Volume 34 October 31, 2014 Number 41

Scan this code for breaking Whey bioplastics, renewable news and the latest markets! packaging take hold in Europe

By Emily King Biobased/Non-Biodegradable ment and government affairs, business growth in response Packaging, Consumer Elec- Tetra Pak. “The difference is to secured long-term supply INSIDE MADISON, Wis. — Renewable tronics/Products, Catering, Ag- that the raw material — eth- resources, retailer preference packaging is swiftly gaining riculture & Pharmaceuticals.” ylene — is derived from sugar and consumer demand for ✦ Guest column: popularity in Europe due to This month, Tetra Pak an- cane rather than conventional packaging made with renew- ‘The importance of governmental mandates, and nounced the launch of what fossil sources. This means that able materials. industry relationships.’ packaging giant Tetra Pak has it calls the industry’s very it has all the functional benefi ts “Across industries, we see a For details, see page 4. responded by manufacturing first carton made entirely of conventional PE and can be growing demand for responsi- plant-based renewable prod- from plant-based, renewable recycled in the same recycling bly sourced packaging that ad- ✦ Synder Filtration offers ucts. Meanwhile, Clear Lam packaging materials. It is streams — yet the source mate- dresses the issues of resource array of membrane Packaging Inc. and Lactalis named the Tetra Rex carton rial is renewable.” scarcity,” Comere says. technology for dairy. American Group Inc. have and is manufactured using bio- The company’s Tetra Rex This is something Clear Lam For details, see page 9. strived for similar goals in the based low-density polyethylene package, developed in partner- took notice of a couple years ago United States with less success. (LDPE) fi lms and a bio-based ship with Braskem, a biopoly- when, as part of Clear Lam’s ✦ Texas elementary school The worldwide bioplastics high-density polyethylene mer producer headquartered in Project EarthClear initiative, shines as Fuel Up to Play 60 market will reach a market (HDPE) cap. São Paulo, Brazil, will be com- it designed new, plant-based grows across the nation. value of $3.94 billion in 2014, Tetra Pak’s HDPE cap mercially available in Europe in and renewable packaging for For details, see page 17. making the global bioplastics — TwistCap OSO 34 — was early 2015. Expansion to other Precious Sticksters cheese market a small but signifi cant released in March. The cap, regions outside Europe will be snacks produced by Lactalis. ✦ Winona Foods announces sub-sector of the plastics along with the company’s bio- prioritized based on demand, The package, which held in- facility expansion. industry, according to an inde- based cartons, have been used Comere says. dividually-sealed cheese sticks, For details, see page 28. pendent report, “Prospects for by dairy companies such as “From a technical stand- was made from a lamination of Finnish-based Valio. point, it was a fairly straightfor- plant-based, renewable plastic The cap was made so cus- ward swap,” Comere says. “The and an outer layer made from tomers using the standard main challenges were ensuring traditional petroleum-based DMI launches partnerships to TwistCap OSO 34 are able that the bio-based PE was up plastic. However, Lactalis has to transfer to the bio-based to our high quality standards discontinued use of Clear Lam’s reinvigorate fl uid milk category version without the need for and that it was available in the renewable packaging. any additional investment or volumes required.” “We no longer use Clear By Alyssa Mitchell modifi cation to existing fi lling This summer Tetra Pak Lam’s renewable packaging be- machines, Tetra Pak says. launched a campaign to raise cause of a cost issue,” says Gus GRAPEVINE, Texas — A new $500 million-plus partnership between Dairy “The advantage of working industry awareness of the pack- Castle, packaging development Management Inc. (DMI) and seven companies to reinvigorate the fl uid with bio-based polyethylene aging life cycle and the sourcing manager, Lactalis American milk category was announced this week during the joint annual meeting (PE) is that it is identical to of renewable materials. The Group. “We may get back into of the National Dairy Board (NDB), National Milk Producers Federation conventional PE once ready for campaign — Moving to the it in the future, but it is diffi cult (NMPF) and United Dairy Industry Association (UDIA). use as a packaging material in Front — outlines the benefi ts because of the premium on that “This announcement completes a 2-year journey that dairy farmers our packaging,” says Elisabeth for businesses that commit to kind of packaging. asked us to pursue after nearly 40 years of declining fl uid milk consump- Comere, director of environ- renewability practices, namely Turn to RENEW, page 14 D tion,” says Tom Gallagher, CEO, DMI. “I think dairy farmers are really excited about this because it’s a unique and large investment in a category that hasn’t seen growth in many years.” Igniting innovation in fl uid milk and milk-based beverages to meet the growing demands of both foreign and U.S. consumers is the objective Baker Cheese announces DFA’s Provolone of the seven wide-ranging partnerships announced by DMI Wednesday. wins Chairman’s These seven partners, supported by DMI — which represents America’s expansion, to add 40 jobs Plaque from NMPF dairy farm families and importers — are committing an unprecedented ST. CLOUD, Wis. — Baker Cheese Inc. is expanding and modern- investment to unlock innovation and put milk back in the center of the izing its operations in St. Cloud, Wis., with a project expected to GRAPEVINE, Texas — A rapidly-growing health and wellness beverage market, DMI says. create about 40 new jobs. Provolone made by Albert The seven partners from across the supply chain include Dairy Farmers Baker Cheese is investing $7 million in new equipment. The Designa of Dairy Farmers of America (DFA); Darigold/Northwest Dairy Association; The Kroger Co.; project has commenced and is expected to be completed by of America, Turlock, Calif., Maryland & Virginia Milk Producers Cooperative Association Inc.; Sham- October 2016. won the Chairman’s Plaque rock Farms; Southeast Milk Inc and The Coca-Cola Co. All partners are “Wisconsin is the No. 1 cheese-producing state in the country for “Best Overall Cheese” at working aggressively to pursue growth opportunities for fl uid milk through and in order to ensure the industry remains strong, it’s important this year’s National Milk Pro- infrastructure, capital, human resource and marketing investments. that state cheesemakers continue to aggressively upgrade their ducers Federation (NMPF) “These dairy partners are making an unprecedented investment operations,” says Wisconsin Gov. Scott Walker. “I commend Baker Championship Cheese Con- over the next few years — more than half a billion dollars in capital and Cheese Factory for making this signifi cant investment in its opera- test. Designa was given the other resources,” Gallagher says. “With our (dairy) checkoff resources tions as a way to modernize and reach new markets — which is Chairman’s award for his and dedication to fl uid milk innovation, we’re excited to see how unique good for Fond du Lac County and the entire region.” Regular Provolone during a partnerships will help us drive ingenuity and generate new offerings and Baker Cheese manufactures natural string cheese under the luncheon Wednesday at the D Turn to FLUID, page 15 Turn to BAKER, page 11 D Turn to CONTEST, page 15 D © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 2 CHEESE MARKET NEWS® — October 31, 2014 MARKET INDICATORS

Chicago Mercantile Exchange CHEESE FUTURES for the week ending October 30, 2014 Cash prices for the week ended October 31, 2014 (Listings for each day by month, settling price and open interest) Monday Tuesday Wednesday Thursday Friday Oct. 27 Oct. 28 Oct. 29 Oct. 30 Oct. 31 Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 OCT14 2.295 1,755 2.299 1,728 2.299 1,728 2.299 1,734 2.291 1,734 Cheese Barrels NOV14 2.025 2,231 2.060 2,197 2.074 2,187 2.089 2,188 2.084 2,186 Price $1.9225 $2.0100 $2.0650 $2.0650 $2.1100 DEC14 1.818 2,348 1.857 2,348 1.861 2,357 1.886 2,360 1.890 2,377 Change +8 3/4 +5 1/2 JAN15 1.780 1,985 1.790 1,997 1.790 2,005 1.810 2,009 1.820 2,022 NC NC +4 1/2 FEB15 1.725 2,016 1.732 2,036 1.740 2,043 1.762 2,037 1.765 2,044 Cheese 40-lb. block MAR15 1.749 2,005 1.749 2,020 1.747 2,024 1.758 2,029 1.752 2,043 APR15 1.737 1,622 1.729 1,639 1.730 