle (see currentadvertising 17 ED STEWART 37 BOB STEWART Argent'snextalbum'All Contest was won inovertheEaster Weekendpicture). campaign. 18 PAUL BURNETT 38 DAVE CASH (April2 and3), when in The admission charge 19 DAVE CHRISTIAN 39 TERRY DAVIS Together Now'isset forEdinburgh last Saturday by Several pop artists and 20 KENNY EVERETT 40 MIKE ROSS release on April 7. Luxembourgwith'Ayresconjunction with Radiocelebrities have promised to will be 80p, and the Thesecond twentybringsinalmostallthe British datessetforToi' sung by VickyLuxembourg we aredropbythemeeting onqualifyingrunsbeginat current major DJs, and includes most of the recent Argentinclude:StockportLeandros. sponsoringthebigSpringEasterMonday,includingabout9.30am.Themain and present RNI teams. Whilst on the subject of RNI nationals Drag Race Meeting "On The Boxes" will be running afull programme WoodfordCentre TheUK'scontestants, 208 disc jockey Dave elimination runs commence guideintheverynear future - as soon as the (Saturday);Croydonthe New Seekers,cameto be held at the Santa PodChristian. at around 1.30pm. necessary information arrives! Greyhound (April 2);second with 'Beg, Steal OrRaceway. RECORD MIRROR will Gravesend Civic Centre (3);Borrow'. They scored 114 This meetingisone ofbe presenting a specialHOW TO GET THERE TUNE IN AND TURN ON Boobs,Bristol(5); Gelnnvotes, 14lessthanthethe most important in thetrophy to the Top Santa Pod Raceway can RADIO ONE - The following artists are booked to Ballroom, Llanelly (13);winningsong.ThirdwasBritish Drag RacingCompetition Altered Car Ofeasily be reached from most appear during week commencing April 3: and will be parts of the S.E. of England JIMMY YOUNG SHOW - Cilia Black, Marvin Welch Devizes Corn ExchangeGermanywith'NurDieCalendar The Day, and there will also and Farrar. (14); Woodford Tech (15);LiebeLeesstUns. Lieben'attended by all top driversbe additional trophies theMidlands -the main DAVE LEE TRAVIS SHOW - Gilbert O'Sullivan, Barbarella's, Birmingham sung by Mary Roos. and cars, includingthepresesitedby Radioaccess routes being the MI Christie, The New Seekers, The Fourmost, Marvin Motorway, the A45 or the Welch and Farrar. Luxembourg, and also by ALAN FREEMAN SHOW - Middle of the Road, AtlanticRecords, who areA6 (see small map below). Lindisfarne, Greyhound. This is sure to be a really SOUNDS OF THE 70's - Brinsley Schwarz Barclay exciting day out - for all James Harvest (Apl 3); Quintessence, Eddie 'Guitar' LIVE! Top stars thefamily,sowelook Burns (Apt 6). RADIO LUXEMBOURG - Programme Guide for could have made it as a soloevening. Later, Chrisat Essex forwardtoseeing you at week commencing Sunday April 2. acoustic singer -songwriter. Hillman joined him to sing Santa Pod. Don't you dare SUNDAY: 7.0 Mark Wesley, 9.0 Paul Burnett; 11.0 Jethro Tull's absence from this a fewduetsinbeautifulfestival miss it!! Bob Stewart; 1.0 Kid Jensen. countryhas prevented theharmony. Together with the MONDAY: 7.30 Mark Wesley; 10.0 Paul Burnett; group from attaining quitetwo other former Burritos,QUINTESSENCE, 11.30 Bob Stewart; 1.0 Kid Jensen. Tull thereputationitdeserves. they performed some niceQuicksilver Messenger TUESDAY: 7.30 Dave Christian; 8.30 Mark Wesley; ROYAL ALBERT HALL: Hopefully, their currentcountry songs including theService, Geno Washington,Dead star 9.30PaulBurnett;11.0BobStewart; 1.0Kid month -long tour will change old'He Was A Friend OfCountry Joe McDonald and It'snearly time for Jethrothat.Obviously, the group Mine'. Then the whole Jensen. Dr the New WEDNESDAY: 7.30 Dave Christian; 9.0 Paul Tull'sseton adimly -lit stillenjoysplayinghere, group joined together again Johnand in concert Burnett; 10.30 Mark Wesley; 12.0 Bob Stewart; 1.0 stage on Tuesday, and there and Anderson admitted,to play for more than oneRiders Of The Purple Sage Kid Jensen. "Thisisthe only country and a half hours,going at Wembley arethesefiveroadiesall areamongthepopacts THURSDAY: 7.30 Dave Christian; 10.0 Bob where we'd daretotrythrough a lot ofSteve'sbooked for the Essex Arts Stewart; 1.0 Kid Jensen. dressed in neat white Bogartsomething new." They getmaterial,with Stills GRATEFUL DEAD will macs and tartan caps, doingmy vote for Best Concert ofalternatively playing leadFestival taking place from '72 so far, by a short headguitar and piano. However star inconcertatthe the last minute adjustments. May 7 to 14. Empire Pool, Wembley, on TELEVISION from Randy Newman. musically disappointing this Quicksilver from San Sounds forSaturday (BBC -2)April 1 - The Or could it be Jethro Tull? ROB MACKIE partoftheperformance April7and8. The gigs, Faces. Confusion builds as was,the group seemed toFrancisco are set to appear Up Country Special (BBC -2)April1 - George and theon May 8 with Comus atdescribed as jubilee similarly hairy individuals in enjoy themselves, concerts, replace Hamilton IV with guests Buffy St. Marie, Tompall Steve audience reactedthe Essex University Dance dates, andtheGlaserBrothers, Wally Whyton, John D. identicalgarb slowly filter enthusiastically. Hall.Country Joewhich the group originally Loudermilk, The Mercey Brothers, The Hillsiders, out from the various stage ROBERT BRIEL intendedtoplayatthe The Numbers, Lee Conway. entrances until there are aStills' McDonald with Cob and the Old Grey Whistle Test (BBC -2) April 4 - Kevin Natural Acoustic Band CommodoreTheatre, Ayers and Claire Hamill. round dozen onstage. Hammersmith, and the box The situationisresolved Gene appearon May12,and atlengthwhen sevenofManassas Quintessence star in a freeofficeopenstoday FUTURE HAPPENINGS themfadebackintothe CONCERTGEBOUW, concertatthe University's(Thursday). wings and the genuine AMSTERDAM: KnowingPitney 'The Tom Jones Show' first shown on BBC -1on Amphitheatre and Geno DeadareattheCity New Year's Eve gets repeat on BBC -2 on April 2 ... Jethros hang their uniformsthe line-up of Steve Stills'VICTORIA PALACE Hall, Newcastle on April 11, The Temptations to do radio and TV appearances on a hat stand and launch new group, one wouldTHEATRE: Hewon'tsee WashingtonandSunshine and be duringtheir forthcoming visit ... Tom Paxton set straightinto'Thick As A expect somegoodmusic 21 again, he wears an areatthe Dance Hall on will at the for Old GreyWhistle Test on May 9... Terry Brick'.JethroTullreally from them. Called Manassas,immaculate straight suit, heMay 13. Dr John and theBicker shaw Festival in Woganstartshisnew Radio2 show onEaster don't miss atrick - eventhe group consists of Stevedoesn't leap about on stage, Lancashire on May 7 after himself,organplayerPaul New Riders will appear on Monday (April 3, 7.0 to 9.0am), and Alan Freeman suchmundanities astheir his announcements and Continental engagements. kicks offhis new afternoon Radio One spot with arrival on stage are handledHarris, guitarist Chrisit' s-great-to-be-back-in-your-May 14. three hours on the same day, and then reverts to 3.0 with style, imagination andHillman, conga drummer Jowu nnerf ul-country-and- to 5.0pm each weekday, plus of course 'Pick Of The wit. Lala, steelguitarist Aly ou 're-a-wunnerful-audience Pops' still on Sundays. What a busy lad our Alan is They kept up the Perkins, bassist "Fuzzy"type of remarks are going to be!!! standard right throughSamuels and drummerrespectively brief and almost two hours of Dallas Taylor. The Budget and SpecialcomedyradioprogrammesonEaster conspicuous by their Monday (Radio -4)includeMorecambe andWise non-stop music interrupted The combination of absence.But Gene Pitney introducing extracts from their BBC 'Morecambe and only by some briefSteve with the three former has thatindefinable starANTHONY BARBER's Wise' LP (12 noon) plus aclassic Hancock's Half interludesofPythonesque Burrito Brothers sounded quality which all but filledBudget last week reducing Tull humour. While 'Thick likea sound promise of a Hour - 'Hancock Joins The Police' (1.45pm) the Victoria Palace for two As A Brick'(their newestbeautiful musical synthesis. purchase tax to 25 per cent discs Syd Lawrence Orchestra starts taping new series of houses on Sunday evening.meansthatyouwillbe 'SezLes' TV showsshortly...newseriesfor album) is slightly However the result last He sang his new single 'Just pop albums will now cost disappointing on record,it week attheAmsterdam payinglessfor your pop London Weekend TV starts June 10. The series will Can't Help Myself', but £1.99from£2.15; EMI's feature Dougie Squires' Second Generation plus such comes alive in the extended Concertgebouw whentheotherwiseitwas a vocalsinglesandLPs. But the played their guestsasSlade,Lulu, Labi Siffre, the Bee Gees, stage version, aided by Iangroup firstprocession through his past inpricevary drop from £2.15 to £1.94; Anderson's masterly use of'live'gigwas a seriesof reductions Stone the Crows, Osibisa and Sandie Shaw. hitslike'TheMan Whofrom company to companyDecca from £2.19to £2; the stage and lightning ratheruninspiredShot Liberty Valance', WEA £2.09from£2.29; switches fromcomedyto performancesof many of'Town Without Pity', 'Lookto some extent. drama and back. Steve's old compositions asIntoThe Eyes Of Love', The WEA group,Polydor£2from£2.15; Despite personnel wellas a coupleof new CBS from£2.29; 'I'm Gonna Be Strong', andcomprising WarnerBros., £2.09 ben cree changes over the years, ones. The main reason for he reminded us of his Phonogram £1.99 from .ietnro Tull has always the failure of the group to Reprise,Elektra,Atlantic, prowess as a songwriter by £2.15, and RCA £2.19 from playedsuperbly as aunit. reach acreative new soundrecapping on his written and Rolling Stone EMI's progressive But as usual, it was was that Steve was trying too hitsforother peoplelikeBearsville, have taken LP 1p£2.29. Anderson who stolethe much to show offhis own Ball' and'Hello Harvest label LPs now cost 'Rubber off their singles with a new show musically as well as musical capabilities. HisMary Lou'. £2.17from£2.40,and visually.Hisflutepumps dominationprevented the It was all Pitneyprice of 49p. So has CBS,Phonogram's Vertigo albums along fiercelylike none in other members of the groupprofessionalismatitsvery while Phonogram, Polydor, Record Mirror popdid before him and histo playing amore creativebest, and when he freaked are now £2.25 from £2.40. twosolosduringthe new andinspiredpart intheout to the extent of sittingEMI, Pye and Decca have workwereexcellent:the performa nce. on the side of the stage, helopped more off to arrive at The fecord dealer's cut is firsthovered and fluttered The showstartedwith was well rewarded witha new charge of 45p. This isnow 363 per cent on most THE PLUS round the Albert Hall like a thewholegroupplaying screams from thefaithful. product. After deduction of giant bird, the second wassomeoldcompositions byIt'sobviously goingto be areduction of 5pinall perfectlypunctuatedtrain Steve, dating as far back asanother sell-out tour,cases exceptPye,whichthe 25 per cent purchase tax rhythm. the Buffalo Springfield era.irrespectiveof whether theformerly charged 49p. RCAfrom thetotal, the record For goodmeasure, the The first part of thenew Pitney single makes the companieshave 384 POP PAPER new theme was followed by performance waschart or not, and like Jackhas lowered its single price 'A New Day Yesterday', anunfortunately lost in a Jones, he proves that a from 50p to 47p. per cent from which they early Tull classic, and mostfailing PA system. After this good act will get them There is even more payartistandpublishing of'Aqualung'.Thelatterwas fixed, Steve returned toqueueing at the box officevariation in LI' prices royaltiesandtheirown particularlyshows thatif sing a fewsongs onhis withouttheimpetusof a EVERY WEEK Anderson had not decidedown, which turned out tohit parade rating. followingthe Budget. Pyemanufacturingand tolead a rockband,he be the highlightofthe N.H.and Phonogram full -price recording costs. RECORD MIRROR, April 1, 1972 7 Broughton, FACE FOR GWT Curved Air FACES, Don McLean and the Beach Boys are among the early bookings for the Great tour dates Western Express, the four -day multi -media Spring Bank Holiday pop festival planned THE Edgar Broughton Band and Curved Air are both on by Great Western Festivals for the weekend the road this month for extensive tours of the UK, and of May 26 to 29. both have new LPs coming out to coincide withtheir itineries. Other star acts fixed to FESTIVAL plus Don The Broughton band has been off the scene for three appearareShaNaNa, months preparing a completely new stage act as well as Lindisfarne, BillyPreston, their new Harvest LP 'Inside Out' and a maxi -single, both Groundhogs, Rory due for release in mid -April. Gallagher, Humble Pie,McLean The Broughton tour Buddy Miles, andJohn began last Friday and Baldry. And there are more continueswithGuildhall, Mecca top -linersto be announcedand the Northamptontoday later. (Thursday); Sports Centre, A questionmarkstill Bracknell(Saturday); Free hangs over where theBeach Trade Hall, Manchester (4);circuit festivalwill takeplace. TownHall,Reading(5); Actor Stanley Baker, a MayfairBallroom, director of GWF, said lastBoys Newcastle (7); Friar's,bans Thursday that the company Aylesbury(8); St. had abandoned its plans to stage the event at Tollesbury in Matthew's Hall, Ipswich Essex. (11); Civic Hall, Guildford He said the reason was that the projected site at Hunt's (13);LowestoftTechnicalSweet Farm did not match up to the code of standards which College(14);PublicHall, GWF hasestablishedand publishedforsuchevents. Preston (15); Central Hall,FOLLOWING an Another factor in dropping Tollesbury was obviously the Chatham (20); Town Hall,appearanceattheMecca strength of local opposition similar to that which caused High Wycombe (21); CornBallroom in Portsmouth, GWF to cancel earlier plans for a festival at Bishopsbourne Exchange, Cambridge (22);duringtheirmini -tourof in Kent. St. Andrew's Hall, NorwichBritain,Sweethavebeen Tollesbury villagers hanged effigies of Baker and fellow (26); TownHall,Oxfordbanned from appearing on director Lord Harlechinthe villagesquare before the (27); Edinburgh Universitythe Mecca circuit, and announcement that Hunt's Farm was unsuitable MichaelDAD'S kind of music may not be top of their personal hit parade, but Dagel (left) and(28); Leeds University (29);several dates already booked Attfield, chairman of the Tollesbury Association, statedDanny still go along to the studio to cheer him on while he's making a new album inGuildhall,Salisbury(Mayfor Mecca venues have been that the Association would be pleased to let any otherLondon. Dad, of course, is Tony Bennett. 2);Trinity College,cancelled. The group were village "threatened" by the GWF festival have the results Carmarthen(5);Leicestersaid to be behaving of what had been learned during the protest campaign. University(6);CivicHall,obscenely on stage. An ironic footnote to the Tollesbury affair is that the Wolverhampton (8); "Their actions words and village victory celebrations last Friday night included an Liverpool Stadium (10);everythingwereobscene," invitationto young people toattend and bringtheir TownHall,Devizes(12);accordingtothe guitars "or anything that makes a joyful sound." David Cassidy Pavilion,BrightonPortsmouthballroom Floral Baker declaredthatthesiteof the Great Western (20) and Brooklands Tech.manager. "I made a report Express event would be announced early in April. Itis Weybridge (26). the following day to believed that the company is delaying the disclosure of TheCurvedAirtour,head office, and they were its next projected site to avoid alerting local opponents which also has Nick Pickettremoved from therest of too early in the proceedings. solo single and LPand ex -Skid Row memberthedates. We had GaryMooreonthebill,complaints from the DAVID CASSIDY ofthefour-colourprinted bag New York's Madison Squareopensat the Winteraudience about the act, and whichreportedly Partridge Family made hisfeaturinga photograph ofGarden Gardens, Weston -super -Mare,I was called from my office solo single debut last Friday Cassidy. took 130,000 dollars at the Christie festivals on April8.Further datesto see theperformance. box office. with 'Could It Be Forever', His first solo LP is also are Free Trade Hall,There were very few people named 'Cherish', and is set composed by Wes Farrell Manchester (9); CityHall,left watching the group at andDannyJanssen.The The next Partridge and new single for release here on May 5. Sheffield(10); Town Hall,the end of their act, and in flipsidewrittenbyTerry Family album due for TONY CHRISTIE will appear in song festivals in Mexico It includes one of his own Oxford(11);MusicHall,fact they arrived only half is'Sound and Bulgaria this year. He takes part in the Mexico SongKirkmanis'Cherish',andcompositionsentitledreleaseinApril Aberdeen (13); Kelvin Hall,an hour beforethe dance has released in Cassidyis Magazine', which has won Festival at Acapulco on May 7, and will be going to been 'Ricky'sTune'. Glasgow(14);CityHall,wasduetoend,which responsetorequestsby an American gold award for Bulgaria in June for another festival, at which the BBC currently playing a string of Newcastle(18);Guildhall,didn't do them much good British is totalling overone will telefilm his performance for later transmission. fans. The single sell-out concerts in thesales Portsmouth(20);Colstonat all. Frankly it wasn't the contained in a special includingoneatmillion dollars. Christie returns from his South African engagements on States, Hall,Bristol (21); Readingsort of thing we have had April 12, and his new single University (22); Town Hall,here before." will be released two days Preston(23); PacificHall, When contacted by RM, later.Itisanother Mitch Donovan, Lulu, Wolverhampton (24);St.Sweet's manager Nicky Murray -Peter Callander LIVE! George's Hall, BradfordChinn commented: "I think compositioncalled'Don't (25);TownHall,thewhole thing has been Mercy', 'Suzanne' and for Oxford Week vastlyexaggeratedandin Go Down To Reno', and 'Nancy' were actually better Middlesborough (26); Christie will be promoting it than the recorded versions.DONOVAN and Lulu are the latest additions to the starsRegent Theatre, Bostonfact I wish it was as bad as on a series of TV dates inLeonard Sometimesone feelsthatappearingduringthe1972FirstOxfordMusic Week(27); Dome, Brighton (28);theysaiditwas because Leonardtrustspeople too Sweet would be really Europe and the UK from much, for when he makesorganised by London impresario Robert Paterson. And jazzWinterGardens, the release date. statements like 'if you can't fans will have a treat in the shape of Count Basie and hisBournemouth (29); Victoriasomething! I also very much Hewill bestarringinCohen see orhear, moveright uporchestra with the Kansas C ty Seven. The concerts takeHall, Stoke (30); St.doubt that any of the kids cabaretatFagin'sClub,ALBERT HALL:Leonardhereonstageandrelax',place between May 7 and 14 athe New Theatre, Oxford. Hall, Norwichcomplained. If they left it's has progressed Andrew's toCohen scores ofpeopledoit. morelikelytheyhadto Manchester, from May 1 admirably since his last From the top balconies to Theopeningnight is (May1); ABC Wigan(2); 6 and at the Batley Variety appearanceattheAlbertthe fifth row in the stalls,titled'Spring Jazz Festival' ABC Chester (3); Pavilion,catch the last bus home." Club (21-27). Hall.Becausehis musicisbodies scramble forthe with the Basie orchestra and Buxton(4);CentralHall, The group's management practically a one-manstage. Some then took Jimmy agreedthatSweetwere operation, the backings are the Kansas City Seven, and Chatham (5); and Liverpool advantage of the 'free' twentyminuteslate on really embellishmentsapproach and complainedthe remainder of the week Stadium (8). adding just that bit more toabout the lights being used isrescheduledtofeature Curved Air's new LP forstage. They have since the atmosphere of the Miller Diamond tofilmthe show and the andthe John Aprilrelease iscompletedsuccessful dates poetic lyrics. Last year, hemikevolume.Even when CleoLaine at Reading Top Rank and seemed helplesslythey were corrected, someDankworthQuartet (May 'Phantasmagoria'. surroundedby a subduedpeople continued to shout.8); Kris Kristofferson with the Chelsea Village, here... but threatening Army andHowever, Cohen easily signed Bournemouth. hisBand of Thieves(9); an alarming number ofquietened them for a NEIL DIAMOND makes hislisteners. Thisfragility is terrific second half and theShirleyBassey(10); MaryROLLING STONESNilsson first British visit for nearlystillapparent,but he holds high pointwith 'Passing Hopkin and Ralph McTellproducer Jimmy Miller has control better and theThrough', a five -part(11); Donovan(12); Lulusigned a dealwiththe a year on May 22 when heArmy'sadditionstothe harmony song featuring the new LPOlsson ill: arrivesforafortnight ofnumbers have beenArmy with Bob Johnston(13), and Nana MouskouriAmerican ABC -Dunhill concertsand TVperfected, reaching anand Mona Washburn(14). label, released here throughNILSSON is completing the engagements,arrangedbyunusually high standard ofnoticeably good. Uproarious EMI, toprovide new actsrecording of his new albumtour off musical communicationallapplause confirmed the impresario Arthur Howes. round.His renditionsofcomplete satisfaction of the and recordings for the label.at London's Trident studiosELTON JOHN cancelled his The three concert datessongs like 'Sisters Oflisteners. At his best, L.G. Webb As wellastheStones,this week, and will be inItalian tour last week until arethe Royal Albert Hall Miller has recorded Traffic,Spain over the EasterJune because his drummer (May 27);Odeon, Spooky Tooth, Blind Faithweekendfor talkswithNigel Olsson was takenill Manchester(30), and and Spencer Davis intheRCA Espana executives andwith muscular strain. John, Odeon, Birmingham(June here past. His deal witha brief holiday. DeeMurray,Olssonand 1). Diamond will be SINGER/SONGWRITERABC -Dunhillexcludesthe He then returns toDavey Johnstone with accompanied on the Albert Rod Jimmy Webbarrived inStones and B. B. King, whoHollywoodforreduction,PhillipGoodhand-Tait had Hall concert by a 30 -piece Britain on Monday for isalreadyreleased by themixing and editing work onconcluded a successful orchestra, and will perform Peters concert datesand thelabel, released here throughthe LP, which is expectedseven-day German tourat his'African Trilogy' from recordingofanalbum.drummer whohasoftento be released here late thisFrankfurt last Monday his 'Tap Root Manuscript' sings Webb will play Barkingplayed on sessions hesummer. Nilsson's singlewhen Olsson became ill. LP. Town Hall on April 6 withproduced. 'Without You' and his He isrestingatthis Hewillfilmaninsert the Royal Philharmonic The dealisforthe'NilssonSchmilsson' albumparents' home in north-east clip for screening on 'Top Lchensh Orchestra,andtheentireAmericanterritoriesonly,have both won gold awardsEngland, and hopes to be Of The Pops' on June1, concert will be recorded. Hebut will probably be inthe States for a millionfit to play a major gig with and goesto Germany on willappearattheRoyalreflectedfurtherafieldinsales of the single and oneJohnattheRoundhouse June 3 for dates there and Albert Hall on May 8, alsotime as Miller is also actingmilliondollars'worthofImplosioninLondonon in FranceandHolland. with the RPO. as a talent scout. sales on the LP. Sunday. 8 RECORD MIRROR, April 1, 1972 AT the Sonex 3rd International Hi-Fi functional lines will blend with most furniture. ExhibitionattheSkywayHotel Its performance and features are of a standard normally associated with more expensive decks. London Airport last week, four new TAPE AND HI-FI INFO Two microphones are supplied, together with a tape machines were unveiled. These connecting lead and a blank cassette. machines show clearly the increasing Itis a compact deck with piano -key controls, slider type record level controls and two record popularity of the tape as an audio level meters. It has a good frequency response of medium. Two of the manufacturers 60-7500Hz and is finished in teak. Price: £51.03. involvedinthe production of this For the enthusiast looking for perfection in sound,thesecondunitfromBushArena, equipment are better known for their although a little more expensive, has a wealth of contribution to the record player and new andimportantfeatures. The C.440isa hi-fiequipment field, but now for de -luxe stereo cassette deck, with many luxury Fournewtape features.Forexample,ithasaChromium thefirsttime enter this excitingly Dioxide (Cr02) tape switch. Cr02 cassettes, when competitive and expanding world of used with suitable equipment, give an extended tape. frequency response and reduce background noise. Firstly,B.S.R. MacDonald, the largest The C.440hasspecialelectroniccircuitry designedtoobtainthisimprovedlevelof manufacturer of record playing units in the performance fromaCr02cassette.This new world introduce their home 8 -track stereo compact stereocassette deck with two record cartirdge player, model No. TD8S. level metersandthreedigittapeposition indicatorissuppliedwith two microphones, a Thiscartridgeplayerisa thoroughly machines record/playbackconnectingleadandablank reliable, full engineeredunitcleverly Cr02 cassette Price £61.73. designed to produce high quality fullycorrectedfrequency response,ideal The J.V.C. stereo cassette tape deck, CD1667. stereophonic sound reproduction in a most for feeding into the auxiliary input on a J.V.C.,thelargestaudiomanufacturerin convenient form, without tape threading or suitable power amplifier. Power is supplied Japan, announcedatSonex '72asystem of through a four pole dynamically -balanced Automatic Noise Reduction (ANRS) for stereo re -winding. One8 -trackcartridgewill cassette recorders. The new system, whilst being synchronous motor which maintains an simple in construction, issimilarto, and fully unwavering constancy of speed independent compatible with, existing noise reduction systems. ofnormalvoltagefluctuations.Motor The new four track stereo cassette tape deck, temperatureiscontrolled by anintegral type CD -1667, featuring ANRS will be available forced -ventilation system. from J.V.C., in the United Kingdom, sometime in June atalittle under £120,00. Other features TheversatileTD8Swillprovideendless include a selector switch for chrome or normal listeningpleasurewhencombinedwithany modern unit audio system and is available in two BUSH ARENA C440 type tape; the operation of this switch selects the accents. Illuminated track information appears on head for each type of tape used. versions. The first is in black and is manufactured With new machines like these it's easy to see from high impact matt ebony styrene with wood atranslucent panel on thefaceof theunit. grain insert and is finished with silver trim and Recommended price £23.73. that the tape generation is here to stay. Next from Bush Arena (a division of the Rank BARRY O'KEEF organisation) two new cassette decks. Announced B.S.R. MACDONALD TD8S asthe"Missing Link" Bush point out that a provide four programmes, up to an hour stereo cassette deck would complete your hi-fi system, radio, record player and tape deck, giving and twenty minutes of clear continuous the best of the three worlds of sound, providing stereo, and will then repeat indefinitely. of course that you have a stereo setup to start The TD8S switches from one with.I wholeheartedly support this view and for programme to the next automatically and tape recording together with its stereo playback hasquick,easy, manual trackselection. facilities the cassette deck offers the better choice from that of the 8 -track cartridge recorder. Programmesareclearly a indicated by The Bush Arena C.430isa stereo cassette series of miniature track lights. An integral deck. It has been selected to reflect the style of solid state two stage pre -amplifier gives a BUSH ARENA C430 theBush Arena Hi-Fi systems, butitsclean, JVC CD1667 OUT NOW! THE FULL, FANTASTIC LIFE STORY OF MARC BOLAN THE POLL WINNING POP SENSATION OF 1972!

28 PAGES PACKED WITH GREAT COLOUR AND BLACK AND WHITE PHOTOGRAPHS AND THE MOST DETAILED AND AUTHORITATIVE ACCOUNT OF THE LIFE AND TIMES OF MARC BOLAN

Available from your newsagent or in case of difficulty send 20p to RECORD MIRROR (Bolan sales) 7 Carnaby Street London W1V 1PG 9 ComeRECORD MIRROR, April 1, 1972 out Paul Bee fheart's UNDERGOUND hero Captain Beefheart surfaced in London with a plea: "Where are you, Paul McCartney?"and here! being ahelpful sort of diary page,weecho: "Come out, Paul, said they weren't, but you'to besmasheduptheconcertosareeithergood wherever you are". knowwhatbloodyliarsbackside byametal boxpianistsorhaveagood Pointisthat Paulis those publicity men are." lorry. working knowledge of theG IR L -OF -THE -WEEK department: There's really theCaptain'sfavourite However he'd decided topiano". X -certificate about Liza Minelli, but there about the film abandon his van just before But John thrives on Beatle.He said: "They PHILIP Swern has produced 'Cabaret' in which she stars. She plays Sally Bowles in this a group called The - and dived over a fencechallenges ... new movie - and it's really done her reputation a power could have come to see Pearls, a girl team, on aout of the way just in time. of good. Liza, daughter of the late Judy Garland, studied me anytime, because I song called 'Third Finger,Half an hourlater, whenOz for pictures of hundreds of old time movie stars to get the couldn'tverywellgo left hand' - a very goodthe bangs had stopped, he flavour. And she adds:"Iget some dazzling outfits to foundthevan and see them. But only song, by the way. This is had been wear in this film. At last I can prove I'm a female, instead what is known as castingcompressed to a quarter ofBroadwayofallthese T-shirts and jeans". No comment, he said Paul came to see me ...CAPTAIN BEEFHEART Pearls before Swern. its original size! pointedly. LOOKS likeit'struethat in Cannes, in 1968. But And if that isn't bad And the Hohner electric MickJagger isgoingtoTonight', I haven't been hiding!"Those P.R.'s enough: Tony Barrow ispianoinsidelooked more alias`Wimoweh'. co -writea Broadway show Beef really laments theirSO there was this carload of the publicist handling thelike a mouth -organ. KarlDenver had a hit withThe Scroll based on the Old Bailey Ozit in Britain ten years back, break-up."Whatdo theypublicists returning from a much -publicised affairs A FURTHER note on the thinkthey're doing? TheyPR convention in Trial. And writeitwhat'sand in America then thehit of the New Seekers. ButJohn's more with one Lisa Lerner origins of 'Desiderata', did so much . . . you know was by the Tokens. Birmingham. Driving down there's no truthinthe which astonishingly hit the what theydid. And now,the Ml. Suddenly the that they're - whosedad, AlanJ. story Lerner,wrote 'My Fair Nowit'sRobertJohnTop Ten last week. There throwing all those rocks atcargoesoutof control, concerto renaming the song: "Beg, with a million -sellerwere somecopiesofthe eachother - speciallyatsomersaults over the AND now John DankworthLady' alongwith Fritz Steal Or Barrow". (certified,folks) in thetract mimeographed and McCartney. embankmentandallthe has written hisfirst pianoLoewe. Amongthe States and available to patrons of Old "He was right, all along.publicists are flung out into concerto. First performancecharacters pencilledinfor 'Opportunity Knocks' discovery St Paul's It was a shame their musica field. of the work, commissionedtheAmerican showare Dave Church in Dust dive Newman heading the BritishBaltimore,Maryland, I gotsocomplicated. When by the Westminster FestivalJudgeArgyle, Marty as Out comesthefarmer onslaught. reported earlier. they were doing'I Wannawith a shovel and buries the JEFF Royal, one of Warmand the Arts Council, willFeldman and George Melly. Hold Your Hand', that waslotofthem.He'sjust Dust'sroadmanagers, gotbe on June 2... by the A quick note for Melly PersonallyIthink it's a But thereain't, no -how it.No,I wanna meet Paulsmoothingoverthelast caught up in the MlMenuhin Festival Orchestraaddicts: Do try his "Revoltludicrouslyoverratedandandnowhere, acopyof Into Styles", subtitled "The again.Butwhereithe?gravewhen upcomesa motorway madness while on(conducted by Yehudi monotonous song. But what'Desiderata'inthechurch How do I get to see him?"patrolcar,outleapthehis way back from a gig inMenuhin) and piano soloistPop Arts In Britain", whichinterested meisthattheright now. And the assistant A finalcryptic messagepolice, observe the Preston. He was on his ownJames Walker. is out now via Penguin for aTokens version wasrector there, the Rev fromtheCaptain."Therestill -smouldering wreckage in the Transit van when he SaysJohn:"Themere 40p. produced by the HankGeorge P.Donnally, wants arebig -eyedbeingsfromof the car and say to thehit the fog. compositionis my biggest Medrass-Dave Appel team -to keep it that way. "Not if Venusandthey'rerightperspiringfarmer:"Allof Ahead:the smoke andchallengeyet.SpeciallyasWimowenand they also produced the I can help it!", quoth he Mind here among us." His nextthem killed?" flames from accidents, so heI'm a wind instrumentalist. Robert John disc. Two bites you, he agrees that it's got the album,appropriately' "Well", says the farmer,pulled upbetweentwoI'm really no pianist. MostSUDDENLY there's a lot ofatthecherry . . . ata churchawholeheapof Star'. his brow, "somearticulated lorries... onlycomposersofpianoaction on 'The Lion Sleepsten-year interval. buckshee publicity.