1,649 1.731 1,663 1.729 1,702 Price $2.1400 $2.1000 $2.1150 $2.1350 $2.1400 MAY15 1.738 1,537 1.730 1,543 1.731 1,544 1.735 1,549 1.739 1,561 Change NC -4 +1 1/2 +2 +1/2 JUN15 1.748 1,573 1.742 1,581 1.740 1,590 1.742 1,594 1.742 1,608 JUL15 1.752 1,083 1.749 1,146 1.743 1,152 1.743 1,155 1.743 1,183 Weekly average (Oct. 27-31): Barrels: $2.0345(+.0095); 40-lb. Blocks: $2.1260(-.1375). AUG15 1.763 985 1.759 1,014 1.759 1,030 1.763 1,035 1.763 1,084 Weekly ave. one year ago (Oct. 28-Nov. 1, 2013): Barrels: $1.8360; 40-lb. Blocks: $1.8835. SEP15 1.771 943 1.770 971 1.768 977 1.765 983 1.768 1,018 OCT15 1.773 677 1.772 715 1.770 724 1.770 727 1.770 760 NOV15 1.767 628 1.764 661 1.760 669 1.760 673 1.760 697 Grade A NDM DEC15 1.757 643 1.754 672 1.754 675 1.755 697 1.755 714 Price $1.2400 $1.2400 $1.2400 $1.2425 $1.2425 JAN16 1.745 18 1.745 18 1.745 18 1.745 18 1.745 18 Change -1/2 NC NC +1/4 NC FEB16 1.750 13 1.750 13 1.750 13 1.750 13 1.750 13 Total Contracts Traded/ Weekly average (Oct. 27-31): Grade A: $1.2410(-.0545). Open Interest 524/22,062 381/22,299 144/22,385 192/22,464 393/22,764 Daily market prices are available by visiting CME’s online statistics sites at http://www.cmegroup.com. Grade AA Butter Price $1.8000 $1.7700 $1.8500 $1.8900 $1.8900 Change -1 -3 +8 +4 NC Weekly average (Oct. 27-31): Grade AA: $1.8400(-.1095). DRY WHEY FUTURES for the week ended October 30, 2014 (Listings for each day by month, settling price and open interest) Class II Cream (Major Northeast Cities): $2.1639(-.1381)–$2.4954(-.3130). Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 Sign up for our daily fax or e-mail service for just $104 a year. Call us at 608-288-9090. OCT14 65.18 404 65.18 404 65.38 405 65.38 405 65.08 404 NOV14 61.50 350 63.00 347 63.35 347 63.50 347 61.00 346 DEC14 59.50 424 59.10 424 61.28 426 61.08 425 58.75 414 JAN15 53.00 453 55.00 457 56.25 463 56.08 467 54.75 477 FEB15 48.53 499 50.25 501 50.98 503 51.75 500 51.75 506 MAR15 45.53 468 47.00 481 48.00 482 48.00 482 48.00 483 APR15 45.50 369 46.25 382 46.80 382 47.20 386 48.00 400 Weekly Cold Storage Holdings October 27, 2014 MAY15 44.50 401 46.50 411 46.50 411 47.50 413 47.50 428 JUN15 45.00 386 47.00 396 47.25 398 47.50 398 47.50 415 On hand Week Change since Oct. 1 Last Year JUL15 45.00 285 47.50 314 47.50 315 47.50 315 47.50 319 Monday Change Pounds Percent Pounds Change AUG15 45.00 247 47.50 268 48.00 269 48.00 270 48.25 276 Butter 14,208 -264 -2,730 -16 12,714 +1,494 SEP15 45.00 217 47.25 232 48.00 232 48.00 239 48.25 239 OCT15 Cheese 94,354 +1,525 +1,396 +2 108,848 -14,494 45.00 169 47.85 180 48.00 180 48.00 182 48.25 183 NOV15 45.88 172 48.28 179 49.00 186 48.50 192 48.50 195 (These data, which include government stocks and are reported in thousands of pounds, are based on reports from DEC15 45.50 173 48.50 176 48.50 177 48.50 180 48.55 185 a limited sample of cold storage centers across the country. This chart is designed to help the dairy industry see the Total Contracts Traded/ trends in cold storage between the release of the National Agricultural Statistics Service’s monthly cold storage reports.) Open Interest 104/5,017 191/5,152 40/5,176 94/5,201 214/5,270 Daily market prices are available by visiting CME’s online statistics sites at http://www.cmegroup.com.

CLASS III PRICE October 31, 2014 (Dollars per hundredweight, 3.5% butterfat test) Dry Products* YEAR JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC 2008 19.32 17.03 18.00 16.76 18.18 20.25 18.24 17.32 16.28 17.06 15.51 15.28 NONFAT DRY MILK 2009 10.78 9.31 10.44 10.78 9.84 9.97 9.97 11.20 12.11 12.82 14.08 14.98 Central & East: low/medium heat $1.2000(-2)-$1.5850(+1/4); 2010 14.50 14.28 12.78 12.92 13.38 13.62 13.74 15.18 16.26 16.94 15.44 13.83 mostly $1.3200(-3)-$1.5050. 2011 13.48 17.00 19.40 16.87 16.52 19.11 21.39 21.67 19.07 18.03 19.07 18.77 high heat $1.4350-$1.6000(-2). 2012 17.05 16.06 15.72 15.72 15.23 15.63 16.68 17.73 19.00 21.02 20.83 18.66 West: low/medium heat $1.2000(-6)-$1.5350(-1/2); 2013 18.14 17.25 16.93 17.59 18.52 18.02 17.38 17.91 18.14 18.22 18.83 18.95 mostly $1.2800(-4)-$1.4700. 2014 21.15 23.35 23.33 24.31 22.57 21.36 21.60 22.25 24.60 high heat $1.4800-$1.5900(+1). Calif. manufacturing plants: extra grade/grade A weighted ave. $1.4939(-.0095) based on 9,290,632 lbs.