THE RADIO LUXEMBOURG/RECORD MIRROR `SPRING NATIONALS' DRAG RACE MEETING

EASTER WEEK -END, APRIL 2/3 SANTA POD RACEWAY WELLINGBOROUGH, NORTHANTS. FEATURING THE "JOHN WOOLFE RACING 208 DRAGSTER". 0 - 200MPH IN 7 SECS. ADMISSION 80p DRAG RACING THE MOST EXCITING AND FASTEST GROWING MOTOR SPORT IN THE WORLD 10 nEconia mion0n. bornt.rn Lon Goddard talks to BEV BEVAN of the MOVE and What makes ..the ELECTRIC Purple tick? LIGHTORCHESTRA PSYCHOLOGY iscone f 5,0( (r(wriulw.rf - times from the inability to of the utmostwhk:er;"eth inowiused to produce the desired pd expression, yet it is a very importance to athis I was breaking it offpersonal condition seldom groupthat's made - row Ijust mil' noticed by others. thetop. Theirh°Tri'',,et "I'mveryfrustrated", though thehe admits, "I cm feelin ability to workadolescentthing-the me something that almost together insuresinferiority complex and amakes thesurface;Ican their longevity, so a1°L 'lea:17'Z; feel that them is more in head me thaniscoming out, bad apple can...ionally, butI know because- I don't think I've certainly upset themyself now and I can found my truemedium. cart for everybody. Ifs probably not the bass. le7gr:ze, rTlTtlyr7 Itmight THE ELO: pigs in Me orchestra? Last week, Deep bepoetryor be someone else and painting,itmightcome Purple'sorganistJonputting on airs.I became out in Purple and it might Lord admitted he wasvery paranoid aboutmy not. basically lazy andlook`' "Idefinitely feel needed other people to ROGER something coming. Cm droolingitat the mouth pressure him. Hefelt Rock's biggest rightnow, but someday that Roger Glover, theGLOVER 111really vomit and it will bard's bassist, was the bereleased.I'meating closest to his own kindexplains everyday,butonlythe of thinking andthat the rubbish comes out of my Ritchie Blackmore, the psychology ass - a lot ofimportant things am heldback. I caseof split leadguitarist, don't get dissatisfied with expressed the most that keeps the bass as such, but I do get, generallydissaliefted. determination and kept "I hear In Pace and the ball rolling. RogerDEEP Ritchie playingand iheir ROGER GLOVER: 'I'm very frustrated, he admits. THE ELECTRIC LIGHT ORCHESTRA: touring from March 23rd, throughout April. The Hookup agreeswiththisandPURPLE stuff is really comingout, includes French horn, ob., cellos, viol.... and a 16 -track mixer. explores itfurther bytogether butmineisjusta fewequal credit, which personality adding that, "Jon and peopletoobviouslyhas its "I finally decided that bee tins. ham nod, know what I'mthinkingdrawbacks at timer. It can AT LAST, theElectric L"Liagndht ISwee rs2 i ,,,II.ichyardp.fian ngd Oi uNp,mMoNewton Iarethefirstto benothing would changemy individually,not justtheget tty when themis Orchestrawill ro He'sa diplomatic about mostface and anything I mad whole group. I don'tfriction duetoundue but it's great to play them. We did a The aim of the ELO is the American things. would probably make know quite what it is theycredit on records, but ft's the Move are in the studio touse show m Germany as the Move and FMstations. The Move went to the worse- I "We'relesslikelytoeverything likeaboutus,butthegiveandtakewith me, makeasingle:two eventsuedand; Tandy and Bill Hunt withStatesonly once initslong lifeon offence. Ritchiecould wind up very vain. I others mem to he pettingSometimes I get too much LIVING WITH that have kept us on pins andthe band; they are the other two thatstage, but was prevented several times thisorhimselffirst, told myself thisisyour their stuff intoit and itand sometimes toolittle. make up the nucleus of the ELO and from returningdue to problems within whichmostpeopledo face, likeit or lump it - connects. We've allof an "Ritchie gets more needles waiting. Foreverthey are celled on if we have to do athe band, myway.Ifhe's friendlyyou can't change it. Thatego -Iwant people touptight about that - he boning, drummer Bev BevanMove gig. You can't do those numbers "We kept having persormel changes", onalmost all toward you, there must be follows like me, not just Purple aswants credit for things he ishaving a grand time as awith only duce musicians." says Bev, -Twice we were stopped by something initfor him, levels-music,poetry, a bend. does. I don't think someone leaving the band - first Ace care relationships, business and memberoftwogroups, a becausehe doesn't "The bass is asin creditwill ever and then Charlie. I think Ace Kefford what people think of him soon. WhenIusedto importantasanyothercome, because our usic A MONSTER producer and the owner of a PROJECTS has given tip now - a shame, bemuse - only what they think ofwrite poetry a lot,IweeS instrument-it'sonlycan'tbecontainedIn a successful Birmingham record he was very good and used to be the his musk. He doesn't mind alwaysthinking of how Bevadmits frustratingona permnaltop line and a set of lyrics AT THE TIME,the successofChristie to anybody thathe'sstoppedto main face in the band.Ihaven't seen other people would see li 'oh Yee 'Yellow shop, He took some time out who's back he puts up. level. No one member is- it's a total thing. We're 'Yellow River' seemed like nothingRiver", which was because it got played ponder men how many projectiare Carl Wayne forages,either.Idon't Ritchie doesn't speak that- now Iwrite A purelyany more important than (and them isn't much of thatbeing pursued simuitancously, but he think a co-operative group in all but manna from Heaven toand played and everybody got sick of anyone even remotely considers often, but when he doea,from my own head. mother; Deep Purple is arespects,sonobody can it. available!) from recording thealso admits there ledmuch time to leaving now- there's so much to get heusually itvery "The for Christie.But,like many groups, puts reason frve-man operationandgetroyaltygreedy.No "They put you Ina category a. Move's new single to drop bystop and ponder. Music and football are involved in.Jeff and RoyandI have strongly. eating is to cetm oneofthefewgoingmatter what other artists they find On reflection that one wordtletyou outofthat beg, bat Hs subjects and the more of each, thebeen pals for so long,it works very "IanandRitchiea micate and you have towithout a dominant force.say, moneyis stillthe massivehitrecordcanfurnish really our standard of musicianship Is for a sunny afternoon pint. merrier. well. somewhat alikeand Jon dunk aboutothers,too, It used to be Jon. During m ons terin an y mote long lasting problems, than a well above the average.If you listen toCHRISTIE: Obit to roghtl - above "I would like to do some drumming and I are somewhat alike.butI'mtryingto makethe 'In Rock' period, therelationship. Yoe. always the album 'For All Mankind' you canPaul Fenton and Lem Lubin,below, scope to I constantpresenceon themusic INTRICATE With aiittiereWte it. The Ian Gillan is the odd man them see what feel press jumped on himvery aware of what you tell, because everything on itis us: weVie Elrnes and Jeff Christie. Move requires morethanthe ELO, PRODUCTION out- hecan be veryinstead of pandering. Mind because of the Concerto scene. which is writtten out very precisely. I'd earn. We used to be a very didn'tuseanysessionmusicians. I "WethoughtthefirstELO bolshie sometimes andyou, I don't write often for Group and Orchestra.angry band angry like to sitht with Buddy Rich's band "On theoutsideproductionside, - "Ityou mimetogetherasa thinkthesecond albumthatwe've travel abroad, ariait's only when they album was good at the time, but almost goes out of his way now fits and starts." They figured he was thebecausepeopleweren't feel secure in the band, after awhile. or.teething.InBirmingham;I MJeffiscomaele groupwithout areputation and done isa good eine., a lot better Wan thisnextonewillfeaturethe Produce.cct-cc° to muse troublt, but he Unbelievably, Roger leader. recomisingus,but now Me first, perhaps because alot moreMat their true personality comes out. round to see John Bonham a lot and heBirmingham rock & roller who's been andIwere thinking about putting a canbeverydiplomatic,isn't entirely sure the bass "There were mvetal bigwe have individual homes, then have ahit recordit'sasif work went into it." Thenifhe's a right bastard there are entireline-up that will be doing known as Big Al for years. rm going to the road.Itcouldn't too, isthe medium forthis rows about that and some clothes,carsandthings you'vecommittedthe At the time of release of Meer 'Iron problems". the live shows. The Electric Lightsupergroup on produce a girl folk singer called Joanne due expression. Most of happen, because ofmanagement "I suppose I'm more of of us got uptight. We stillare more complicent". Horsesingle, andinmeparation for Jefffeelsthat Christie b a happy Karlin. Though I don't play guitar, I've time, he enjoys unforgivablesin",JeffChristie Orchestra will include myself, Roy thought themiddle maninthe the get that syndrome, but he They might be in their band iearnt over a difficulties, but we seriously grown very fond of folk music and the toldme."People their successful college tourwith andthat they Wood and Jeff Lynne, Bill Hunt group as far as pacifyinghimselfimmenselywhile isn't the leader - this is aprivatelives,but itisn't still sm to periodto'tom'togethersuccessfully. about a band featuring he and I onintimate atmosphere you get in folk Deep Edison Lighthouse and Worth, Christie and piano, people, bemuse I'm fairlythumpingout democratic band. He and peacefulonthatstage. thinkthatwe're jueest a That is something hefeels it is on Frenchhom drums, Tony Lommi on leadguitar,clubs.I spend a lot of time in one of Purple's rhythms - but on added a further member to Weir three easyto please. In fact,I Ritchiestartthemusic, They continuetobetter sessiongroup"(anargumentI'd piece line up. Lem Luken, who important to maintain, a. obviously Richard Tandy on guitar, bass andDave Walker on vocals, Robert Plant onthem up in Birmingham". the odd occasion it vocals, Jeff Lynne on piano and Roy never stood up to people get the action rolling and out some very alive beat heard only days before from White previously worked with Satisfaction has Lam fulfils these reowirements. Wilf Gibson on violin, Hugh TheMove'ssingleisreleasedby at ailuntilI joined and Idoesn't seem to work for the rest of us lump in toin the vein that put them "I know exactly what Iwarn to do Wood on bass. The minute we played, artistssuffer Plains./"But in factI've worked now joined the group on bass omMo McDowell oncello, Mike Atkins Harvest on April 7 and the ELO ham stilldon'tattimes. It him,All at completeit. We all sharewhere theyare. Wore this move was rnMe Iasked Jeff with .e band", he told me. "And the bootleggers would nick it anyway."started a two -month tour and are at the tothis on cello, Andy Craig on cello and business for eleven years, how seriously he had Wren considering Mink it would be grossly incorrect to "There just doesn't seem time to doBelfry, Sutton Goldfield (April IL Then lb -track andhavebeen fullyprofessional augmenting the grow. say that the kids all want to hear heavy Trevor Smithwillplay much more right now. Roy is the onethe big show will hop in their mini bus, who's doing the most. He's writing the for several. "That's a good numtion'", he mus,c, as much m it would be wren, to mixer asifit were an instrument supplied with airplane seats, TV, &track thinkit would hem Wen better pondered.'Recordonewisewedon't saythattheyallwant to hear pup intricate stuff for the ELO along withstereo and champagne, to continue with in the band. rock for the Move, Stan knocks the knockers too thebarediiMey'd been ming need anybody, and magewise with what The. willalwaysbethedieferwit "Much of ELO will depend on eff,writing the solid bookings throughout the rest of STAN WEBB was very before 'Yellow Royer' hit, or of we're doing at Me moment we don't sections. like Skinheads digging reggae, lus some straight pop for people likeApril.Don't miss it. pleasedabouttherecent and the balance - we'll be ableto jRainbowournattit turnedup. we have had a few flops fi, need anybody. But of Me right person thesoulfreaksvergingintothe 25p tourthatChicken Th. thiss fr woutd have been aknow°Irfttitierths as soludgrit, The feeling of suffocation mat this mm along - wellreally I play ;nano Tamla thing, and many more. feature many, soloists that didn't ShackandSavoyBrown claSSic exam. of what we but as tong as peoPm come knowledge produces in Jettisobvious. andlead "People want entertaining and they first LP. It's . r.hess nisi.'issiSit mu get a donee on the completed a few wmks ego. DespiteasuceeMulfollowup with they could take over for always have done. I'm not knocking .e svery intricate music, arranged and "The ideawas togivergynx:u:,-,-gzrwzv. 1:6,"° SOIL theprophets ofpotsdoesn't matter what anyone 'SanBernadino', Riverstill that.If there was a guy who could May bands that don't exactly entetain, they written out by Roy and Jeff, Its everybody a chance to seewho Mdn't turn up becauseeose hassaid.The mme remains as the chain that binds them - bass, and have a higher v.. range thantake ten minutes .ning up and turn., us, both gimps, as we are verystrictand nothinglike the tar; IT"5.1s=0""a rls* theor tune,butin some ways Vic and I - becaum we spanonly their backs to the audience, but when now. It was aim an on the Thames. A lotof wcp.wwww. yhe press haS theirshackle!It'sstillthe num.about one a. a half °mai., - be you think of people like.Hendrix and,Move. opportunity to give peoplethem are on ego trips and not liked them - then the auMences want to hear Me most,butit inmresled the Who. They're incredibie bands, and "We shouldfinishthe new Move chancetoenjoythey prettudgethings groupgets acknowled- is they entertain w well. If we're having a single tonight. The 'A'sidewill anyway. most of them can't gement from the sudieme must have come to the point where ''The pr.lem that there are so themselveswithouthaving Jeffsees roll. Yellow riverson his many trouble makers, you have to be hard time and we're very tired we may probablybe'California Man, areal to pay a thousand guineas a traT un-tr:e'n sleep!The group'slaterllop'with vary careful.I'dbe.prepared to takenot be as good assual, but otherwise rock & rot song with Jerry Lee Lewis minute for the privilege of Wan ofManyFates'didlittleto someone from a semkpro group, 1 Mink ittheatmosphere isconducivewe stylephone and Roy onsex. I like it. Most of the places were'ud:orvirrnato"Perrn:1::, 'trtertsla'irr4':re:trInrel; ready Clincher's situation, alMough mrue important to have someonemuck about a Pit, though its not a set record!. Mom numbers, bemuse there sellouts and we were sorrytiVere:t7:krIr ;:ovut:n.oasrt "" became a hit in Malaysia and Germany. whoisa mry nice guy a. eager to isn'tany pressure any more. The onbo we couldn'tdo Sheffield, fho The Chicken Shack are "It's so frustrating 1 couldn't begin learnthana guy who knowsitait time we'd appear in that eiMaciff is he Leedsand Guildfordwords didn't ince.yet it'snow Pack on a schedule of television or if we got s hit IP. We did the,acceptanceset::"%bal STAN WEBB: Tot many to tell you," said Jeff, obviously withSome people want to getinbecause bemuse of the power cuts. one.nighters .andwiii r.ts peoplein Me music biz feeling, "The trouble isif you mention Mm thinkMeyIl make money and Val Mabbs actuallydoa Movegigaboutsix 'We expected thePress htleanwaineeauell s:m= baaas:ie:ZarM thinktheir wordislaw.' months agofor a Charilybenefit in 10 nEconia mion0n. bornt.rn Lon Goddard talks to BEV BEVAN of the MOVE and What makes ..the ELECTRIC Purple tick? LIGHTORCHESTRA PSYCHOLOGY iscone f 5,0( (r(wriulw.rf - times from the inability to of the utmostwhk:er;"eth inowiused to produce the desired pd expression, yet it is a very importance to athis I was breaking it offpersonal condition seldom groupthat's made - row Ijust mil' noticed by others. thetop. Theirh°Tri'',,et "I'mveryfrustrated", though thehe admits, "I cm feelin ability to workadolescentthing-the me something that almost together insuresinferiority complex and amakes thesurface;Ican their longevity, so a1°L 'lea:17'Z; feel that them is more in head me thaniscoming out, bad apple can...ionally, butI know because- I don't think I've certainly upset themyself now and I can found my truemedium. cart for everybody. Ifs probably not the bass. le7gr:ze, rTlTtlyr7 Itmight THE ELO: pigs in Me orchestra? Last week, Deep bepoetryor be someone else and painting,itmightcome Purple'sorganistJonputting on airs.I became out in Purple and it might Lord admitted he wasvery paranoid aboutmy not. basically lazy andlook`' "Idefinitely feel needed other people to ROGER something coming. Cm droolingitat the mouth pressure him. Hefelt Rock's biggest rightnow, but someday that Roger Glover, theGLOVER 111really vomit and it will bard's bassist, was the bereleased.I'meating closest to his own kindexplains everyday,butonlythe of thinking andthat the rubbish comes out of my Ritchie Blackmore, the psychology ass - a lot ofimportant things am heldback. I caseof split leadguitarist, don't get dissatisfied with expressed the most that keeps the bass as such, but I do get, generallydissaliefted. determination and kept "I hear In Pace and the ball rolling. RogerDEEP Ritchie playingand iheir ROGER GLOVER: 'I'm very frustrated, he admits. THE ELECTRIC LIGHT ORCHESTRA: touring from March 23rd, throughout April. The Hookup agreeswiththisandPURPLE stuff is really comingout, includes French horn, ob., cellos, viol.... and a 16 -track mixer. explores itfurther bytogether butmineisjusta fewequal credit, which personality adding that, "Jon and peopletoobviouslyhas its "I finally decided that bee tins. ham nod, know what I'mthinkingdrawbacks at timer. It can AT LAST, theElectric L"Liagndht ISwee rs2 i ,,,II.ichyardp.fian ngd Oi uNp,mMoNewton Iarethefirstto benothing would changemy individually,not justtheget tty when themis Orchestrawill ro He'sa diplomatic about mostface and anything I mad whole group. I don'tfriction duetoundue but it's great to play them. We did a The aim of the ELO is the American things. would probably make know quite what it is theycredit on records, but ft's the Move are in the studio touse show m Germany as the Move and FMstations. The Move went to the worse- I "We'relesslikelytoeverything likeaboutus,butthegiveandtakewith me, makeasingle:two eventsuedand; Tandy and Bill Hunt withStatesonly once initslong lifeon offence. Ritchiecould wind up very vain. I others mem to he pettingSometimes I get too much LIVING WITH that have kept us on pins andthe band; they are the other two thatstage, but was prevented several times thisorhimselffirst, told myself thisisyour their stuff intoit and itand sometimes toolittle. make up the nucleus of the ELO and from returningdue to problems within whichmostpeopledo face, likeit or lump it - connects. We've allof an "Ritchie gets more needles waiting. Foreverthey are celled on if we have to do athe band, myway.Ifhe's friendlyyou can't change it. Thatego -Iwant people touptight about that - he boning, drummer Bev BevanMove gig. You can't do those numbers "We kept having persormel changes", onalmost all toward you, there must be follows like me, not just Purple aswants credit for things he ishaving a grand time as awith only duce musicians." says Bev, -Twice we were stopped by something initfor him, levels-music,poetry, a bend. does. I don't think someone leaving the band - first Ace care relationships, business and memberoftwogroups, a becausehe doesn't "The bass is asin creditwill ever and then Charlie. I think Ace Kefford what people think of him soon. WhenIusedto importantasanyothercome, because our usic A MONSTER producer and the owner of a PROJECTS has given tip now - a shame, bemuse - only what they think ofwrite poetry a lot,IweeS instrument-it'sonlycan'tbecontainedIn a successful Birmingham record he was very good and used to be the his musk. He doesn't mind alwaysthinking of how Bevadmits frustratingona permnaltop line and a set of lyrics AT THE TIME,the successofChristie to anybody thathe'sstoppedto main face in the band.Ihaven't seen other people would see li 'oh Yee 'Yellow shop, He took some time out who's back he puts up. level. No one member is- it's a total thing. We're 'Yellow River' seemed like nothingRiver", which was because it got played ponder men how many projectiare Carl Wayne forages,either.Idon't Ritchie doesn't speak that- now Iwrite A purelyany more important than (and them isn't much of thatbeing pursued simuitancously, but he think a co-operative group in all but manna from Heaven toand played and everybody got sick of anyone even remotely considers often, but when he doea,from my own head. mother; Deep Purple is arespects,sonobody can it. available!) from recording thealso admits there ledmuch time to leaving now- there's so much to get heusually itvery "The for Christie.But,like many groups, puts reason frve-man operationandgetroyaltygreedy.No "They put you Ina category a. Move's new single to drop bystop and ponder. Music and football are involved in.Jeff and RoyandI have strongly. eating is to cetm oneofthefewgoingmatter what other artists they find On reflection that one wordtletyou outofthat beg, bat Hs subjects and the more of each, thebeen pals for so long,it works very "IanandRitchiea micate and you have towithout a dominant force.say, moneyis stillthe massivehitrecordcanfurnish really our standard of musicianship Is for a sunny afternoon pint. merrier. well. somewhat alikeand Jon dunk aboutothers,too, It used to be Jon. During m ons terin an y mote long lasting problems, than a well above the average.If you listen toCHRISTIE: Obit to roghtl - above "I would like to do some drumming and I are somewhat alike.butI'mtryingto makethe 'In Rock' period, therelationship. Yoe. always the album 'For All Mankind' you canPaul Fenton and Lem Lubin,below, scope to I constantpresenceon themusic INTRICATE With aiittiereWte it. The Ian Gillan is the odd man them see what feel press jumped on himvery aware of what you tell, because everything on itis us: weVie Elrnes and Jeff Christie. Move requires morethanthe ELO, PRODUCTION out- hecan be veryinstead of pandering. Mind because of the Concerto scene. which is writtten out very precisely. I'd earn. We used to be a very didn'tuseanysessionmusicians. I "WethoughtthefirstELO bolshie sometimes andyou, I don't write often for Group and Orchestra.angry band angry like to sitht with Buddy Rich's band "On theoutsideproductionside, - "Ityou mimetogetherasa thinkthesecond albumthatwe've travel abroad, ariait's only when they album was good at the time, but almost goes out of his way now fits and starts." They figured he was thebecausepeopleweren't feel secure in the band, after awhile. or.teething.InBirmingham;I MJeffiscomaele groupwithout areputation and done isa good eine., a lot better Wan thisnextonewillfeaturethe Produce.cct-cc° to muse troublt, but he Unbelievably, Roger leader. recomisingus,but now Me first, perhaps because alot moreMat their true personality comes out. round to see John Bonham a lot and heBirmingham rock & roller who's been andIwere thinking about putting a canbeverydiplomatic,isn't entirely sure the bass "There were mvetal bigwe have individual homes, then have ahit recordit'sasif work went into it." Thenifhe's a right bastard there are entireline-up that will be doing known as Big Al for years. rm going to the road.Itcouldn't too, isthe medium forthis rows about that and some clothes,carsandthings you'vecommittedthe At the time of release of Meer 'Iron problems". the live shows. The Electric Lightsupergroup on produce a girl folk singer called Joanne due expression. Most of happen, because ofmanagement "I suppose I'm more of of us got uptight. We stillare more complicent". Horsesingle, andinmeparation for Jefffeelsthat Christie b a happy Karlin. Though I don't play guitar, I've time, he enjoys unforgivablesin",JeffChristie Orchestra will include myself, Roy thought themiddle maninthe the get that syndrome, but he They might be in their band iearnt over a difficulties, but we seriously grown very fond of folk music and the toldme."People their successful college tourwith andthat they Wood and Jeff Lynne, Bill Hunt group as far as pacifyinghimselfimmenselywhile isn't the leader - this is aprivatelives,but itisn't still sm to periodto'tom'togethersuccessfully. about a band featuring he and I onintimate atmosphere you get in folk Deep Edison Lighthouse and Worth, Christie and piano, people, bemuse I'm fairlythumpingout democratic band. He and peacefulonthatstage. thinkthatwe're jueest a That is something hefeels it is on Frenchhom drums, Tony Lommi on leadguitar,clubs.I spend a lot of time in one of Purple's rhythms - but on added a further member to Weir three easyto please. In fact,I Ritchiestartthemusic, They continuetobetter sessiongroup"(anargumentI'd piece line up. Lem Luken, who important to maintain, a. obviously Richard Tandy on guitar, bass andDave Walker on vocals, Robert Plant onthem up in Birmingham". the odd occasion it vocals, Jeff Lynne on piano and Roy never stood up to people get the action rolling and out some very alive beat heard only days before from White previously worked with Satisfaction has Lam fulfils these reowirements. Wilf Gibson on violin, Hugh TheMove'ssingleisreleasedby at ailuntilI joined and Idoesn't seem to work for the rest of us lump in toin the vein that put them "I know exactly what Iwarn to do Wood on bass. The minute we played, artistssuffer Plains./"But in factI've worked now joined the group on bass omMo McDowell oncello, Mike Atkins Harvest on April 7 and the ELO ham stilldon'tattimes. It him,All at completeit. We all sharewhere theyare. Wore this move was rnMe Iasked Jeff with .e band", he told me. "And the bootleggers would nick it anyway."started a two -month tour and are at the tothis on cello, Andy Craig on cello and business for eleven years, how seriously he had Wren considering Mink it would be grossly incorrect to "There just doesn't seem time to doBelfry, Sutton Goldfield (April IL Then lb -track andhavebeen fullyprofessional augmenting the grow. say that the kids all want to hear heavy Trevor Smithwillplay much more right now. Roy is the onethe big show will hop in their mini bus, who's doing the most. He's writing the for several. "That's a good numtion'", he mus,c, as much m it would be wren, to mixer asifit were an instrument supplied with airplane seats, TV, &track thinkit would hem Wen better pondered.'Recordonewisewedon't saythattheyallwant to hear pup intricate stuff for the ELO along withstereo and champagne, to continue with in the band. rock for the Move, Stan knocks the knockers too thebarediiMey'd been ming need anybody, and magewise with what The. willalwaysbethedieferwit "Much of ELO will depend on eff,writing the solid bookings throughout the rest of STAN WEBB was very before 'Yellow Royer' hit, or of we're doing at Me moment we don't sections. like Skinheads digging reggae, lus some straight pop for people likeApril.Don't miss it. pleasedabouttherecent and the balance - we'll be ableto jRainbowournattit turnedup. we have had a few flops fi, need anybody. But of Me right person thesoulfreaksvergingintothe 25p tourthatChicken Th. thiss fr woutd have been aknow°Irfttitierths as soludgrit, The feeling of suffocation mat this mm along - wellreally I play ;nano Tamla thing, and many more. feature many, soloists that didn't ShackandSavoyBrown claSSic exam. of what we but as tong as peoPm come knowledge produces in Jettisobvious. andlead "People want entertaining and they first LP. It's . r.hess nisi.'issiSit mu get a donee on the completed a few wmks ego. DespiteasuceeMulfollowup with they could take over for always have done. I'm not knocking .e svery intricate music, arranged and "The ideawas togivergynx:u:,-,-gzrwzv. 1:6,"° SOIL theprophets ofpotsdoesn't matter what anyone 'SanBernadino', Riverstill that.If there was a guy who could May bands that don't exactly entetain, they written out by Roy and Jeff, Its everybody a chance to seewho Mdn't turn up becauseeose hassaid.The mme remains as the chain that binds them - bass, and have a higher v.. range thantake ten minutes .ning up and turn., us, both gimps, as we are verystrictand nothinglike the tar; IT"5.1s=0""a rls* theor tune,butin some ways Vic and I - becaum we spanonly their backs to the audience, but when now. It was aim an on the Thames. A lotof wcp.wwww. yhe press haS theirshackle!It'sstillthe num.about one a. a half °mai., - be you think of people like.Hendrix and,Move. opportunity to give peoplethem are on ego trips and not liked them - then the auMences want to hear Me most,butit inmresled the Who. They're incredibie bands, and "We shouldfinishthe new Move chancetoenjoythey prettudgethings groupgets acknowled- is they entertain w well. If we're having a single tonight. The 'A'sidewill anyway. most of them can't gement from the sudieme must have come to the point where ''The pr.lem that there are so themselveswithouthaving Jeffsees roll. Yellow riverson his many trouble makers, you have to be hard time and we're very tired we may probablybe'California Man, areal to pay a thousand guineas a traT un-tr:e'n sleep!The group'slaterllop'with vary careful.I'dbe.prepared to takenot be as good assual, but otherwise rock & rot song with Jerry Lee Lewis minute for the privilege of Wan ofManyFates'didlittleto someone from a semkpro group, 1 Mink ittheatmosphere isconducivewe stylephone and Roy onsex. I like it. Most of the places were'ud:orvirrnato"Perrn:1::, 'trtertsla'irr4':re:trInrel; ready Clincher's situation, alMough mrue important to have someonemuck about a Pit, though its not a set record!. Mom numbers, bemuse there sellouts and we were sorrytiVere:t7:krIr ;:ovut:n.oasrt "" became a hit in Malaysia and Germany. whoisa mry nice guy a. eager to isn'tany pressure any more. The onbo we couldn'tdo Sheffield, fho The Chicken Shack are "It's so frustrating 1 couldn't begin learnthana guy who knowsitait time we'd appear in that eiMaciff is he Leedsand Guildfordwords didn't ince.yet it'snow Pack on a schedule of television or if we got s hit IP. We did the,acceptanceset::"%bal STAN WEBB: Tot many to tell you," said Jeff, obviously withSome people want to getinbecause bemuse of the power cuts. one.nighters .andwiii r.ts peoplein Me music biz feeling, "The trouble isif you mention Mm thinkMeyIl make money and Val Mabbs actuallydoa Movegigaboutsix 'We expected thePress htleanwaineeauell s:m= baaas:ie:ZarM thinktheir wordislaw.' months agofor a Charilybenefit in MERVYN CONN presents MERVYN CONN presents

. Produced by Richard Nader

ALSO APPEARING

BELLE VUE MANCHESTER JUNE 2 APRIL 1972 6.30 & 9.30 p.m. Seats: £2.00, £1.50, £1.00, 50p. 22nd ABC STOCKTON 6.30 & 9.00pm. Seats: Available from Forsyth's,Lewis's, Hime & Addison ticket agents or Seats:£1.50, £1.25, £100, 75p. direct from Belle Vue box office using booking form below, or phoning: 23rd LONDON PALLADIUM 600 & 8.30p.m 061-223 2927. Boxesf.12,f10,f5, Seats13, fZ5Of ZOO f125 £1.00 24th KELVIN HALL GLASGOW630a 900pm Boxes: £9, Seats: £150, £1.00, 75p. 26th ABC GLOUCESTER 6.30 & 9.00p.m. EMPIRE POOL WEMBLEY JUNE 3 Seats:£l.75, £1.50,£125, f1.0 0 8.30 p.m. 27th BIRMINGHAM THEATRE6158.830pm. Seats Seats: £2.60, £2.10, £1.60, £1.10 Boxes. £6 8E4-50, Seats.£1-50,£1.25 £105,75p. Available from Wembley box officeusing booking form below, or 28th ABC IPSWICH 630 & 9.00 pm. phoning: 01-902 1234. Tickets also available from Harlequin Record Seats: f175,£1.50, f1.25,f1.0 0 Shops. 29th ABC PETERBOROUGH 6.00 Et 8.45 p.m. Seats,f1.75,f150,f1-25,f1.00 1-1SE ROGINVIVe 42E 4RFCT TO CONPRI:AMON & MAY 1972 A MERVYN CONN PROMOTION 1st CENTRAL HALL CHATHAM 630 Et- 9 00pm Seats:£200, £1.50, £100, 75p. *BELLE VUE MANCHESTER JUNE 2 2nd FREE TRADE HALL MANCHESTER TICKEY APPLICATION FORM Booking Office 630 Er 8-45 p.m.Seats: £150,£125, £1 00, 90p,75p,60p To: "Rock & Roll Revival" Box Office (For Box Office Use Only) Belle Vue, Manchester. 4th ABC HULL 630 Et 900pm Please reserve the following seats for the Rock & Roll Revival: Seatst1.50, f1 -25,f1-00, 75p Friday June 2nd. 6.30 p.m. Perf. 9.30 p.m. Perf. 5th &6th EMPIRE LIVERPOOL 615 & 835 p.m @ £2.00 @ £2.00 Seats11.50,f1.25,f100, 75p @ £1.50 @ £1.50 7th COVENTRY THEATRE 6.00 Et 830p.m. @ £1.00 @ £1.00 Seats,f_1.50, £1.20 90p,70p,60p @ £0.50 @ £0.50 TICKETS ARE AVAILABLE FROM THEATRE BOX OFFICES I enclose cheque/P.O. value £ tip-ScE°G0:44p0IAVS SL-BE:t OR USUAL BOOKING AGENTS NAME 8.111:911CN ADDRESS A MERVYN CONN PROMOTION *EMPIRE POOL WEMBLEY JUNE 3 TICKET APPLICATION FORM Booking Office TICKET APPLICATION FORM Booking Office To: "Jerry Lee Lewis Concert" Box Office (For Box Office Use Only) To: "Rock & Roll Revival" Box Office, (For Box Office Use Only) London Palladium, Argyle Street, London W.1. Telephone: 01-437 7373 Empire Pool, Wembley, Middlesex HA9 ODW Please reserve the following seats for the Jerry Lee Lewis Concert. Please reserve the following seats for the Rock & Roll Revival: Sunday April 23rd 6.00 p.m. Perf. 8.30 p.m. Perf. @ £3.00 @ £3.00 Saturday June 3rd. 8.30 p.m. Performance. @ £2.50 @ £2.50 @ £2.00 @ £2.00 @ £2.60 @ £1.60 @ £1.25 @ £1.25 @ £2.10 @ £1.10 @ £1.00 @ £1.00 Boxes at £12/£10/£5. (delete as applic.)

I enclose cheque/P.O. value £ I enclose cheque/P.O. value £

NAME NAME ADDRESS ADDRESS RECORD MIRROR, April 1, 1972 21 M A NEW KIND OF MEDICINE we were a popular group ACCORDINGtoJohn anyway, able to work as much as Fiddler,guitaristwith weliked.Reallywe werea Head, when novelty act. I suppose you could Medicine draw a parallel between us and their first single 'Pictures early Tyrannosaurus Rex, as we In The Sky' was cut, his were both duos and we used to partner Peter Hope was createanincredible sound for two people. Although he only totally unaware that any played Jews harp Pete had an recording was being incrediblepresence, but he got made. Peter was always fed up with trucking around." The new three-piece Medicine the most mysterious half Head were formed in December

of the combination, ever last year and almost immediately , silent, even during workedonthreegigs. John Fiddler now believes the band to interviews,andtotally be more co-ordinated and hopes withdrawn. to undertake extensive live appearances inBritain, without "Some people can work runningtheriskof becoming inthestudioandother bored and stale musically. people can't, they can only "I've found out a lot about certain the way things work in the last workunder couple of years," he explained. says John. conditions," "AndI know itcan be very "Peter just couldn't get it on destructive to just keep gigging in thestudio. We were round thecountry.But we're having a certain amount of usingallour own material on difficulty - so for 'Pictures stage now - in fact we started out with an entirely new In The Sky' I recorded Peter repertoire with the new group. playingwhen he didn't We still use 'Pictures In The Sky' know. I'd already laid because we find people call out down a couple of tracks by forit, and we get twelve yea! oldgirlscomingtoseeus that time, that Peter wasn't because of the hit record. With a on,andI'dusedsome MEDICINE HEAD (left to right): Keith Relf, John Fiddler and John Davis. singleinthechartyoufind session musicians for." yourselves working insome really funny places, almost the One of the tracks recorded at cabaret club circuit!" this time is now on release as JOHN FIDDLER of Medicine Medicine Head have already MedicineHead'slongawaited completed work ontheir next single. Titled 'On The Land' it album,'Dark SideOfThe wasproduced byKeithRelf, Head talks to Val Mabbs Moon', and itis due for release who has now been added to the ratherthanatwopiece, andKeith Relf on bass andto increase the size of the group any time. Medicine Head line up. maybeitwouldhavebeenharmonica,thenumbershave with a bass player and drummer, "Allof the songs were written "We were going to release thenon -representative to havebeen boosted by drummer Johnand Peter just wanted to go. Weby me," says John Fiddler, "Bu' numberstraightafterourhitreleased it then." Davis. always had good gigs together, we're hoping to get into sor single,"says John. "ButIhad PeterHope 'hasnowleft "Isplit with Pete inthough, and the hit helped usgroup compositionsaswellas more of a band sound on itMedicine Head, and along withNovember, because I had wantedthere's no doubt about that. But group arrangements."

DANNY O'DONOVAN FOR APB INTERNATIONAL PRESENTS THE

40

THE NEW PENNIES: 'Not Guilty', they claim ... TWO SIDES OF THE PENNIES WITH THE accused - allsixofsoliciting votes and after all, them! - proppedprogramme rules are programme rules,we all themselves amiablyagainstunderstand that. CARLA THOMAS thebarofthelocal RM Well, as I alwayssay, hostelry and proceeded tothere's two sides to every AND deliver their defence. penny - ifyou'llforgive the pun! - and as I see it, The NEW PENNIES - thesearethefacts:'Tis for those of you who didn'ttrue,theysay,thatthey JIMMY HELMS askedalltheirfriendsto see them on the show orwatch them on the box ... catch up with the aftermaththey also asked their as reportedin our popularrespective mums and dads to take a look -in ... but as IN CONCERT Nationals - are the groupforwritingoutpostcards, who caused all the rumpuswelldefinitely NOT SATURDAY APRIL1st on, or rather after winning,GUILTY to that charge. CAPITOL THEATRE CARDIFF on Hughie Green's Mind you, as leader SUNDAY APRIL 2nd BIRMINGHAM THEATRE TonyChristianiexplained, 'Opportunity Knocks'. they did venture a comment MONDAY APRIL 3rd THE OPERA HOUSE BLACKPOOL Seemstheladsgained to their enthusiastic FRIDAY the highest studio audiencefollowers which went APRIL 7th THE ODEON HAMMERSMITH applausemeterreadingin something like: "If you dig SATURDAY APRIL 8th thehistoryoftheshowus, remember, it's votes that THE EMPIRE LIVERPOOL witha count of 96 whencount." SUNDAY APRIL 9th THEATRE ROYAL NOTTINGHAM they appeared on February And so, ladies and 21. However, altho'gentlemen of the jury,I put MONDAY APRIL 10th ROYAL ALBERT HALL LONDON runaway winnersontheitto you, does that really viewers postalvotestoomake them guilty or merely WEDNESDAY APRIL 12th WINTER GARDENS BOURNEMOUTH they were dropped from thevictims of their own followingweek'senthusiasm? The Defence FRIDAY APRIL 14th FREE TRADE HALL MANCHESTER transmission. rests- butLES REED iO Inthe interim perioddoesn't!Having signed The SUNDAY APRIL 16tht programme officials receivedNEW PENNIES to his FIESTA CLUB SHEFFIELD "someanonymouslettersChapter One label, this SATURDAY APRIL 22nd week the music people and 'phonecalls"stating sees thereleaseof thegrouphadbeenouttheir first single, 'B -BOOM'. RECORD MIRROR, April 1, 1972 22 I IEt Itt s rri a songwriting penfriendsa mobile ARCANUM ?????77? The price for a classified advertisement is: 5p per discotheques 01-452-6151 word - (Min. 50p). £2.00 per single column inch, Rare soul import 45s + SONG AND lyricwritersMAKE NEW FRIENDS, wanted. DAVE JANSEN (max. 30 words) boxed. Box Number charge 25p. UK Oldies. Our new Send s.a.e. forMarriage Partners. Stamp to:JAMES HAMILTON No money, in any form, should be paid to a Box complete catalogue listing FREE copy of 'From Song DISCOTHEQUES. Radio is almostready.Don't Miss Chidgey, Postal01-584-5910. styledprofessional number. Advertisements should be submitted 10 missyourcopy.Send Lyric to Commercial to"Road- FriendshipClub, 124/A39ASTERIX DISCOTHEQUE entertainment 01-699 4010. days before date of publication. All advertisements are large s.a.e. Record'. Sylvanbury runner'" Rediffusion, 13 Keys Avenue, Bristol.01-346-2767. subject to the approval of the publishers. The RM will Angel Row, Nottingham. Records (Dept R1), 30 BS7OH L. SPOT -LIGHT Discotheques, not be liable for any event arising out of advertising. Craven Street, LONDON PENFRIENDS AT HOMEATLANTA S.S, Music weddings, pubs, parties, ALL CLASSIFIEDS MUST BE PRE -PAID WC2N 5NT. power and abroad. Send s.a.e. for plus lights. dances, etc. 802 5033 01-886-2956. ACCEPT NO SUBSTITUTE freedetails.- European 254-5444. LYRICS WANTED by MusicFriendshopSociety, the Genuine Soul UprisingPublishing House, 11 St. FLYING MACHINE for Burnley. listsnowavailable.LargeAlbans Avenue, London W4. Surrey and surrounding fan clubs s.a.e. Graham Stapleton, UNDER 21. Penpalscounties, Weybridge 43050. Basement, 28 Walham anywhere.S.a.e.toefreeWoking 67146. ORDER FORM Grove, London SW6. SONG WRITERS: Send TeenageClub, details - COUNT DISCO - All kinds ELVIS FANS! your songs (words and Falcon House. Burnley. Join his film society, no ROCK OBSCURITIES ofparties accepted, 21st's To place your advertisement complete the order form musicor words only) and subscription, send 25p Vol. 1 'Louisianarock FRENCH penfriends, alland Weddings. below and send to: S.A.E.to: JANAY MUSIC Ring: registration fee plus two 'n'roll'.(Danny James, aged from 12 to 21. Send856-7081. s.a.e.'s - Peter Big Boy Miles,Rocket COMPANY, Dept. RM, 60, Wilson, RECORD MIRROR, 7 CARNABY STREET, LONDON s.a.e. forfreedetails 99 Eaton Place, London Morgan, etc). £2.25 and North Street, Chichester. - SW1. W1V 1PG. 15p postage. Chris Anglo FrenchCorrespon- NOCTURNE DISCO- Wel lard Records, 6 dence Club, Burnley. THEQUES 01-286 3293 Lewisham Way, New HOLLYWOOD COMPANY I would like my copy to read Cross,London, needs lyrics for new songs. SE14 6NN. Alltypeswanted. FREE details- Musical Services, ROCK'n'roll,oldiesset1305/R North Highland, saleandauction,Presley,Hollywood, California, USA. HMV 45's,Burnette Trio, I would like to have . insertion/s week beginning Downing, BerryHawkins, Lewis, McCracklin, Richard, tapes NEXT WEEK Sun, etc. S.a.e. Rare Record Under the classification Centre, 6 Old Market, I enclose cheque/postal order for £ Halifax, Yorkshire. Elvis Presley story on six C120cassettes, setfor OVER 100 singles for sale. £24 or £5 each:P. A. Signed O'Dwyer,53 St James Send s.a.e.toF.Mitchell, Road, Sutton,Surrey. Address 40 Prescot Road, Phone 01-546 6353. Sunderland, Co. Durham. oda JERRY LEE! Personally2,500 new/used cassette autographed LPs, all singles.tapes for sale. 4p s.a.e. 26 AlsoCarl, Gene,Chuck,Whitburn, Lewisham, SE13. Eddie, L. Richard, M. Gilley, etc. Many U.S free radio MIRROR records for sale ATTENTION Southern soul labels.Singles, LPs, EPs, and disco freaks! Great etc. S.a.e. Auction, 30 FORF.R.A. ASSOCIATE "ABSOLUTELY THE BESTselection of sounds in stock, Heaton Grove, Windhill,membership send s.a.e. to: mailorderexport servicenew and old. Sound Shipley, Yorks. Free Radio Association, 339 for ALL readerslivingin Unlimited, 149 North EastwoodRoad,Rayleigh, NORWAY SWEDEN,Street, Brighton. Tel. personal Essex. FINLAND, DENMARK,27240. LATEST freeradionews. GERMANY, HOLLAND, Ringorapswith top DJ ROY HAMILTON 'Cracking WORLDWIDE OCCULT,March issue 15p plus s.a.e. BELGIUMetc.Now you Up Over You' (U.S. RCA witchcraft and Circle"Oneacre",Royden, Diss, can obtain all your records introductions, etc. S.a.e. to:Norfolk. quickly and tax free fromVictor)realisticoffers:2 Delaunays Road, Sale, 'Phoenix', The Golder TANDY'S famous mail RNI RECORDINGS 1970 Cheshire. Wheel, Birkenhead, Cheshire. order export service. Write beginning and 1970 Johnny Moran todayforfreeCatalogue closedown. Cassettesonly EX -JUKE BOX records, pluslistsof new releases etc. £1.50p each. P. Bufton, 23 from: Tandy's (RM), 18/20pop,Tamla, reggae, Haven Avenue, Wolverhampton Road,S.a.e. 47 Chelmsford Street, NAN Weymouth, Dorset. Holland -on -Sea, Essex. Warley, Worcestershire". Takes the Studiorecordedtop GOLDEN OLDIES - 40 guess -work out of American radio and jingles BEATLES, STONES, Cheap.Hundredsofhits. ontape;alsointeresting Captain Beef heart and Cash, Dylan, Presley, S.a.e. lists 'Records',14 choosing friends piratetapesavailableat 33/4/7Y2 ips. Special Cassette tapes for Castle Avenue, Crosshill, collectors. S.a.e.details. Send s.a.e. to D. Smith, Lochgeily, Fife. Midland Mail Order Co. Let the Dateline 29 Suffolk Avenue, Ltd., 66 Castleford Road, Computer Dating Leigh -on -Sea, Essex Sparkhill, Birmingham. BETTYE SWANN'S MAKE SS9 3HD. hismessage toYOU ME YOURS, on MONEY, System find them for and other Super Soul Discs you. Post the coupon OFFSHORE NEWSLETTER TAMLAS FROM 15p Soulfrom BOYLANS, 30-32 Old now for details: 2.S.a.e.to B4 Eastworth andPop singles from 5p.Road, Conisbrough, Dateline, 23 Abingdon Road, Chertsey, Surrey. S.A.E. 4 Cavendish Ave., St.Doncaster,Yorks -large Rd., London W8. Leonards-on-Sea, Sussex. s.a.e. 01-937 0102. Please IF you live in the Brighton send me my Dateline area, tune to 256 metres on PLUS "WHEN POP PRICES are hiMINI RECORD AUCTION. applicationformand the 31st at 11am. giveborrowingLP's atri. S.a.e.list, 53 Eastern Way, full details: We've700sounds, spendLetchworth, Herts. Name pennies not pounds. S.a.e. Address travel to 17(R) Park View Vourt, 1,000sof UK OLDDIES, ECONOMY FLIGHTS, Fulham High Street, POP ROCK, SOUL and India, USA, Canada, London SW6 LP3". C&W 45s. 100s innew DATES ARRANGED byPakistan, Ceylon, East America Judee Sill 'UNCLE SAM's Soulcondition.Sendme your post. Age 16upwards, Africa, South Africa. Supply'.S.E.T.Sale, Soulwant'sstatingyourprice everywhere. For free SOLANKI TRAVELS, 187 GoldenOldies. Sends.a.e. plus s.a.e.to:F. T. Bailey brochure write stating age. Tufnell Park Road, London to 55 Capilano Road, Perry(Records), 54 Radnor Road, Mayfair Introductions N7 OPU. Tel: 607 5639. Common, Birmingham. Worthing, Sussex. (Dept. 9),291 Finchley Road,London NW3 6ND. publications AND ALL YOUR OLDIES (UNPLAYED). SPECIAL CASSETTES, T. ROCKPI LE No II 15p. 4 Free lists. Records from 5p JANE SCOTT for genuine each. Send S.A.E. 12,Rex, Who, Stones, Zeppelin, friends. Introductions N a rve I Felts, Cochran, USUAL FEATURES Winkley Street, London,Hendrix.S.a.e.Stuart, 28opposite sex with sincerityTwitty, Berry, O'Keefe, E.2. Farm Road, Finchfield, and thoughtfulness. Detailsphotos. 16 Laurel Avenue, Wolverhampton. Gravesend, Kent. EX -JUKE Box Records. free.3pstamptoJane Pop,Tamla, Reggae,Etc. Scott, 50/RM, MaddoxSTONEY & MEATLOAF. INCLUDING S.A.E. Lists - 47 Rare Soul Import Street, London W1. Motown Monthly. 12p plus ChelmsfordStreet, singles. Our new s.a.e.48 ChepstowRoad, Weymouth, Dorset. supplement listing to our POEMS W2. main catalogue is URGENTLY WANTED interesting SOUL BARGAINS available now. - 100s Send s.a.e. to prizes. Send s.a.e.for freeTAMMI TERRELL. 40p each, many scarce 'R o a d r u n n e r editorial opinion. Strand Exclusive photo cover. items - 'Don't Miss'. S.a.e. Rediffusion Record LiteraryEditions (BX) 30Motown Monthly. 12p plus Egletonand Chalmers, 26 Centre,13 Angel Row, Echoes Baker Street, London s.a.e.48 ChepstowRoad, Stanford Avenue, Hassocks, Nottingham. W12 2EZ. W2. Sussex. 23 RECORD MIRROR, April 1, 1972

QUITE OFTEN, when I listen to an LP, I pick up the sleeve and glanceidly through the notes as the discis playing. And I must say when I didthistheother evening, I was struck by the vast strides that have been made in the quality of liner notes since the time when I Theman saw Woody Herman described as having gained a new lease of life since he left the Hermits. First Iplayed 'My Favourite Egyptian Folk Songs' by Moishe Maccabi and his Kosher Kats featuring Dayan Carroll (not a patch on Golda and the Gingerbreads, by the way) and for the first time Igrasped the rapport between the perceptive notes of Arthur "f7.50 per thousand" Hack who has and the music on the record. Next I gave a spin to Mark EXCLUSIVE! Blowlamp and Physical Rex playingtheirlatestalbum Interview "Epileptic Furrier' and once again I marvelledatthe sublimelyapt and with the nothingup sympathetic notes ofS.0. Felon - inextricably married legendary to the sounds on the record. It was only when I realised thatI'd had the LPs in the Harold wrong sleevesthat his sleeves disillusionment set in. And a hasty run through a selection Wright -Burke ChelseaFootballClub,the records. The least we can do istogivethem afirst-rate of albums confirmed the grisly FourFreshmen andTessie sleeve note, even if the record factthatthestatusquo O'Shea". whose notes he has penned. "But isn'titvitalto be isappalling.Ithink we owe hadn't really -changed. Sleeve them that. note writersstill maintain a No records. Just sleeves. accurate in writingsleeve "And again, 'Using a in essence, a purely idiomatic very lowly status and really "You mean" I asked notes?" "As a matter of fact- fastidiously hand-picked - though contemporarily have nothing to quo about. incredulously,"that you "I say, what a disarmingly though don't put this about rhythmsection ... 'means: validandquintessential- never actually get any records'? quaintthought! My dear -I did hear a record once. 'The bass player had the pot, manifestation of didactic Whyisit,Iask myself Thatallthosesleevesare chap, the whole art of sleeve Awful row, quite unbearable! the drummer owns the record discord.' " (often), that sleeve notes are empty? Then how on note writingisto boost the Never again. I cantell you, company and the whole band "And what did that so abysmal? earth ... ?" product, not condemnit. I for allthe future he's got in owes the pianist money.' mean?" music, Well, I have now "Well, I don'tactually mean how would it be if on that Mark Poland "Thenyou'lloftensee: "It meant I still had an discovered that half the listentotherecords, you the 'Miles at Newport' album, mightaswell giveup. No 'The leader is ruminative (he inch and a half to fill." problemisthatsleeve note know. Far too many released. released by Rot Records,I chance. has a vacant stare), he talks "Onefinalquestion. Is writers use a language of their Have you any idea of the actually pointed out thatit "I couldn't understand the sparingly(he'sinarticulate), Harold Wright -Burke your own which,ifyou'renot colossalnumber of records was recorded at Newport, Isle stuff at all. Awfully his playing is informed by a real name?" familiar with it, can be most that are issued each month? of Wight, by Sid Miles the disturbingexperiencefora tremendousinner stimulus "Good heavens, no! To be perplexing - and can, in fact, "But how can you write yodelling meat porter? And note writer. In the end I had (he's smashed out of his brain honest, I thoughtpeople lead to exactly the kind of about records you'venever how long do you thinkI'd to use phrase 14c: 'Here the mostofthetime)yethe might pay more attention to is malevolent criticism of their heard?" I asked. last at this game if my note band gropingfornew never seeksthe limelight my notes if I had an workwhich I havebeen "Well,you tryto avoid for the Armpit label's treble dimensions,searching, (nobody's ever heard of improbable name. All the top making for years. mentioningthemusic. In LP set,'Concert for Bangla seeking, restlessly probing the him)'. critics and record people do Recently,though, Ihad fact, in many cases we don't Desh' actually revealed that it peripheryof the musical "Oneof my most it, you know. I mean nobody - the uncommon good luck to evenmention theartist- was a concert by the Saffron spectrum ... ' . . . you know memorablepassages, I feel, could reallybecalled Dom meet a liner note writer who that'ssleevenotewriting Walden Townswomen's Guild the sort of thing". was this: 'Theplangently Ce r u Ili, Orrin Keepnews, was frank and honest enough honedtoafineedgeof Ukulele and Jaws Harp "So the sleeve note writer sibilant overtonesof his Nesuhi Ertegun, Bent Fabric, to explain the secrets of his perfection.Imean you can Ensemble?" has a language all his own?" upperregisterbravurastyle Yannick Bruynoghe or Peter trade. do up to six carbon copies, "Butisn't all this "But of course! For contraststarkly withthe Jones." Harold Wright -Burkelives allfordifferentLPs. You thoroughly dishonest?" instance, 'Outstanding on all constricted,autocratic, in a secluded, sound -proofed know, 'Thisis probably the "Well,wetakeamore tracks is thebrilliant, convoluted, yet sparingly house at 333 Bayswater greatest vocal group record of enlightenedandoptimistic sympathetic accompaniment reticulatereverberations Mike Terrace.His loungeislined ourtime'.Thatwenton view. Optimist, in fact, is the of ... ' would, in your which emanate in concentric, with record shelves which are albums bytheLuton Girls keynote. And afterall,the language read: 'He's my transharmonic waves from the Hennessey crammed with record sleeves Choir, Pinky and Perky, the public pay good money for brother-in-law'. diatonic concept of what is, WIN A PIONEERS RADIO ROGER LP BY ROGER DAY managers and publicity men. They'lltakeatleast nice be HELLO - to 25per centofthegross HOW WOULD you like to win a copy of the Pioneers LP, "Yeah!" (TR L talking(or writing) to youearnings. But I'm not 24). Well, you can! All you have to do is answer the six questions below, again. It'sbeen a busycomplaining about them, the monthforme,withthe becausetheydo find and, also in not more than 25 words, tell us why you like reggae music. group work. usual endless miles of The middle man, though, motorway travel in betweenis the promoter who thinks THE twenty five correct entries which in the opinion of the judges (The Editor and Circulation Manager is of Record Mirror) give the best reasons will be judged the winners. The judges decision is final and no dates. I often wonder whatthe best artist the cheapestartist - and he correspondence can be entered into. we pop people would dousually lives in much better without motorways. - stylethan the people who Personally, I'd buy a pullin the crowds for him. Send your entries to the following address: These promoters should you ready for this? Record Mirror (Pioneers Comp) helicopter. now seethatunlessthey The 6-9 am spot - me. not 7, Carnaby Street, I suppose many peoplestart paying fairer fees more reservedfor It's groups will disband - and that I'm the sort who London. W1V 1PG. who read this column enjoyslisteningtohimself assume that one has only toallthe fun wilt go out of to arrive not later than first post Monday April 10th 1972 pop. - but I DO enjoydoing be PART of show -business this show! Maybe an answer would And 9-12 noon - Mike -CUT HERE - toimmediately order a be for the groups Ahern.He's formerly with mansioninSurrey and athemselves to promote dances which would surely Caroline South, butis now A. Q. , A. Rolls Royce. Take a band in Australia. Q. resultin cheaper admission The Pioneers LP likeTonyRivers -I'dprices and more money in From 12 noon - 3 pm 1. Name the three members 4. Paul Burnett -- (TBL 103) better,because he'd neverthepockets ofthe people - of the Pioneers. "Longshot" who deserve it. Luxembourg's best was produced by: (a) forgive me ifI didn't. disc -jockey. At the moment, I have He and his group used to From 3-6 pm Itis Keith Winston Low? (b) Lee the pleasure of working for Leslie Kong? gig most nights oftheBritain's only 24 -hour radio Hampshire, another Caroline 2. Whichmemberofthe Perry? (c) in week, drawing large crowds largebiscuit Southdisc -jockey, now station - a Canada. Pioneers is Desmond 5.The Pioneers recorded a and, onfacevalue, earningfactory near Isleworth.Itis a very good wage but when And from 6-9 pm must Dekker's younger 'live'versionof"La La true Top Forty and with six Everett, my we look closer at thetalenteddee-jays up there be Kenny half-brother? Means I Love You" for facts I'dsayit'sa veryunder the direction of Dave all-time favourite. what Trojan LP? different picture. Dennis, who was Thenfrom 9 pm to There was hire purchase midnight - Johnnie 3. Whatisthe title of the 6. What is the address of the much -loved for his mid -day This show, in terms of time, tobepaidon avan and BigL,itneeds new Pioneers single? Trojan Artists Appreciation equipment, stage clothes toshow on was more his style than the only a medium wave Society? be bought, a roadie to betransmitter to wipe the present time -slot he has paid - andifthat wasn'topposition off the radio. with BBC. enough, justthinkofthe From 12 midnight to 6 In fact, it's worth getting I like reggae music because (not more than 25 words) amount of petrol they had atthefactory am - Simon. Simon Dee - to buy to get them to the a job to a good jock. listen to the station! some of the dates. Another point to people ask me Maybe Many people readingthis willbe consider is thecost ofwhat disc -jockeys I repairs to vans and personally like to too young to remember two Address listen to. ofthementioneddee-jays Name equipment ... Well,the easiest wayof And then we come to butletme assure youall listing them is just -stow I'd listed are interestedin thy most expensive part of employ them. -if'happened I've the operation ...agents,to own a ildio station. Are radio and its improvement. 24 RECORD MIRROR, April 1, 1972

PETER JONES ON THE NEW Mirrorpick SINGLES Name AMERICAN valve? MARVIN, WELSH AND FARRAR: Marmaduke; Strike A RELEASES Light(Regal CANNED HEAT: Rockin' THE DELFONICS: Tryin' Zonophone RZ 3048). With The King (UA UP To Make A Fool Of Me Written,itsays,here, 35 34 8). Surprisingly (Bell 1215). Another by Tarney and Spencer. ancient -sounding slab old and out of The trio handle it well - of Rock'n' sequence U.S. hit, this R oll ...and if you sweet slowie is of niceeasy-going don't already know course lovely but may mid -tempo,with a who's onpianoand have too much gently shuffling sort of rhythmic lead vocals, where have percussivearrangement base. YOU been? (It's Dickie for the general public. Story -linelyricsof Penniman, actually). sound sense, though I find Jazzy instrumental flip. WAR: Slippin' Into it hard to take the name Darkness; Nappy Head Marmadukeseriously.A EDGAR WINTER'S (UA UP 35327). WHITE TRASH: Keep Snipped from War's strongprofessional, Playin'That Rock'n' superb "All Day musicianlyfeeltoit - Roll (Epic EPC 7550). Music" LP (do check it and it builds excitingly Right on! Johnny's out - its banded but CHART CHANCE. brother keeps on continuous music rockin', but ina more makes it good late-nite CHRISTOPHER NEIL: If modern manner. CARLY SIMON: Legend materialfordee-jays), this slinkly slow beater I Was Close To You; Grey THE J. GEILS BAND: InYour Own Time; Looking Julie Through The is somewhat Day(Rak128).Nicely For A Love overshadowed bythe (Atlantic K 10099). Glass (Elektra K presented performance - 12043). The beauteous editedLatin -Rockflip Frantic teenagePunk about which our good Mr Neil is a good Rock,slightlylacking thrush on her own Carole King-ish light "doctor" so rightly songwriterandhis own in dynamics but quite raved. But get the LP. good. Chicago -style slowthrobber,which voiceislightweight but harmonica flip. Britain's Penny Lane capable of deep expression has covered rather well forallthat.This isa ALICE COOPER: Be My too. Good sounds, and NEIL REID - with former Miss World EVA JON RUEBER-STAIER Lover; You Drive Me a very pretty quiet flip. veritableflurryof notes Nervous (Warner Bros. andwords whichmight K 16154). The Krazy Gang strut J.P. ROBINSON: George Procol, hold it back, but there is their Jackson (Atlantic K also class in every groove, adolescent training -bra 1 01 49). Slow Soul groupie stuff (the version of Bobby T.Rex, as they say. Do tryit - words are good). Zimmerman's recently it'sa nice production. - Noisierflipgetsiton unsuccessful new CHART CHANCE. more. "protest" song. It's ELVIS PRESLEY:Until better than Bob's and Cocker ROYAL BREWERY: that Another doesn't contain It's Time For You To Na-ya-ta-ta (Concord). I controversial use of the Go (RCA2188). Et know nothing about this seems to be relaxing like word"shit",butdo Move Perry Como, with enough people over group except thatthe sloppy slushy effect on herecareaboutU.S. record, a languidchoral Buffy S a inte-Marie's political prisoners in job,is doing well on the the firstplace? Funky Magni- now wishy-washy continent. Merely so-so. slowie.Tightenitup, flip. El! 'Mother' ROBERT JOHN: The Flys EARL SCRUGGS: Foggy Lion Sleeps Tonight Mountain Breakdown (Atlantic K 10136). ON March 24th comes (CBS7877).Whileit Despite his updating the first four releases in doesn't equal the (well, recreation) of the a newFly'Magni-Fly original by Earl and his Tokens oldie being the erstwhile partner Lester series. All of the singles best.Ifear Robert will featurethreetracksor Flatt, this less lose out to the British more and retailat only nerve -jangling treatment GENEfor PITNEY: I Just DrawledNeil out with spirited NEIL REID: That's "Opportunity Knocks" 50p. No futurereleases humour, too - it's one of of that famous cover version unless he are definitely set, but if Can't Help Myself; What I Want To Be; If banjo-pickin' "Bonnie gets an almighty theymatch uptothe Beautiful Sounds (Pye those simple things, & Clyde" tuneisstill Wishes Were Ships plugging push. a piano-tonked,thatsticks mighty fine. present issues, it's 25579). This is actually a series to watch. switch of emphasis - the inthe mind. - CHART (Decca F 13300). JAN HOWARD with BILL BREAD: Everything I An obvioushit, Own (Elektra K For those who missed former 'B' side now CHANCE. ANDERSON: Someday them the first time following hot on the heels Be Together 12041). Comes & goes becomes the top deck. Not We'll slow Pop. around,or for younger (nearly typed "hells") of (MCA MMU 1152). So, pop fans, thetracks entirelyconfidentabout FRANK WIELD: Hurdy it's this weekend's included onthefirst it,but Genediditon Gurdy; Lonesome Jubilee 'Mother Of Mine'. In fact, Country bonanza at SAN REMO STRINGS: four maxis should be of telly recently and it came (MAM 69). The yodeller this is a little -boy Wembley which Reach Out I'll Be particular interest. presentation of acatchy last issue's There; Hungry For over very strongly indeed. of yoreneeds onlythe prompted PROCOL HARUM's andsentimentalsong - bumper C&W release Love(Tamla Motown classic recording 'A It'sagood, never -fall -in - right song to get back in review.Here, Motown T M G 8 0 7) . the charts. This is a pacey, sung with excellent clarity Backing -track -type Whiter Shade Of Pale' is love -again songwitha (the Supremesoldie) available on Magnifly catchy melodic base and atmosphericand and all the confidence in AXE: hard and fast goes Country, with stomping instrumentals Echo 101, coupled with the world. Neil looks like interesting results, fromthelatter'60s, 'Salty Dog' and Gene is less dramatic, commercial song - which AXE: Running Wild; Sing, with many fans. A being around fora long including typical 'Homburg', and more relaxed. Nice has a hint of reggae in the Sing, Sing(MCA MKS recitation by Bill. depressing thought, but combines the production London -recorded backing,but nottoo long time. -- CHART Flipside,Jansolos on thisisthe most likely 5088).Thisreallydoes genius of Denny Cordell muchofahint.Frank CERT. thefamiliar"LoveIs hitout of allthis with Brooker -Reid production. CHART drivealong- hard and Like A Spinning week's fine releases. songwriting talents. Echo CHANCE. does hisusual big -voiced fast. Good for the Wheel" and the doomy job, and there's a hell of a THE PEARLS: Third DETROIT EMERALDS: 102 features early dancers, anda duo (Bill "DallasYou've Won". TYRANNOSAURUS HOT CHOCOLATE: lot of personality showing Finger,Left Hand (Bell). You Want It, You Got REX material, 'One Inch This isanatural hit song Kimberand Rod CONWAY TWITTY with It (Janus 6146007). Rock','TheWoodland Mary -Anne; Ruth (Rak through.- CHART - on Tamla a 'B' side job, Alexander) who could LORETTA LYNN: The fellas at Philips are Mickie Most CHANCE. butitcouldeasilytake After The Fire Is Gone doing sterling work for Bop' and 'The Seal Of 127). break through at the first Seasons' providing a nice productionofsubstance offand givethisgirlie time of asking. (MCA MMU 1150). us R&B freaks (watch samplerforfans who NEIL LANCASTER: Why group a hit right now. It's built Heartstrings -tugging thisspace!),andthis and style. It's an missed out on thatera Can'tPeople Be People; round a staccato beat and weepy Country duetted U.S.hitby the great ofBolan'scareer,and ear bending slab, very THE BUSKER, STREET, is sameyin termsof slowie, with the "Do Me Right" group TheRiseAndFallOf PIANO AND ORCH: keening Loretta coming might hopefully hit for thetopside'Debora'. commercial,withhectic melody,but thetwo JOE COCKER is the Solly Glick (Polydor 2058 Streets Of London outontop.Flipside, them. The rapidly drum bassbeatandthe blokesget a really subjectforEcho103, 207).Nicegentle -voiced (Columbia). Atmospheric Harold solos onthe plopping bongo rhythm with his five minute long verse, painlessanyway, piece with a sort of tough -edged sound going. a intro to this, then the beat love-lorn self-pitying "I is filled outby versionoftheBeatles' leads intoa most direct Jack -the -Ripper feel to it, One to watch. - CHART Can't See Me Without surprisingly Reggae-ish buildswell it's a I thought. 'With A Little Help chorus. Not the strongest - CHANCE. You" and thenastily stop/go bass and a From My Friends', charming little song, and gloating "I Wonder regular as clockwork of Chocolate bars in terms coupled with 'Delta quiteafair What She'll Think stomping backbeat, Lady' and the Boxtops of melody, but I'm pretty Neilswings Reggae corner Me Leaving". while the boys' perfect About hit 'The Letter'. sureit'lldowell.Nice oldbitasthevolume Undeniable value, these timing and light builds. As for the chorus DANNY RAY: on'FeelSo Bad'(Horse),chugs bighit -crammed MCA harmonies give it One ofthe MOVE's restrained arrangement along merrily with a good string -and -horn backing - Country maxis. double appeal to Soul liveliest recordings, from most ofthe way. - -well,thephilosophy actuallyhe singsverywell.'EternalDrums' by Group Freaks and 1968, and a Cordell may be a bit hackneyed, BONGO HERMAN AND LES (Big is strong on the CHART CHANCE. beat with submerged reggae chit-chat running JOAN BAEZ: SongOf dancers both. production is 'Fire butit'saverysaleable Bangladesh; Prison Brigade', featured on through. Danceable. sort of philosophy.Ilike Trilogy (Billy Rose) LUNAR FUNK: Mr. Magnifly Echo 104, and EWAN STEPHENS: The TROPIC SHADOWS sing 'Our Anniversary' (A&M AMS 897). Penguin, as an added bonus this it a lot. -CHART (Big Shot) with a drawling style and a slow, ragged Parts 1 & 2 Brother We CanSurely pace ... over -emphasised. KING IWAH, on 'Give Me Without other people's (Bell 1225). Sad to also has 'I Can Hear The Work It Out; Long CHANCE. troubles for subject report the death of the Grass Grow',andthe Power' (Upsetter),is drum -heralded, majestic in the matter, whatever would great Linda Jones, more moody 'Night Of Long Summer (Decca F spokenintro...thenvocallyacrobatic.Quite Joaniedo?Shegives really sad. Anyway, to Fear'. 13299).Obviouslyvery SHAKIN' STEVENS AND strong. hertonsilstheir usual THE SUNSETS: Sweet 'MerryUp'by GOD SONS(GreenDoor) is cheer us up, this totally All are packaged much an outsider in terms Roller airing on this unrelated recent LittleRock And mid -tempo, shuffling, but with trumpets and horns U.S. attractivelyin a paper disturbingly -worded R&Bhit of name value, but it's a (Polydor). The old Chuck most authoritative --split by spoken nothingness. instrumental sleeve printed in various Berrybelterdressedup slowie/bouncy (with friendly vocal good-time old -styled, 'The WorldIsSpinning Round' by JOE HIGGS shadesofbrown, and with a large amount of (Sioux) isquite a catchy and commercial song - coupling, thetitlesof interjections)isafast, drawledthingwhichis picturingtheartistsas musical violence by one of easy to grab, melodically. 'Cock Mouth Kill Cock' Is which provide a general organ -based, they were. Good value. darned catchy and sort of a variety the best home-grown rock quite a title - THE AFRICAN (Sioux) - but vocally umbrellafor hand-clappin', V.M. of ungroovy topics. hit -worthy gas. vaudevillianinapproach. outfits. Exciting. it's all a bit over -happening, which is a pity. 25 RECORD MIRROR, April1, 1972 MirrorpickilPs REVIEWERS: Lon Goddard, Valerie Mabbs, Bill McAllister, Peter Jones, Mike Hennessey The A treat for real Slade fans SLADE: Slade Alive! (Polydor 2383 101). Packaged inasleeve with an amusing cartoon, and Genius extracts from the many things written about Slade, this LOUIS ARMSTRONG isa good quality live recording - made under studio The Genius Of ...(CBS conditions and produced by Chas Chandler. To those 66225).Two -albumset, who haven't seen Slade this could be surprising, with priced £2.99, aptly titled, Noddy's raucous vocal, and bellowed comment - and and withmaterial dating make their appeal difficult to understand. It's a rockin' from 1924, going through album and the excitement of the group and crowd has to 1932. Though far been captured well, but it's not easy listening, somewhat removed fromthe frenzied! On stage the group hold attention with their 'WonderfulWorld' cavortinganticsandgeneralenthusiasm,andto Satchmo of the Top Ten, followers this is a good album to keep to remind of the it is an historic collection. live performances they see. But it's only a fraction of And some revered jazzmen the story. Opens with 'Hear Me Calling', an Alvin Lee featuredin thevarious composition that the group have used since their days as accompanying groups. Ambrose Slade.Getting faster and faster with hand claps from the audience and whoops from the group it JERRY REED setsthescene.'Get Down WithIt'isexcellently Nashville Underground performed, and shows the extentof audience (RCA Victor LSA 3056). participation with the group. Their 'Keep On Rocking' Songslike'FineOf My incorporates phrases and the feel of many an old rock Mind', 'Tupelo Mississippi song, and perhaps best indicates what Slade really are Flash'and'Hallelujah I LoveHerSo'underline about. In contrast Sebastian's 'Darlin Be Home Soon' is the essentialspiritof this the only slow tempo track - with a shattering 'burp' country man. Not for him 'Greatest Hits Vol. 2' includes some of their best -ever songs: 'He Ain't the pedantic mourning: THE HOLLIES with ALLAN CLARKE: breakingthemood,shouldyou betakingittoo more the joy of living. Heavy', 'Hey Willy' and 'Just Like Me'. seriously! V.M. THE HOLLIES: CHRIS ETHRIDGE, VARIOUS ARTISTS It All Started Here Hollies Greatest Vol JOHNY BARBATA, JOE (Atlantic K 20025). SCOTT HILL Anotherselling at99p, 2 (Parlophone PCS L.A. Getaway (Atlantic K withcontributionsfrom 7148). 40310).Jazz based rock Aretha, Brook Benton, A particularly valuable Hollies: eig with very emotional and Otis Redding, Wilson t Pickett, SamandDave, collectionofthegroup rough vocals. A blend of King Floyd and Roberta ... as it was, that is with white soul, jazz and rock Flack -fourteenexcellent Clarke as lead R&B soul tracks ... all of Allan fromthreetasty interest. singer.Items range from musicians. Not an amazing the'JustLikeMe'of amountofbacking and SOUNDTRACK 1963, to 1971's'Hey rightintheL.A.rock WithLove Prom Russia reputedtobea (Sunset SLS Title Willy', yearsof hits field.Thereare a songfromLionelBart, tribute' to departing thousand bandslikethis singing.ButBentonstill mostofthescore from member Graham Nash. CACTUS VARIOUS ARTISTS keyboards, bass, guitar ... and these three doitas John Barry, vocalrefrain Another good track which Restrictions(AtlanticK Rock 'n' Roll Is Here Tobut hassome invaluable remains among the great well as any of them, but as they say fromMatt 40307). Half ofthe helpfromsingerLinda under -rated stars, certainly Monro- one ofthe didn't make a release Stay (United Artists UAS even intheirsubtlety strongest -ever movie music here: 'Too Young To Be adventurous and sometime 29336). As if we didn'tLewis and drummer in terms of actual sales of his records. This should be is no real individuality - productions. Married',a Gold Disc in successfulVanilla Fudge, know! UA's rock master LaurieAllan.The voice is justmusical ability. A requiredlistening forall Australia.Proofofthe Cactus retain the energy Alan Warner springs more flexibleandalert,the galaxyofsuperstarsin SANDPIPERS enjoy emotional, La Bamba (A&M AMLB Hollies' sheer consistency. and sweep away a lot of surprisesby puttingmaterial somewhat who attendancedoesn'treally soulfulselling... and a 51030). This budget thesubjectiveexcursions genuinestereoonthisvariable - 'Hard Woman warrantmuchattention. album includes the VARIOUS ORCHS. the bonus is the great OfT.V.Themes that characterised 'stereo -enhanced -mono' Is Good To Find' is a nice magnificent'Softly As I World L.G. (Decca SPA 217). Vienna Fudge. But they haven't labelled biscuit, like 'Love track as is 'Listen While I backgroundvoalistics by LeaveYou',oneofthe the Sweet Inspirations. finest of all romantic Phil , FrankChacksfield, come upwith anything No.9'(Clovers, Sing My Song.' A good BLONDE ON BLONDE London Phil Stuttgart Potion ballads. And a lively 'Fly new. The soundis New with 'No. 10' verse) andshowcase for Chris's THE DUBLINERS ReflectionsOf A Life Me To The Moon'. Chamber Orch.and The Hometown! (Columbia GrenadierGuards on a York heavy, touched by `Perfidia'(Ventures). writing abilities. (Ember NR 5058). Opens selection of rock & roll and the blues SCX 6492). Recorded live WALDO DE LOS RIOS predictable Other mono goodies atthe National Stadium, withsoundsofababy telly -series biggies. In A Romantic Mood and with some good lines includetrax from BROOK BENTON Dublin, hence the title - crying on 'Gene Machine' (A&M 51027). A 99p in freedom lyrics.It ain't andithastheraucous, DAVID SNELL Cochran, Domino, Lewis StoryTeller(Atlantic K -closing with a productionwithfamiliar veryspacedout,butit zestfulladsin top form. themes like 'Raindrops Harp Transplant (Pye (JerryLeeandSmiley) 40314). Recorded in three Asever, they'vefound conglomeration of sound. Quad 1002).Beautifully should appeal to Zeppelin some first-rate material to The lyrical contents here Keep Fallin", recorded set of harp solos, and others. Nothing rare,differentlocations,with 'Everybody'sTalkin'and freaks,fifth -formheads unknownorsurprising, somebrilliantmusicians suit their style - are blatant and far 'Something'. Some very withclassicaladaptations and IronButterfly traditional slices of stylisharrangements and one side and a heavy but a fine collection foronthevariousbacking Ireland, handsomely reaching,with'IDon't leaning on Bacharach and nostalgics. anyone whohaseither Care' an up tempo number instrumental blends. David on the other. Some tracks,thisissuper -class delivered. excellent backing WILSON PICKETT just gotten into r 'n' r, or about an incestuous JOHNNY PEARSON musicians like Barry Don'tKnock My Love whose London -American relationship; and 'Sad Song Sleepy Shores (Penny Morgan and Alan Parker. (Atlantic K 40319). Long 45s are showing excessive For An Easy Lady' with Farthing PAGS 525). version of the title track, wear 'n' tear. insistentharmonicaand JohnnywrotethetitleANNE MURRAY/GLEN theme, a big single hit -CAMPBELL split into two parts, is a lineslike'a and there are other Murray and Campbell stand -outdepartment on DENNIS COFFEY AND little man who's shoes are examplesofhiswriting (Capitol SW 869).Not skill an albumwhich THE DETROIT GUITAR brown, who doesn't live in herein, notably 'Lesjust one side each - a real sometimesslumpsfrom Deux Marionettes'. Good listeningliaisonbetween BAND this 01' town, only wants orchestral-cum-pianistictwostars who have had theusualhighPickett Evolution (AMLS 68035). his damperdown'. sounds. single hits previously. standards.Butthere'sa Coffey'sworkonthe Reflectionsofcynicism, Therearesongs like 'So goodreading the JOHN PRINE Easy To Love', 'Let Me Be of Randy Motownlabelhas disillusionmentand John Prine(Atlantic K The One', which build an Newman's 'Mama Told Me remained unheralded, but occasional influx of 40357). Singer and atmosphereofromance, Not To Come' and nowhis Sussexsingle sympathy and love. One acoustic guitarist, with and some very strong Wilson's harmonica works 'Scorpio' is a funk classic, group's view on life. The plenty of steel guitar string and brass evocatively on 'Mighty stories seemthemost featuredinthebacking. arrangements (by Rick he may getthe It's country -styledWilkins). This one should Long Way'. Tight, recognitionhedeserves. interesting aspect - which performances on suchas Sell very well. unrelenting backing group. The sounds are clean, hard may not have been 'Hello In There' and But the best track of all is intended! V.M. 'Pretty Good' and the MERLE HAGGARD and pure guitar - only evocative 'Flashback Someday We'll Look Back `Can'tJudgeABook', drums and piano intrude Blues'.And somevery which really goes some. (Capitol ST 835). Just onto the'orchestral' TONY BENNETT appreciativesleeve notes about thefastest -riserin from Kris Kristofferson. selection ofdifferent With Love (CBS 64849). a the contemporary country BARRY MANN guitarsoundshere,but music scene. Some of his Lay It AllOut(CBS Accompanied by the HENRY MANCINI own songs herein, plus a don'tcompareitwith Robert Farnon orchestra, BigScreen,Little Screen good onefrom Roger 64805). With a variety of Tommy Garrett. Mr. C is (RCA Victor SF 8257).Miller- and Dallas partners- PhilSpector, highly -charged and recorded in London - and Very polished themes, Frazier's'California Weil, dedicated to 'Frank Cynthia Mike electronically evocative. dressed upinpolished, Cottonfields', which is a Stoller,Gerry Goffin - Sinatra, king of the high -glossedarrangements, standout track. His music could be used entertainment and including that catchy Barry has created many a as well for a discotheque, world'.In piece from 'Cade'sPETER NERO hit. This Al Gorgoni THE FLIRTATIONS; can they overtake the fact,oneofthebest County'. Hank takes pianoSummer of '42 (CBS as for muzac, as for head Supremes? Bennett 64790). Looking hipper as production brings the best balladalbums, solo on 'Nicholas and listening.Versatile,huh? THE FLIRTATIONS lyrically Alexandra'andthere is the years go by, according of his singing style to the very strong other good solo stufffromto the sleeve picture, fore;too. The hits just CHRIS SPEDDING The World Of ... (Deram series,but always a fineindeed ... and the ma n trumpeter Graham YoungpianistPeterhereon a roll off ... `Lovin' The Only LickI Know SPA218).Soulgroup, group.Threegirlswho thrives on worthwhile and tenorist JeromeSteinway set which Is suddenly more to highlighted by that theme Feelin' ', a 'consistent (Harvest SHSP 4017). "rated" haveititin them lyrics.Trythebeautiful Richardson. Afirst-class through their work on the the album inasuper -melodicfrom the movie. Nice stand -out. A highly Christacklesjustabout overtake even 'Street of DreanW:.file - area. display of mood -changing.- organised set. thelot - vocals. CliffRichard television Supremes. (rem oream . 16 RECORD MIRROR-. April 1, 1972

,,,,%. , ...... 1,13:3rIe ,,..f., go4,1,,, , ...1,A 11; "9 !. AI,.,i''''.1,...,/a 4 f,..: -,ffis \-... ECOR 4-I r 1. , the50 IR < a. DAVID CASSIDY's first solo LP, 'Cherish' singles I - albums due in May from Bell Records RM's

NIGEL HUNTER pleased to receive a 1 1 8 WITHOUT YOU Nilsson RCA 2165 1 1 12FOG ON THE TYNE postcard from DANYEL GERARD 2 3 4 BEG, STEAL OR BORROW Lindisfarne Charisma CAS 1050 addressed to NIGER HUNTER New Seekers Polydor 2058 201 2 3 5HARVEST Neil Young Reprise K 54005 3 2 10 AMERICAN PIE Don McLeanUnited Artists UP 35325 3 5 6PAUL SIMON CBS 69007 ALICE COOPER, who 4 6 4 ALONE AGAIN (NATURALLY) 4 4 9NILSSON SCHMILSSON Nilsson RCA Victor SF 8242 should have arrived in Britain two weeks Gilbert O'Sullivan MAM 66 5 6 3THICK AS A BRICK Jethro Tull Chrysalis CHR 1003 ago, is in mourning over the death of his 5 9 5 MEETME ON THE CORNER 6 2 9NEIL REID Decca SKL 5122 boa constrictor LEONARD Lindisfarne Charisma CB 173 710 13GILBERT O'SULLIVAN HIMSELF MAM 501 BERNSTEIN accepted a Grammy on the 6 5 6 MOTHER AND CHILD REUNION 8 713BRIDGE OVER TROUBLED WATER Paul Simon CBS 7793 Simon and Garfunkel CBS 63699 live U.S. televised presentations while his 721 4 HOLD YOUR HEAD UP Argent Epic EPC 7786 912 3BABY I'M -A -WANT YOU Bread Elektra K 42100 `West Side Story' was capturing all the 8 7 7 GOT TO BE THERE 10 8 3WHO WILL SAVE THE WORLD rating figures on an opposing channel. Michael Jackson Tamla Motown TMG 797 Groundhogs United Artists UAG 29237 9 20 6 DESIDERATA Les Crane Warner Bros K 16119 11 11 13TEASER AND THE FIRECAT 10 184 FLOY JOY Supremes Tamla Motown TMG 804 Cat Stevens Island ILPS 9154 Next DEL SHANNON album on Sunset 11 8 5 BLUE IS THE COLOUR 12 18 4AMERICAN PIE Don McLean United Artists UAS 29285 features eleven tracks never before released Chelsea Football Team Penny Farthing PEN 782 13 --WE'D LIKE TO TEACH THE WORLD TO SING 12 4 9 SON OF MY FATHER Chicory Tip New Seekers Polydor 2383 103 in Britain LABI SIFFRE's 'Crying, CBS 7737 13 11 5I CAN'T HELP MYSELF 14 9 13ELECTRIC WARRIOR T. Rex Fly HIFLY 6 Laughing, Loving, Lying' leaping a Donnie Elbert Avco 6105009 15 15 6GRAVE NEW WORLD Strawbs A&M AMLH 68078 Mr. T. BLACKBURN announed last week, 14 19 5IT'S ONE OF THOSE NIGHTS 1614 13IMAGINE "and at number 16 is 'Give Ireland Back Partridge Family Bell 1203 John Lennon/Plastic Ono Band Apple PAS 10004 17 23 13TAPESTRY Carole King A&M/Ode AMLS 2025 To ' er....at number 16 is a record by 15 10 13 MOTHER OF MINE Neil Reid Decca F 13264 16 175 GIVE IRELAND BACK TO THE IRISH 181613A NOD'S AS GOOD AS A WINK WINGS for their first French release, Wings Apple R 5936 Faces Warner Bros. K 56006 will ARGENT revive 'Money'? a Mr. 17 12 8 POPPA JOE Sweet RCA 2164 19 26 3NICELY OUT OF TUNE Lindisfarne Charisma CAS 1025 T. BLACKBURN also said last week, 18 13 8 LOOK WOT YOU DUN Slade Polydor 2058 195 20 27 13JESUS CHRIST SUPERSTAR "Hope you all saw CLIFF RICHARD and 19 264 TOO BEAUTIFUL TO LAST Various MCA MKPS 2011/2 Engelbert Humperdinck Decca F 13281 2117 4MILESTONES Rolling Stones Decca SKL 5098 the NEW SEEKERS' version of 'I Can't 20 22 14 I'D LIKE TO TEACH THE WORLD TO 22 20 13THE NEW LED ZEPPELIN ALBUM Atlantic K 5008 Help Myself last Saturday". It was 'Baby SING New Seekers Polydor 2058 184 23 21 3THE MOTOWN STORY Tamla Motown TMSP 1130 Love' one of the SWINGLE SINGERS 21 34 3 WHAT IS LIFE Olivia Newton -John Pye 7N 25575 24 38 7I CAPRICORN Shirley Bassey United Artists UAS 29246 bears an uncanny resemblance to EDWARD 22 14 9 STORM IN A TEA CUP Fortunes Capitol CL 15707 25 13 3TOP TV THEMES John Keating/London Symphony (CALLAN) WOODWARD...... JOHNNY 23 16 9 DAY AFTER DAY Badfinger Apple 40 Orchestra Studio Two TWO 372 24 50 2 SWEET TALKING GUY 26 4311 CONCERT FOR BANGLA DESH BEERLING has been appointed an Chiffons London HL 10271 George Harrison, Bob Dylan and Others executive producer at the Beeb - nice 25 33 3 HEART OF GOLD Neil Young Reprise K 14140 Apple STCX 3385 going, JOHNNY. 26 275 THE BABY Hollies Polydor 2058199 2719 9HENDRIX IN THE WEST 27 23 8 FLIRT Jonathan King Decca F 13276 Jimi Hendrix Polydor 2302 018 28 32 4 BROTHER CCS RAK 126 28 2413EVERY PICTURE TELLS A STORY ALAN TAYLOR now gigging again after 29 2411 HAVE YOU SEEN HER Chi-Lites MCA MU 1146 Rod Stewart Mecury 6338 063 30 157 SAY YOU DON'T MIND 29 29 6THE CARPENTERS A&M AMLS 63502 a major operation. Hope he doesn't leave Colin Blunstone Epic EPC 7765 30 34 2LOVE STORY Soundtrack Paramount SPFL 267 us for America, as is probable great to 3141 3 BERNADETTE Four Tops Tamla Motown TMG 803 31 --GARDEN IN THE CITY Melanie Buddah 2318 054 welcome the comeback of both JERRY 32 47 2 SMOKE GETS IN YOUR EYES 32 44 8TEA FOR THE TILLERMAN LEE LEWIS (`Me And Bobby McGee') and Blue Haze A&M AMS 891 Cat Stevens Island ILPS 9135 LITTLE RICHARD Mock With The 33 -- CRYING LAUGHING LOVING LYING 33 45 10THAT'S THE WAY IT IS Labi Siffre Pye 7N 25576 Elvis Presley RCA Victor SF 8162 LINDA JONES, 27 -year -old King') 34 46 2 I'M GONNA BE A COUNTRY GIRL AGAIN 34 1 SPARTACUS Aram Khatchaturian/Vienna Philharmonic R&B artist on America's Turbo label, died Buffy Sainte -Marie Vanguard VRS 35143 Orchestra Decca SXL 6000 on March 14 from a diabetic 35 30 14 SLEEPY SHORES 35 - 1 GODSPELL London Cast Bell BELLS 203 attack the LAST POETS have formed Johnny Pearson Orchestra Penny Farthing PEN 778 36 4213MOTOWN CHARTBUSTERS Vol. 6 their own label, True Sound the 36 25 9 TELEGRAM SAM T. Rex T. Rex 101 Various Tamla Motown STML 11191 37 38 3 JESUS Cliff Richard Columbia DB 8864 37 40 7MEATY, BEATY, BIG AND BOUNCY Hudson Bay Music company - LIEBER, 38 29 9 MY WORLD Bee Gees Polydor 2058 185 The Who Track 24606 006 STOLLER and BIENSTOCK, have released 39 -- AT THE CLUB Drifters Atlantic K 10148 38 - 1 GATHER ME Melanie Buddah 2322 002 BOBBY DARIN to form his own company, 40 36 6 LOVING YOU AIN'T EASY Pagliaro Pye 7N 45111 39 --GRIEG AND SCHUMANN PIANO CONCERTOS Gabby Darin Music, Inc. 413112 LET'S STAY TOGETHER Stephen Bishop Philips 6500 166 Al Green London HL 10348 40 - 1 PAINT YOUR WAGON Soundtrack Paramount SPFL 257 42 THEME FROM CADE'S COUNTY 4135 5CLOSE TO YOU Carpenters A&M AMLS 998 Terrific T-shirts from UA featuring Henry Mancini RCA 2182 4231 2SOUND OF MUSIC Sountrack RCA Victor SB/RB 6616 43 TURN YOUR RADIO ON 43 - 1 CLOCKWORK ORANGE Soundtrack Warner K 46127 FATS DOMINO, RICK NELSON, Ray Stevens CBS 7634 44 - 1 LED ZEPPELIN II Atlantic K 40037 GROUNDHOGS, EDDIE 44 4214MORNING HAS BROKEN Cat Stevens Island WIP 6121 45 39 2FRANK SINATRA'S GREATEST HITS Vol. 2 COCHRAN JOHN and YOKO 45--I AM WHAT I AM Greyhound Trojan TR 7853 Reprise K 44018 46 - 1 AMERICA America Warner K 46093 working with the PLASTIC ONO BAND 46-- RUN RUN RUN Jo Jo Gunne Asylum AYM 501 47 -- IRON HORSE Christie CBS 7747 47 3213MEDDLE Pink Floyd Harvest SHVL 795 and ELEPHANTS MEMORY in America's 48 2811 ALL I EVER NEED IS YOU 48 22 3ANDY WILLIAMS' GREATEST HITS CBS 63920 Record Plant at last, the EVERLY Sonny and Cher MCA MU 1145 49 - 1 MOTOWN MEMORIES Various BROTHERS' album, 'Stories We Could 49 SACRAMENTO Middle of the Road RCA 2184 Tamla Motown STML 11200 Tell', is completed. It features GRAHAM 50 DOWN BY THE LAZY RIVER 50 --WEIRD SCENES INSIDE THE GOLD MINES MGM 2006 096 Doors Elektra K 62009 NASH, JOHN SEBASTIAN, DAVID Osmonds CROSBY and DELANEY & BONNIE among others. top producers 5 years ago 10 years ago WE regret that a printing dispute and the Easter holidays have prevented publication of the American charts and 1 Richard Perry 1 1 RE LEASE ME 1 the British Top 50 is repeated from last week. Record 2 David Mackay Engelbert 1 WONDERFUL LAND Shadows Mirror apologises to all its readers for this inconvenicence. 3 Ed Freeman Humperdinck 2 2 TELL ME WHAT HE SAID 4 Gordon Mills 2 2 PENNY LANE/STRAWBERRY Helen Shapiro 5 Bob Johnston 6 Paul Simon FIELDS FOREVER Beatles 3 3 R OCK-A-HULA BABY/CAN'T 7 Rod Argent/Chris White 3 3 THIS IS MY SONG Pet Clark HELP FALLING IN LOVE Elvis 8 Hal Davis 9 Fred Werner/Les Crane 4 5 ON A CAROUSEL Hollies Presley 10 Robinson/Wilson/Sawyer 5 4 EDELWEISS Vince Hill 4 9 DREAM BABY Roy Orbison 11 Larry Page 12 R. Easterby/D. Champ 5 5 LET'S TWIST AGAIN Chubby 13 Donnie Elbert Checker 14 Wes Farrell 1111111111811111M 15 Dick Rowe/Ivor Raymonde iesommis 16 Paul & Linda McCartney 17 Phil Wainman 6 - GEORGY GIRL Seekers 18 Chas Chandler 6 6 WIMOWEH Karl Denver 19 Gordon Mills 7 8 THERE'S A KIND OF HUSH 7 8 STRANGER ON THE SHORE 20 David Mackay Herman's Hermits 21 Harrisongs Acker Bilk 22 Cook/Greenaway 8- DETROIT CITY Tom Jones 8 4 MARCH OFTHE SIAMESE :eRseit7regs')isrs 23 George Harrison 9 6 HERE COMES MY BABY 24 Robert Mellin CHILDREN Kenny Ball 25 Kinney Tremeloes 9 - HOLE IN THE GROUND 26 Ron Richards 10 - SNOOPY vs. THE RED BARON Bernard Cribbins 27 Jonathan King The Royal Guardsmen 28 CCS/RP K 10 - SOFTLY AS I LEAVE YOU 29 Eugene Record Matt Monroe L_ 30 Rod Argent/Chris White RECORD MIRROR, April 1, 1972 27 28 RECORD MIRROR, April 1, 1972

' CO11/1/0,

HIGH COUNTRY (K 46134) JOHN HARTFORD: Aero Plain (K 46136) JOHN STEWART: The Lonesome Picker John Hartford's album features the Rides Again (K 46135) Bluegrass music makes a welcome return in traditional sounds the shape of High Country and in the light of fiddle, banjo, This album is a milestone in the career of mandolin, dobro,guitar and stringbass. John Stewart - anartiste whoisfast ofthe currentoldtime country revival And to quote a Toronto reviewer "It's a becoming acultfigure on both the folk both here and in the United States, this splendid Nashville jam, an exhilirating jazz and country scene. album is destined for greater things. countryfeast,andsomeofthemost intricate and thoroughly satisfying music you can hear.

Andy Williams The Impossible Dream

Bridge Over Troubled Water S,newhere, My Love Love Themefrom RonseoAnd What Now My Low Love Is Blue They Long To Be Close ToYou I Will Wait For You Didn't We Both Sides Now My Sweet Lord A Mon And AWoman Eliondor Paso Good Morning Starshine My Cherie Amour Spanish Harlem He Ain't Heovy. Hes My Braises. Long Long rime The LostTime I Sow Her The Impossible Dwain Someone Who Cares

JOHN D. LOUDERMILK: Volume 1 -- ANDY WILLIAMS: The Impossible Dream FISHBAUGH FISHBAUGH AND ZORN: Eloree (K 46124) (CBS 67236) FF&Z (CBS 64Y83) 'Eloree'isa superb vehicle for the divers Virtually every track on this new double "Our music is people's music", says Pete talents of John D. Loudermilk - he runs albumfromAndy is a contemporary Zorn explaining the aim of his new group. thegamutofhuman emotions on an standard. 'What Now My Love'. 'A Man This offshoot of the New Cristie Minstrels album whichcan only be describedas And A Woman' are just two of the finest playbeautifulsoftrock - in a very brilliant. collection of love songs ever put on record individual way. An acoustic extension of - bythegreatestinterpreterofsuch themselves withideas drawnIn, formed material around today. and blown out natur411y.

11.1 G.. a...4 lootatl..6 Como... My Atm town 14.boto Pay .14tto hi C.a. eons To le. 11164. NIL. 4 1.1.3 b In to. Mcgt outu Mo. y 114eata Donn...n allkn MARTIN CARTHY: Shearwater (PEG 12) GOLDEN HOUR OF GENE PITNEY'S OLIVIA NEWTON -JOHN (NSPL 28155) Thisisthefirst solo album from Martin GREATEST HITS (GH 805) Olivia Newton -John has emerged as one of Carthy since he left Steeleye Span. Martin Gene Pitney fans get real value for money the most popular female singers of today musically continues to improve and expand on this Golden Hour album. Itnot only and hit records apart she makes this first with a vitality which this record reflects. features his latest single 'IJust Can't Help album a memorable listening experience. His renditionoftraditional songs is Myself' but also catalogues his success with The choice of materialis wide and really complimented byhis unique guitar style, such memorablemillionsellers as '24 reflects Olivia's talent as an artist who is andthis album really underlines why his Hours From Tulsa', 'Town Without Pity' goingtobe around for a long time to club performances are so popular. and 'Liberty Valence'. come.

Cti(10(.. et RAY SAN FRANCISCO DUES

TOY STAR FESTIVAL (6830 100) CHUCK BERRY: San FranciscoDues JON HENDRICKS: Times Of Love (6414 An unusual artistic achievemedt endorsed (6310 115) 302) by an honorary panel of Burt Bacharach, Oh Lousiana; Let's Do Our Thing; Your Beautifulalbumofstandards from Jon Dave Brubeck,DukeEllington, David Lick; Festival; Bound To lose plus Hendricks,founder member andleading Frost, PaulMauriat.Sixteentitlesby BordeauxIn My Pirough; San Francisco lightofthe famous Lambert, Hendricks extremelyhighpowered talent including Dues; Viva Rock And Roll; My Dream; and Ross jazz influenced vocal trio. Jon's ArethaFranklin,AndyWilliams,Nana Lonely School Days. A brand new album Pick this one up on Philips new Mouskouri, Val Doonican, Neil Diamond from Mr Rock and Roll himself,not a 'Applause' series at £1.50. and Engelbert Humperdinck. Great value at reissue. A must for anyone who saw him £1.50. last week on tour. ALL SLEEVES ARE ADVERTISEMENTS RECORD MIRROR, April 1, 1972 11

COUntlifiti7leSPECIAL WEMBLEY SECTION Meet the artists at stand No. 8 VISITORS tothisyear's Wembley 2.30 Margo at stand No. 8. LynnAnderson,JanHoward and festival will have the opportunity to 2.40 Tex Withers Another highlight of thisyear's LorettaLynn; TopU.S. group - meet their favourite artists in person 2.50 Country Fever festivalwill be the presentation on Tompal I and Glaser Brothers, at the Record Mirror/Billboard stand. stageat Sunday night's concert of Numbers and Statlers; Top song - Alltheartistsappearinghave the Record Mirror/Billboard country 'Help Me MakeItThroughThe agreed to visit the RM stand to meet SUNDAY: awards for 1972. A famous celebrity Night' and 'Me And Bobby McGee', fans and sign autographs. 11.30 am Hank Williams Jnr. wil! make the presentations to most bothby Kris Kristofferson and Hereisa complete rundown on 11.40 Anne Murray oftheartiststhemselvesonthe 'Stand By Your Man' by Billy Sheri!! the scheduledtimes the artists will 11.50 Tom T. Hall Wembley stage. and Tammy Wynette. be appearing: 12.30 pm ... Bill Anderson -Jan Howard The winners' names willnot be In the British section, the SATURDAY: 12.40 Earl Scruggs revealed before the presentation. But following were nominated: Top UK 11. 30 am Del Reeves 12.50 John D. Loudermilk the nominationsforthisyear's solo performer -Tex Withers, 11.40 Dottie West awards have been selected. Brian Golbey and Larry Cunningham; 11.50 Stoneman Family 2.30 Ray Lynam They are as follows: Top UK group - Jonny Young Four, 12.30 pm George Hamilton IV 2.40 Larry Cunningham TopU.S. maleartist - Slim Hillsiders and Country Fever; Most 12.40 Loretta Lynn 2.50 Jonny Young Four Whitman, Hank WilliamsJnr., and promising talent - Syndicate, 12.50 Conway Twitty Make a note - Record Mirroris Hank Snow: Top U.S. female artist- Tennessee Four and Western Union. HEARD ANY good cowboy songs recently? No? Well, that'snotwhatit'sall aboutanyway- isit? Timesand ImageshaveCountryinvadesthe City changedand country It's that music which shouldthat"Helpme makeit tighter musicmoreother camps. Whatever theWithin acoupleof yearsexpandinginconcept and music's appealis now just be brought to the attentionthroughtheNight", "Forcompatible to the music of amusic - and who can drawthis composer has risen tothe barriers are being as firmly rooted in the cityof the cynics: they may betheGood Times",rock generation. Waylonboundaries these days? - italmost brokendownwith as it is in the country. cultfigure equal listening to it, liking it and"Morning", "Did youJenningsandJerryReedstandsout as a superbproportionsbut swiftness. It leads, The sooner some bigoted westill not realising that it'sever?" or even "Knock threemay lead a field whose musicexample of outstandinghavetowait for someoneultimately,toasituation ideas are locked away andcountry! times" were originally is suitable forpopcraftsmanship. outsidecountry realms towhere it becomes unhealthy the key destroyed the First,let's view change.country music? enthusiastsbut there's The album also throwspronounce him country! tolabela music.It could scenewill Yes, country musicplenty of other contenders easily happen here! notA contemporaryband of light upon current Nashville Country music is rapidly become. That's the may have seems to be stuck unjustly,which include Freedy Weller, preaching to the converted thirties background. It was featuredfiddle,guitar andwith outdated stigmas. KennyVernon,Anthonyproduced in sessionman - they already know thebanjo. Forty years later the ButtoreturntotheArmstrongJones,Johnny facts but it's an WayneMoss' "Cinderella - line-up becomes amplified: itquestion in handwhichPaycheck among theirSoundStudios" and opportunitytopresenta concerns a growth of music doctrinebefore thefeaturesguitars and numbers. featuresthe appearance of drums and any otherbearing a definite A new movement wasThe Nashpilharmonic - an uninitiated. It's a chance to association with countrycreated when some of the letthecynics know thatinstruments the record impressivesounding name producer may thinkmusic. It takes a number oftop names in folk decidedgiving out with an countrymusicisatrifle forms:there's the countryto record in Nashville. Joan more than riders on necessarytocreateahit impressive sound! But, wait sound. In some cases a full artistsstretchingtowardsBaez and Bob Dylan were a minute, it's another horseback and plastic pop, thepop artistat the front of the six-shooters. orchestrais employed:It's example of Nashville not so much the sound butstretching towards country,spearhead but were quickly craftsmanship.It'smainly Let's putthings into a the musician who plays forfollowed by others - not little more proportion. Sureratherthe"feel"of the the work of three musicians materialthesedaysthatboth pop and countryallfrom folk realms. The(Wayne Moss, Weldon there's the more traditional artists and the songwriterssubsequent results not only elements and they do playmakes a record country. Myrick and Buddy Spicher) Naturally it leadsto whoarebringinga newbroughtfreshrevaluationsand considerable skill in the animportant partinthe intelligence to lyrics. upon theartistsbut also music known as"countrystrange situations. Ray Price mi,:ing studios! and EddyArnold,both Some country artistsbrought into prominence the andwestern" . . . but Mickey Newbury is also stalwartsofthe Americanrecord withorchestras yetskillandabilityofthe YOU'LL FIND MORE there's also a more importanttothecurrent country scene, now recordretainthebasicsimplicityNashville sessionmen. commercialside tothe Ifleft to countryscene foranother with orchestras more fittingassociated with country theirown music.It'sthat devices these musicians canreason.He isoneofa COUNTRY IN THE to a pop environment thanmusic inother words commerciality that has - produce some growing batch of new acountryone.Yet theirthere's still the basic three or pretty moved with the times and fantastic sounds. songwriters bringing a new records make thecountryfour chord progressions. Witness MIDDLE OF has progressed into a themusicalexcursionsofimage tolyrics:he, like a charts. On the other hand ifThrough this move the number of others, are musical sphere that isJoan Baez records with a "Area Code 615." On these rapidly breaking down the artist hascaptured therecordings addingpersonal standardNashville countryattentionofthecityfolk werethesame BOND STREET barriers. musicians who sat on interpretations by recording The artists appearing ataccompaniment her recordsbutstill remains faithful to their material. only make the pop charts.his country image. Only it'sstraight country sessions, the THAN ANYWHERE this year's InternationalIt'sall a case of who paysnow become a sophisticatedsame who added their talents Country songwriters have Festival prove the versatilitythe dues. to the Nashville recordingsbeen recording for a of countrymusic.Ithas country image! of Ian and Sylvia, Joan Baeznumber of years- Hank ELSE INBRITAIN becomefar more Country music is RayPricehasprovedand Gordon Lightfoot. NowCochran,Harlan Howard cosmopolitan andbecoming, more and more,himself the most successfulthey were creating their own andJohnD.Loudermilk sophisticated:that'swhata state of mind. A music'sof this new breed. He rosemusicalthing:standoutmost has made the music a $200label can create or restrict ato his greatest heights withsuddenlythecynicswhopredominantly-butit's million industry in thedemand: in thecaseofthe Kristoffersonpenned wereusuallyso quickin only recently that this trend United States and hascountry music, in the "For the Good Times" andcondemning the majority ofhasgrowntoimportant attracteda larger audienceBritishIsles, the demand ishas become one ofNashville product foundproportions. Tom T.Hall top paid thaneverbeforein itsrestricted. Here the music isAmerica's themselvespraisingthoseprobably led the processionYOUR WEST END COUNTRY MUSIC history. doggedwithfalseimagesentertainers. The record wassame musicians. and,whilehisrecordings LATEST U.S. IMPORTS The upsurge andand values and non -countrypracticallyignored on the TheNashvillemusicianshavegatheredtremendousCENTRE FOR ALL broadeningofthemusicenthusiastsdon't wantto Britishmarketandnow,arenotcontenttoplaycountry acclaim, it was Kris has, naturally, upset manyknow. some fifteen months later,straight country orKristofferson who brought ofthetraditionalistsand But consider for a the album makes its belatedimprovise. Nashvilleis nowthesituationtonational r# some British country musicmoment some records thatappearance. "For The Goodproducing,forlackofarecognition. harlequn enthusiasts are distressed byhave made the British Times" (CBS 64639) is wellbetter word, "contemp- Kristoffersonpersonifies the current product corningcharts. How many conjuredworth a listen: it's a superborary" country. the new Nashville. He's so from Nashville and the Westupthoseold impressions:example of "cosmopolitan" A premierexample is definitelycountryyet he Coast.Butthencountrydidyouspotanywhile country. There's the smooth Mickey Newbury'salbumstands for everything against119 NEW BOND ST. LONDON W.1. music, like any otherlistening to"Snowbird",orchestrationsand"Frisco Mabel Joy" (Elektratheoldculture: along OR VISIT OUR STAND AT THE musical genre, has to"Harper Valley PTA", arrangements, fine vocalsK42105): it's a further stephaired representative from a FESTIVAL OF COUNTRY MUSIC progress in order to survive."Rose Garden" or "A Boyand outstanding lyrics but, inaprogressivesituation.revolutionary generation Fortunately a goodnamed Sue"? throughout,itstillretainsNewbury emphaticallyKristofferson had to break We are at yourservice to sort out percentage of contemporary And while on thethatbasiccountrystatesthat he andhisdown many barriers before those difficult to find albums. recordings have notsubject,if you're going tosimplicity. materialarecountry,yethe could succeed. farfrombasiclabel music At the other end of the Success has finally come wandered whatabout the album will be disowned WORLD WIDE MAIL ORDERS country roots. But what ofsome credits where creditsscale are the country artistsby the majority of countryand his lyrics have brought theremainingpercentage?are due? Who told anyonewho are making a heavier,fansandpraisedbythea new prestige to the music. 12 RECORD MIRROR, April 1, 1972 Wembley Artists Wembley Artists Wembley Artists Wembley Artists Wembley Hank Williams Jr John D. Loudermilk TO BE BORNwith a be gone". THIS YEAR'S Wembley But it's not been famous name can be both a Festival is laying restrictedto country. This and Lastyear'sappearance blessing burden. presentedtotheBritish considerable emphasis upon composer's pen has pushed Obviously it brings country music public (and the singer -songwriters. material over into the pop immediateattention a to therewere manyoutside There's Tom T.Hall and market. Remember "Google well known name butit this circle who were Bill Anderson: now add the Eye", "Tobacco Road" and, also brings comparison. impressed)anartistwho name of a man who has more recently, "Indian More often than not it's a displayed tremendous done considerable work Reservation"? comparison by name only behindthe country music versatility, unending stamina Likethemajorityof without paying attention to and act full of msuic with scenes. John D. Loudermilk theartist's own individual countrymusic songwriters littlechat. There are very had his first big hit with "A merits.InHankWilliams John D. Loudermilkhas few artistsaroundwho RoseandaBaby Ruth" Jr.'s case it was a also been tempted to record possesstheshowmanship whhn George Hamilton IV comparisonwithoneof recordedthe number way his own material. It's that abounds in the HankTom T- brought forth success with music's most country The American publicWilliams Jr. act! back in 1956. Since those famous and revered figures.havelongrecognisedhis early days success has never"Waterloo", titles like "Road Hog" and Ernest"Language of Love". Before he could start hiscontribution to the Popular demand has turneditsbackontheAshworth hadhisbiggest own career he had first tocontemporarycountrybrought him back and thereHall writer from North Carolina.successwith"Talkback One hopes that Wembley live down the hue and crymusicscene.It'sapparentwillbemany newfaces Many people areTrembling Lips" and Georgewill give John D. that the newcomer was butconstantly in thechartswatching the act this yearONE OF the most eagerlyextremely grateful thatHamilton IV followed initialLoudermilkevery a pale imitatorofhiswith an array of hit paradewho heardaboutitafterawaited visitors from MusicJohn D. Loudermilk camesuccesswithotheropportunity to show off his famous father. But hematerial which includesthe eventlastyear. HankCityU.S.A., Tom T.HalluponthecountrymusicLoudermilk compositions fine songs and musical overcamehisadversity bynumbers like "Standing InWilliamsJr.has overcomehas already establishedscene. StonewallJacksonlike "Break my Mind" andsense. He's a creative person establishing himself notThe Shadows", "It s all overthe unjust comparisons: he'shimselfbyreputationashad hisfirstbig hit with"Abilene". in every sense of the word. onlyasafinesinger butbut thecrying","Cajuna brilliant entertainer is hisone of the outstanding new alsoas an able songwriterBaby", "All for the Love ofown right and he'll prove ittalentstohavehitthe andoutstandingmusician.Sunshine" and"I'dratheragain this weekend. contemporary country music scene. Earl Scruggs More than being justa TO many people the nametwenty one year fine - many consider him partnership. brilliant - songwriter, TomEarl Scruggs will ring Both artists Del Reeves synonymous withthatofwere to pick up the pieces has made hismarkasa his ex -partner Lester Flatt.separatelyandstarttheir WHEREAS the majority ofNorthCarolina,bornin musicaljournalist.He has artistsappearingatthisSpartaon14July1933. that unique ability to relateThose were the old days:own bands. the team The result of the split on year's festival are relativelyInstead of heading towards in musical terms the days when the well known to the BritishNashville, Del madehis were, along with theirEarl Scruggs' part was the experiences and events that of public, Del Reeves remainsmove towardstheWest make up life: but it's moreformerbossBillMonroe,formation the Earl an unknown quantity. Coast. It turned out to be a rulingthe bluegrass roost.Scruggs Review. than relating. The writer hasThe days when they also The Earl Scruggs Review He's one of those artistshighlysuccessfuldecision. anawarenesstosituation who suffers through lack ofFor four years he headed and can install depth thatcaught a wide public's eye isa combinations of youngbe seen but the lineup seen with such numbers asand old ideas. It has to be record releases. Possibly hishis own television show and makes the listener involved in America is a pretty greatest claim to fame was a that way because Earl also spent a couple of those inthe 'FoggyMountain formidable collection of musical experience. Scruggs,long 1965 success called "Girl onyearsworkingLasVegas' Breakdown' (usedfor the regardedas musical talent. theBillboard"Itwas a "Golden Strip" series called "Country Although Tom T.Hallfilm'BonnieandClyde')master of his profession, is catchy, t o ngu e -twisting, Carnival". canwritewith depth, heand'TheBalladofJednow joined by a bunch of WatchEarlScruggsat truckdrivingsongs which In 1966hereturned This weekend the Britishalso possesses that necessaryClampett' (from TV'sequally talented youngWembleyandthem form broughttolighthis noweastwards,settled inpublic can, for the first timecommerciality which makes'Beverley Hillbillies'). musicians. your opinions. The group famous "doodle-oo-doo-Nashville, became a memberexperience the Del Reeveswriting a profitable career. LesterFlattandEarl How many members ofcouldveryeasilybethe doo". of the Grand Old Opry andstage act.It'sexciting andWitness the success ofScruggswenttheirownthe actual Review takes the highlightofthetwo-day Del Reeves is a native ofstartedafreshtelevisionvisual. "Harper Valley P.T.A.". ways in March 1969 after aWembley stage remains to event.

6 beautifulcounirgsides

THE WORLDEver wanted your own juke box of country OF COUNTRYclassics? Here's the next best thing. Twenty great artists singing and playing twenty GIANTSall-time great country tunes. Johnny Cash; Marty Robbins, Lynn Anderson, Jody z record setMiller, Carl Perkins, Earl Scruggs. All the 66286giants are on this album.

THE WORLD OF COUNTRY GIANTS 4. EARL SCRUGGS: EFORMANCES HIS FAMILY AND FRIENDS Johnny Cash/Ray Price INCLUDING: Marty Robbins JOAN BAEZ/BOB DYLAN Tammy Wynette THE BYRDS/DOC WATSON Jerry Reed AND OTHERS Lynn Anderson Jody Milier Freddy Weller and others HIS FAMILYProbably no other single instrument AND FRIENDSin history has brought about such acclaim fr,Orn diversified audiences EARL SCRUGGSand critics as has the five -string banjo in the hands of Earl Scruggs. His family and friends - including Bob Dylan, Joan Bacz, Doc C F35 Watson, The Byrds - pay homage to his brilliant pickin' on a (40THE COUNTRY MUSIC PEOPLE memorable album. r ; r7.7 7 7 ' 7 .7 '7 '7 7 1

RECORD MIRROR, April 1, 1972 13 Wembley Artists Wembley Artists Wembley Artists Discography

ALBUMS currently listed in the respective record companies George Hamilton IV catalogues: Well, George's dream did GEORGE HAMILTON IV is come true. But he first hit BILL ANDERSON best-known Always Remember MCA MUPS 446 probably the the bigtime with a pop song For Loving You (Duets with JAN and most popular in Britain MCA MUPS 337 "A RoseAnd A Baby HOWARD) of all of America's country Happy State Of Mind . MCA MUPS 392 Ruth- which was a artists.He has visited and If It's All The Same To You million -selling smash hitin (Duets with JAN HOWARD) MCA MUPS 415 appeared here many times 1956 and he had another My Life MCA MUPS 400 and had the distinction of Where Have All The Heroes Gone MCA MUPS 428 huge hit in 1958 with "Why Wild Weekend MCA MUPS 413 his own TV series on BBC -2 Don't They Understand". which was followed by 'Up However, in 1959 George COUNTRY FEVER Country' again on BBC -2 in abandonedthepop scene Listen To The Country Fever Lucky LUS 3003 which George was the host. and moved to Nashville to A New Dimension Lucky LUS 3013 Marvin Rainwater Gets Country In addition to his own try and get back to his first Philips 6414110 singing spot, George was the Fever (Vocals by Marvin Rainwater) interested in country musiclove - country music. The very -popular compere at last following year he Stoneman startedabandinhigh was LARRY CUNNINGHAM year's Wembley festival and signedto RCA byChet Country -My Way Release SRL 3004 he will do so again this yearschoolcalled the Release SRL 4009 Stoneman is a country Serenaders. Later I had oneAtkins and that in a sense This Is Larry Cunningham musiclegend: heraised on the Saturday night. calledtheCountrywas therealbeginning of thirteen children and inbred George's career as a country TOM T. HALL Family George has alwaysGentlemenwhich Ithink them allwithhiskeen singer. Homecoming Mercury 6338 004 wantedtobeacountrywe stole from a record by Mercury 6338 073 A VEIL of secrecy seems tomusical sense. He'sone In Search Of A Song singer. "By the timeIwasChetAtkinscalled Since then he has lieover the appearance of 'The musician whose never had 12yearsold I was veryCountry Gentleman'. progressed slowly but surely The Stoneman Family thistheproblem of findinga influenced by country tohis present positionat GEORGE HAMILTON IV weekend. Details about the "Duringtheseyears I The Best Of George Hamilton IV RCA LSA 3005 replacement for his band! music", he says."I had ahad this dream of wantingBritain'sfavourite, country Canadian Pacific RCA SF 8062 group's personnel or current Tradition has beennewspaperroundatthat music artist. Down Home RCA LSA 3024 to bea countrysinger.I RCA LSA 3043 recording contract are morepassedonfromthelatetime and I saved up my After his Saturday stint Heritage (with THE HILLSIDERS) than just a trifle difficult to was very impressed by the West Texas Highway RCA LSA 3060 "Pop" Stoneman. His sonsmoney to go to the GrandsingersI saw in person likeat Wembley George heads obtain. and daughters now form theOld Opry. Eddy Arnolk, Ernest Tubbnorth for a week's cabaret But one need not worrycurrentStonemanFamily atthe famed Batley Club. JAN HOWARD (see also listing much longer. Come "As I got more and moreand Hank Snow. under BILL ANDERSON) and theirartistry seems to Jan Howard MCA MUPS 414 Saturdayeveningandallknow noboundariesor Rock Me Back To Little Rock MCA MUPS 444 willberevealedtothelimitations. The group can enquiring mindsof thetacklecountry,bluegrass, audiencegatheredwithin Terry McKenna JOHN D. LOUDERMILK pop or folk with equal ease Volume I - 'Elloree' Warner Bros K 46124 the seating ' area ofand perfection. Wembley's Empire Pool. When the WITH his own compositionfirstsingle,of'The Key' Stoneman RAY LYNAM Inthe meantime some 'TheKey'countrynaturally, hasjustbeen Family steps uponthesinger/songwriter Hillbilly Country Release BRL 4007 consolation with a few factsWembley stage you'll be in Terryreleased. Meet Ray Lynam Release BRL 4017 aboutthe groupastheyfor a musical treat. They'reMcKenna won a nationwide Promoter ofthe existed a number of monthshappy, infectious act whichcompetiton,sponsoredby the Wrangler jeans people,Wembley festival and boss LORETTA LYNN ago. can stop a show! They are of Carnaby, Mervyn Conn Coal Miner's Daughter MCA MUPS 427 which resulted in a free trip Foropenerstheone ofcountrymusic's saysofTerry:"Hehas Loretta Lynn MCA MUPS 338 Stonemans possess a namemost successful groups:to Nashville and a recording Loretta Lynn Writes 'Em And contract. written some really strong Sings 'Em MCA MUPS 417 that is as much a apart oftheirsecret is plain materialbutwhatmakes Loretta Lynn's Greatest Hits MCA MUPS 385 countrymusichistoryasentertainment and an ability Born inPeterborough,him specialishis flair for We Only Make Believe (with country music itself.It's ato communicate with theirMcKenna will sing his songsinging what he composes. I CONWAY TWITTY) MCA MUPS 429 atthe festival on Saturday Wings Upon Your Horns MCA MUPS 407 revered and respectedaudiences.Thisyearsees think he'll be a headliner by You're Looking At Country MCA MUPS 447 named passed down fromtheir debut appearance ...as a special guest. the timewe'reputting Your Squaw Is On The Warpath MCA MUPS 411 their father Ernest V.be sureitwon't be their He has been signedtotogethernextyear's "Pop"Stoneman."Pop"last! the Carnabylabel and hisfestival". to next page

2368 013 Moonshine Sampler featuring 2353 013 Mel Till is Greatest Hits Hank Williams Sheb Woolley 2354 005 Ben Colder Luke the Drifter Volume 2 Tompall and the Glaser Brothers Billy Walker 2353 012 Don Gibson All for the Love of Sunshine Osborne Brothers with the Mike Curb CongregationHank Williams Junior Stoneman Family Coming soon Marvin Rainwater Your Cheating Heart Tony Booth soundtrack PRICE 99p 14 RECORDiviiRROR, April 1, 1972 Discography Wembley Artists Wembley Artists Wembley Artists from previous page MARGO Bill Anderson Margo And The Country Folk Ruby RLB 1003 From Margo With Love Ara ARAL 1001 RECENTLY Bill Anderson turned upasaguestof ANNE MURRAY George Hamilton IV on the Anne Murray Capitol E -ST 667 `Up Country' television Anne Murray And Glen Campbell Capitol E -SW 869 series. Both these artists are Snowbird Capitol E -ST 579 Talk It Over In The Morning Capitol E -ST 821 back this weekend and are holding vital roles as comperes as well as DEL REEVES entertainers.Georgelooks Del Reeves Sings Jim Reeves Hallmark HM 564 aftertheproceedingson SaturdaywhileBilltakes charge on the Sunday EARL SCRUGGS evening. Earl Scruggs: His Family And Friends CBS 6477 Forthose people Great Country Hits (LESTER FLATT unfamiliarwiththeextra AND EARL SCRUGGS) Hallmark HM 535 Kings Of Bluegrass (LESTER FLATT smoothAndersonactas AND EARL SCRUGGS) Hallmark HM 559 seenon his two previous stagevisitstotheBritish Isles, the television Dottie THE STONEMAN FAMILY appearance would have No Current Albums Available provided a clear - although Universitygraduate, brief - indication of whatsportsman,journalist,disc to expect during thejockey...BillAnderson CONWAY TWITTY performance of 'Whispering West Conway Twitty MGM 2351 006 eventuallybecame MCA MUPS 386 Bill'this coming weekend.recognised Darling You Know I Wouldn't Lie asasongwriterTHE exciting thing about a Fifteen Years Ago MCA MUPS 426 Bill Anderson is aofparticular merit MCA MUPS 342 by Here's Conway Twitty masterfulsongwriterwithproviding the country musiccountry music festival is that I Love You More Today MCA MUPS 404 it provides its audience with numerous titles to hisworldwithfinematerial I Wonder What She'll Think About a great varietyof Me Leaving MCA MUPS 443 credit. The success of hislike 'City Lights','I missed Next In Line MCA MUPS 363 me', 'The contrastingmusicalstyles. MCA MUPS 412 tradeis not limited to the Tip OfMy To See My Angel Cry country music fieldor toFingers' and 'Once A Day'. Dottie West's turn uponAnne Murray the UnitedStates: witness His success as a the stage will represent the the successfulchart smooth,modern approachCANADA has DOTTIE WEST songwriter must be playedanphysical education teacher. Careless Hands...... RCA LSA 3048 appearances by Frankiecontributed to a to the music. She is important role in the An interest in folk music Have You Heard RCA LSA 3062 McBride (`Five Littleperceptiveness for detail andcharacteristicof Nashville'sAmerican countrymusicbrought her to Toronto and Fingers')and KenDoddpersonal experience. It mustcurrent sophisticated scene.It'sprovided Hankeventually landed her place `Still' and 'Eight By Ten')also lie within the ability tocountry singer: she can sellSnow and Wilf Carter bothon a CBC folk music HANK WILLIAMS JR. inourownBritishpopidentifywithothersandtocity folk as well as the hailingfrom Nova Scotia;television show. For The Love Of Sunshine (with charts. However itiswithsharetheir reactions.Itismore rural audiences. more recently there's been Since hitting the big tune MGM 2353 012 MIKE CURB CONGREGATION) country that the Andersonwithin thefield of human With the greatest of ease theartisticandwritingshehasnotforsaken her Hank Williams Jr. Greatest Hits MGM 2353 013 pen and talent really excels Hank Williams Jr. Greatest Hits emotions that the BillDottie could cross over thecapabilitiesofRay Griffroots. Although she travels itself. Vol II MGM 2353 053 Anderson skillisthe most line andenterthepopand Stu Phillips. constantlythroughout the Luke The Drifter Vol II MGM 2354 005 Hestartedoutinthesuccessful. musicalfieldsandbea One also must not forgetUnited States and Canada, music business primarily as When Bill Andersonsuccess. $he could but sheGordon Lightfoot who hasshe stillusedCanadian studiosfor a writer and then later wasappears with his group Thewon't .. .she's a "countryprovided much hitparademusicians and TEX WITHERS recognised as a singer. HisPo Boys beprepared forgirl" and her preferences liematerialtothecountrythe majority of her Avenue 027 Tex Withers Sings Country Style background isvariedandsome fine examplesofwith that music. recording artist. A couple ofrecording sessions. serves as a usefulcountry sentimentality. He Morerecentlyshehas She'sanother of thoseyearsback another contribution to the wealthis one of the finest Canadian writer, Genejoined up with another big artists making a debut THE JONNY YOUNG FOUR of experience needed for aperformers in this particular McLellan, provided anothername:in the current No Current Albums Available. appearance this weekend on writer's trade. field. pop -country scene.After thisside ofthewater.of Canada's home grown product with chart success.someconcertappearances Dottie'sfromNashville - withGlenCampbell,she inShe was Anne Murray and althoughborn the song was 'Snowbird'. landed herself a regular spot McMinnville,Tennessee- on his successful `Goodtime andisaregularonthe `Snowbird' came out inHour' television series. The Grand Ole Opry. the latter part of 1970 andresult of this pairing can be was, as everybody knows, a She istypicalofthe determined by British fans massivesuccess.In factit BIG COUNTRY rural background that is the by takingalistentothe easilyclearedthemillionnew release 'Anne Murray childhood of so many mark. An instantly catchy countryentertainers. A And Glen Campbell' numberwhichhassince(Capitol E -SW 869). determinedandambitiousbeen recorded by numerous lady,herchildhood knewothercountry artists, When Anne Murray' butmany little luxury `Snowbird'owes much ofmakes her debut Wembley hardtimes: one of ten itsinitialsuccesstotheappearance she'll be adding children, she regularly savedfresh, young voice that sanganother dimensionto that moneyonce shestartedthe words! rapidly growing field called working in order to pay for country music. This a musical training. Anne Murray follows inattractive 25 -year -oldwill the She's been in the successful footsteps ofbe winning many new fans her as recordingbusinessfor a fellow Nova Scotians. wellaslettingthe old dozen or so years and firstBorninSpringhill,Novafans have a chance to see really attracted the public'sScotia,shestudiedat thethe singer that made eye (or rather ear) with herUniversityof New`Snowbird' a country music composition'HerecomesBrunswick and was a former standard! mybaby'in1964.She followedthat success with greater success in the form ofaduetrecording with Jim Reeves entitled 'Love is BURLINGTON no Excuse'. Over on this side of the PALACE Atlantic RCA have issued a couple ofDottie West albums inthelastfew MUSIC months (`Careless Hands' - LSA 3048 and 'Have you Heard' - LSA 3062). No doubt many of the country 9 Albert Embankment, musicenthusiasts inthe British Isles have now acquainted themselves with London, S.E.1. The 40 page April issue of COUNTRY her fine voice - Wembley will provide the opportunity 735 2692 is on sale now for 20p. It brings you to savour the stage performance. the whole scene from hillbillies and Dottie West greatly enjoysthemusic business Bluegrass, to Brinsley Schwarz. andcaninjectthemost mediocre of material with style and perfection. When Representing Country See us at Stand 5, Wembley. youseeheruponstage you'll not only be seeing a Music in this country greatsingerbut a fine entertainer and an attractive andall countries lady. RECORD MIRROR, April 1, 1972 1S

GEORGE DOTTIE HAMILTON IV WEST WEST TEXAS HAVE HIGHWAY YOU LSA 3060 HEARD LSA 3062

tiksss LSA SERIES £1.69 EACH DPS SERIES: FAMOUS COUNTRY MUSIC MAKERS GREAT DOUBLE ALBUMS £2.99 EACH CHARLEY PRIDE SINGS HEART SONGS LSA 3052 SKEETER DAVIS LOVE TAKES A LOT OF MY TIME LSA 3054

LESTER FLATT FLATT ON VICTOR LSA 3059 JIMMIE RODGERS VOL. 1 MFUSIC SMAKERS DPS 2021

PORTER WAGONER SINGS His OWN LSA 3058 JIMMIE DRIFTWOOD VOL. 1 fI DPS 2022 CONNIE SMITH THE BEST OF CONNIE SMITH LSA 3055 HANK SNOW VOL. 1 I/ DPS 2023

JIM REEVES MY FRIEND SF 8258 EDDY ARNOLD VOL. 1 Of DPS 2024

ssefatils sslOks VISIT RCA AT THE INTERNATIONAL FESTIVAL

JERRY REED NASHVILLE UNDERGROUND LSA 3056 OF COUNTRY MUSIC JIM ED BROWN SHE'S LEAVIN' LSA 3061 ON STAND No. 15 WAYLON JENNINGS CEDARTOWN GEORGIA LSA 3053

RC/1RECORDS AND TAPES RECORD MIRROR, April 1, 1972 16

Wembley Artists Wembley Artists Wembley Artists Wembley Artists Jan Howard JAN HOWARD was born in West Plains, Missouri, as one of11children. An early collectorof country records,herfirstpublic appearance came as a result ofmeetingJohnnyCash and his wife June. Her first major tour followed. Jan's first recording was a duet with Wynn Stewart, fortheChallengelabel, titled 'Yankee Go Home'. It was followed by her solo single'The One You Skip Around With', which became a Top 10 hit. In1960 she moved to Ray Lynam Nashville, signed with MCA's Decca label, and has A WRITER in oneofthecompany.Raymade subsequentlyenjoyedhit Britain's leading musicaljust one stipulation - that after hit. papers dubbed Ray Lynamthey would be allowed toConwayTwitty HerteamingwithBill as 'the great Irish hope ofcontinue with their avowed Anderson in the mid -Sixties 1972 COUNTRY MUSIC WHO'S WHO £6.00 country Music' - he wasn'tpolicyof'purecountryCONWAY Twitty was bornwhich placed him at the topas a featured artist in this far wrong, infact, he wasmusic first, last and always'. HaroldJenkinsinFriarsof both pop and countryroad showand popular LAND OF MANY CHURCHES - absolutelyright!BorninNoproblems!Handshakes Point,Mississippi, incharts. television series has resulted DOUBLE ALBUM roundand contractsSeptember 1933. His father While pursuing his rock in countlesshit duets. the quiet Midland town ofall IMPORT - MERLE HAGGARD £2.99 Moate, the son of a baker,were duly signed. was a riverboat pilot and acareer, Conway began Ray 'cuthis teeth' on the lover of country music, andwriting country songs and RECORD MIRROR music of Buck Owens and Ray LynamandTheit was from him thatin 1960 Ray Price recorded publishes a weekly GeorgeJones. HeMerrymen became Ray Conway learned to play theoneofhiscompositions columndevotedto Just two of 10,000 Country Music items assimilated the influences ofLynam and The Hillbillies.guitarandsingalong on'Walk Me To The Door'. As country musicand available from the UK's largest C&W retailer. bothsingersand wonaTheyexplodedontothe songs made famous by suchTwittyputsit:"Istarted will featuredetails reputation for himself,recording scene in the earlycountry stars as Hankoutinrock'n'rolland aboutboth the whilestillateenager, bypart of 1970 with 'Busted',Williams, Red Foley, Kittyworkedmy wayupto British and U.S. Send S.A.E. for catalogue to: - faithfully reproducing theirthesong which had givenWells and Ernest Tubb. country. country music scenes. vocalstyleswithalocalinternational hits to Johnny Althoughhisreallove In 1965 Conway went to Any current Greenwood Records, countryband, TheCash and Ray Charles.IthasalwaysbeencountryNashville and said he would information about Merrymen. was a big -seller for the boysmusic, he began his recordliketosignwith MCA's artists,bookings, Po Box 20, Sean Reilly of theand served to introduce thecareer inthe rock'n'rollDecca label, but only if he recordreleases,etc. field and was one of thewas allowed to record ReleaseOrganisation heardgreat voice of Ray Lynam should be forwarded Bradford,Yorks them and was impressed. Heto the Irishfansand topstarsofthefifties,country material. Producer to Tony Byworth c/o brought along Mike Clerkinpromoters. Within threemakingseveralrockfilmsOwenBradleyagreedto Record Mirror for (CALLERS WELCOME AT OUR SHOP and scoring a million sellergive ita try and the result to catch their show and thismonths, the Hillbillies were inclusion in the news ADJACENT BRADFORD ODEON). resulted in a recording and amajor attraction on thewithhis own compositionhas beenasuccessionof columns. management contract withballroom circuit. 'It'sOnlyMakeBelieve'huge hits for Twitty TED Country 8 Western WinnersSampler Roger Miller/Flatt& Scruggs/George Roger Miller Jones smxi.78 Atrip in the Countryens 021 Tom T. Hell Home Coming6338 004 Bobby Bare Bare Country63380.0 Jerry Lee Lewis Country Music Hall of Fame Hitsvol 1 smct. 20157 Vol 2 SINCI. 20158 British CountryMusic Mountain Dew at £1.50 Southern Journey6414 103 Great CountryGold Sampler featuringPineridge Artists Ray Dexter 6114,04 Country Seasons6414 1o6 Natchez Tace From Natchez to Nashville 6414 106 Phil Bradyb the Ranchers A Little Bit Country8414 107 The Ranchers Country Steel Guitar6414 108 Ted Ford Faded Love & WinteRoses 6414 Mervin Rainwater 109 Gets CountryFever 6414 110 The CountrySyndicate Home 6414111

Great valueat £1.50 Johnny Cash Et the TennesseeTwo Original GoldenHits vol Story Songs 1 6467001 Vol 7 6467007 of the Trains&Rivers 6467017 Showcase7467016 RECORD MIRROR, April 1, 1972 17

Wembley ArtistsWembley Artists COUNTRY & WESTERN GREATS ON PRECISION TAPES cassettes & cartrid es

cisco houston (4 woody guthrie

.41, *GEORGE JONES fie,t of George Jones 21:8 28150 YEW 281

f*EVERLY BROTHERS VARIOUS ARTISTS I, Routs 4 f(ngs of Country Music ZCK4.11128 Y 8218 48128 ZCE 8 128 Y8811 28

SANFORD CLARK They Cull Me C011111/ V GEORGE JONES ZCEB 131 8818 131 1he C town Prince of CUtiliff Music PATSY CLINE ZGEB IS! 8818 101 Walki0y At ter N18111191,1 ZCE8 134 YyE8 13.1 RED SOVINE Margo and the Country 1/1.! G01.1,1 Country Ballads of CISCO HOUSTON the 60 s Cisco Houston ICES 135 Y8E0 1'35 AT the age of twenty-one,thelightof atorch, but MA 100 s 8EB 10C with just three years as aeventually her parents and VARIOUS ARTISTS COWBOY COPAS professional singer, onethe school authorities Country Expk,..or Beyond The Sunset 2CE8 8002 Y8E8 Folk 20E8 118 Y8E8 118 might not think thereinsistedthatherstudies wouldbemuchtosaymust come before country LP, 'From Margo With CLIFFORD JAMES HANK LOCKLIN More Country Explosion about Margo. But the littlemusic - muchtoherLove', features songs like 'If EIICOre, IJohno, Cash ZC:f H 122 8818. 12: T3r.,, A Tt lady from Donegal, in thedisgust! I KissYou','Too Many Sanes North-West of Ireland, has When Margo passed herTeardrops Too Late' and 'I BUCK OWENS ZCE8 8001 Y8E13 800/ Country Man No 1 packed moreintothoseexams and finished with theWashed My FaceIn The 001 El 120 8818 126 4ity4 three years than mostdull routine of school, sheMorning Dew'. VARIOUS ARTISTS The Country Musa: St, singers would in a lifetime.began her showbusiness Margo was voted ZCLUD 100 0 81511 100 Her interestincountrycareer inearnest. With herIreland'sNo. 1 Female music began while she wasownband,theCountryCountry Singer in a stillatschoolwiththeFolk, she had numerous No.nationwidepoppolllast LOW PRICE *FULL PRICE CASSETTE = 2C CARTRIDGE - Y8 songsofthelatePatsy 1 hits.Some wereIrishyear. With her group Cline. Margo started singingballads,butallfeaturedCountry Folk she has FROM with a local band when shecountry songs as A or BtouredBritain,established PEIA:INNW TAPES: was seventeen - this meantsides. These included 'Timebox-office records in many '11111 NEW the bandwagon waitingChanges Everything', 'MamaofIreland'slargest NHAPEN OF discreetly around a cornerSay APrayer','Satisfiedballrooms and she begins an from her school so that sheMind', etc. Americantourinafew !Ii couldtakeoffforthe Herfirstalbum,titledweeks time. ballroom dates immediatelysimply 'Margo',included She may not be too long afterschoolhours!She 'Heaven Help The Workingin the business - but Margo managed to do herGirl' and 'I Got You, Youhas covered quite a lot of homework in the wagon byGot Me', while her latestterritory! Tex Withers COUNTRY MUSIC PEOPLE TEX Withers is possibly onefull. He now spends quite ofthemostwell knownconsiderable time in Ireland COVERS exponents of country musicwhere he's been greeted like on this side of the Atlantic. along -lost cousin and has As an entertainer he's beenbeen showing the Irish that THE WORLD OF COUNTRY MUSIC featured in publicityBritish entertainers can do a featureswayoutsidetheprettygood job whenit normalrealmsof countrycomestosingingcountry music and the pop musicmusic! press.Only a few months Throughout Britain he is ago he was the subject of aknown to countless millions Country MusicPeople profile in the Sunday regular appearances ENLARGED VISIT US Times' Colour Supplement r ..;'Country Meets ON STAND Shortly fterwards he was -r- 'Country Style' APRIL EDITION featured in BBC -1 alsoreached the 24 programme 'Twenty -Fourtelevisioncountryviewer NOW ON SALE Hours'. through appearances on FEATURING Country Recently the engagementGeorge Hamilton IV'sCountry Music Association Music bookof Tex Withers hastelevision shows. (GreatBritain)Ltd award ARTICLES ON Pc.-3ple been becoming increasingly The winner of the 1971for Male Singer of the Year. WEMBLEY SPECIAL WEMBLEY EDITION The Johnny Young 4 f..,...ttera. Alt the Ste, IF you were watching thehighly respected in countrycomparevery favourably sixth and final programme music circles. withtheir American in the `Up Country' series a It's justified acclaim. The 610 C81 I colleagues. Their popularity 1011 $11.1 couple of weeks ago JonnyYoung Fourareand professionalism can be 828020 (SaturdayMarch18) youregardedasoneofthejudgedwhen 011lAktlEISS011 yourealise iq would have seen one of theleading country music bandst hatit'sveryseldom the British groups whoareintheBritishIslesandband has a night away from work. Besidesbeing fine musicians, the boys are just 'FOR SAMPLE COPY PLEASE SEND 20p as entertaining off stage as theyareonstage.The SUBSCRIPTION RATE AS FOLLOWS: 24 MONTHS - £4.00 Jonny Young Four humour 12 MONTHS - £2,50 Rod mist be as well known as (Delete as applicable) theirmusicalabilityand SEND TO: COUNTRY MUSIC PRESS Peters blends inperfectlywith POWERSCROFT ROAD tbeitcontrastingarrayof FOOTSCRAY country material. SIDCUP, KENT The Jonny Young Four Cilse; Jonny Young (lead singer NAME...... andrhythmguiar),Dave i4)Crane (lead guitar and ...... vocals),Dave Tewes (bass ADDRESS...... guitar and vocals) and Stuart Langridge (drums) - ...... r ...... are back for a second year at Wembley. 18 RECORD MIRROR, April 1, 1972

Section compiled by TONY BYWORTH BRIAN O'BRIEN MICHAEL CLARE Larry Cunningham Loretta Lynn FOR the past twelve years,thisventurestrengthenedof best-sellers - if he ever WITHOUT a doubt Lorettaradio"she explained on aLarry Cunningham has beenhisresolve, and opened agot around to writing Lynn must emerge as thepreviousvisit,"andthethe undisputed, ifnew field for future concertnovels! most popular of AmericanGrand Ole Opry came onuncrowned, king of countrytours throughout the States. "I'dlike tochatto country female entertainersSaturday nights . . why,music in Ireland. He popped "Working a. heavyaudiences a bit, but this is tohittheseshores.Shewe saved our batteries untilinto the British Top Twentyschedule of ballroom datesonlypossibleincabaret", scores with a winning hand Saturdaynight. We turnedoncewith'A Tribute Tomay be financiallyhe says. "Can you see me thatinvolvesthe audiencethatthing on and dancedJim Reeves',workedinrewarding, but it leaves norambling on about the local with her stage performance.andcarriedonallnightNashvilletwice- withatimeforfamilylifeoroul' chap who goes down There'sheroverwhelminglong." spot on the Grand Ole Oprydeveloping one'smusicaleachweektocollecthis enthusiasm,bubbling Loretta is downhomelast year, and he completescareer", Larry says.blindpension-onhis personality and a voice thatand friendly. She talks tohis hat -trick of appearances ApartfromthedeepBICYCLE - while the lads puts Loretta at the top ofher audiences and they, inat Wembley's Internationalvoice, which is a mixture ofat the dance are itchin' forCountry Fever the popularity polls. return, yell out theirFestival of Country MusicJimReeves,CharliePridethe music to start, so they this year. andJohnny She's been over here forfavourite Loretta Lynn hit Cash,Larrycanchat -upabirdtheyBRITISH country music isnumberof changes which she will sing. She will Sincethelastfestival,Cunninghamhasafolksyfancy?It'sjust not on -getting fair representation atthroughout thelastfew alltheprevious Larry hasmarried and of InternationalFestivalsascontinue to delight her fans sense humourbut in cabaret it would bethis year's fesitval. Countryyears. They have often been again this year and gain newretiredfromthelucrativereminiscent of the great Willpossible. The AmericanFever are another band thatfeatured on radio wellas being one of the ballroom circuit, `though heRodgers. This doesn't often artistswhotouredwithones - but there can't be nationwide tourwashavedone much fortheprogrammes - and not only many people aroundwill continue makingcome over on stage, wherefantastic. People listened toBritish cause.It'sfair that theregular country music MCA show in May 1970. recordsandappearinginhe gets on with the serious Yetthefans never growunawareoftheLoretta the music - and the chat -theyshouldhaveaplace shows-takealsointo tired of the Loretta LynnLynn appeal. At the end ofcabaretandconcerts. business of singing countryI have never felt so close toamongthebigAmericanconsideration The Jimmy Following his Floridamusic. Away from the act.She'saperfectionisther time on stage there'll be an audiencein my wholenames assembled toYoung Show','The Terry and the epitome of the truethefamiliar `Ah'm comin'honeymoon,Larryset-offbrightlightsand cheeringcareer." entertaintheBritishWogan Show' and 'The Pete a crowds, he is a relaxed and country country .artist. back' and the famouson three-weekconcert So ends an erainthe musicenthusiasts. Murray Show'. On taevision dance. If she has her waytourofAmerica,whichunpretentious characterhistoryofIrishcountry The group are no they played on the George Loretta's backgroundisshe'llbe back again nexttookinNew York,Sanwithanendlessflowofmusic. Perhaps it alsonewcomerstothesceneHamilton IV seriesas well country and she's proud ofyear: she'sbecomingFrancisco, Boston, Lasearthystories andindicates a swing towards aalthoughtheirpersonnel,as such diverse programmes atypical rural upbringing.attached totheBritishVegas and other large cities.reminiscences which wouldnewcabaret'boom'forlike so many other groups,as 'Late Night Line-up' and "We hadanoldbatteryaudiences! Theincrediblesuccessofprovide material for a seriescountry - it's long overdue!hasbeensubjectedtoa `Colour Me Pop'.

"ITCWETiEt=XmCICKEKIIVar 4KI" MCA COUNTRY

New LP New LP YOU'RE LOOKING AT COUNTRY ALWAYS REMEMBER MUPS 447 MUPS 446 MAXI -SINGLE MAXI -SINGLE ONE'S ON THE WAY QUITS YOU'RE LOOKING AT COUNTRY ALWAYS REMEMBER LORETTA LYNN & CONWAY TWITTY BILL ANDERSON & JAN HOWARD LEAD ME ON DIS-SATISFIED

agNew LP New LE I WONDER WHAT SHE'LL THINK ROCK ME BACK TO LITTLE ROCK ABOUT ME LEAVING MUPS 443 MUPS 444 MAXI -SINGLE MAXI -SINGLE I CAN'T SEE ME WITHOUT YOU LOVE IS LIKE A SPINNING WHEEL I WONDER WHAT SHE'LL THINK ABOUT ME LEAVING DALLAS YOU'VE WON CONWAY TWITTY & LORETTA LYNN JAN HOWARD & BILL ANDERSON AFTER THE FIRE IS GONE SOMEDAY WE'LL BE TOGETHER