WHOLE MILK POWDER (National): $1.6000-$1.8200. STAFF SUBSCRIPTION INFORMATION Susan Quarne, Publisher Cheese Market News®, Publication #0598-030, (ISSN 0891- EDIBLE LACTOSE (PH 608/831-6002; FAX 608/831-1004) 1509), is published weekly by Quarne Publishing LLC, 4692 (FOB)Central and West: $.2525(-3/4)-$.6075(+3); mostly $.3500-$.4800. e-mail: [email protected] Signature Drive, Middleton, WI 53562; Phone 608/831-6002; Kate Sander, Editorial Director FAX 608/831-1004. Periodicals postage paid at Madison, WI. (PH 509/962-4026; FAX 509/962-4027) Circulation records are maintained by Quarne Publishing LLC, 4692 Signature Drive, Middleton, WI 53562. POSTMASTER: WHEY POWDER e-mail: [email protected] Send address changes to Cheese Market News®, Subscriber Central: nonhygroscopic $.4800-$.6925(-1 1/4); Alyssa Mitchell, Senior Editor Services, P. O. Box 628254, Middleton, WI 53562; Form mostly $.5500(-1)-$.6450(-1 1/2). (PH 608/288-9090; FAX 608/288-9093) 3579 requested; or call direct at 608/831-6002. All rights e-mail: [email protected] West: nonhygroscopic $.5000-$.6875; reserved under the United States International and Pan- mostly $.5500-$.6450. Rena Archwamety, News/Web Editor American Copyright Conventions. No part of this publication (PH 608/288-9090; FAX 608/288-9093) may be reproduced, stored in a retrieval system or transmitted (FOB) Northeast: extra grade/grade A $.6100-$.7025(-1 1/4). e-mail: [email protected] in any form or by any means, mechanical, photocopying, Emily King, Assistant Editor electronic recording or otherwise, without the prior written ANIMAL FEED WHEY (Central): Whey spray milk replacer $.3500-$.5900. (PH 608/288-9090; FAX 608/288-9093) permission of Quarne Publishing LLC. Opinions expressed e-mail: [email protected] in articles are those of the authors and do not necessarily UHÁHFWWKRVHRI4XDUQH3XEOLVKLQJ//&GED&KHHVH0DUNHW WHEY PROTEIN CONCENTRATE (34 percent): $1.2000-$1.5325(-1/4); REGULAR CONTRIBUTORS ® ® News . Cheese Market News does not endorse the products mostly $1.2300(-2)-$1.4025(-1 1/4). John Umhoefer, FCStone, International Dairy Foods of any advertiser and does not assume and hereby disclaims Association, National Milk Producers Federation, U.S. any liability to any person for any loss or damage caused by Dairy Export Council, Eric Meyer, Rice Dairy errors or omissions in the material contained herein, regard- DRY BUTTERMILK less of whether such errors result from negligence, accident (FOB)Central & East: $1.0800-$1.2700(-8). SUBSCRIPTIONS & BUSINESS STAFF or any other cause whatsoever. Copyright 2014 by Quarne Subscription/advertising rates available upon request Publishing LLC. (FOB) West: $1.1600-$1.4300; mostly $1.3000-$1.3800(-2). Contact: Susan Quarne - Publisher Subscriptions: $135 for U.S., second-class delivery; $190 P.O. Box 628254, Middleton, WI 53562 IRU86ÀUVWFODVVGHOLYHU\LQFOXGLQJ&DQDGDDQG,QWHU- 0(/.% s&!8  national rate to all others. Printed in U.S.A. CASEIN: Rennet $4.2000-$4.8000; Acid $4.4000-$5.0000. WEBSITE: www.cheesemarketnews.com *Source: USDA’s Dairy Market News

DISCLAIMER: Cheese Market News® has made every effort to provide accurate current as well as historical market information. However, we do not guarantee the accuracy of these data and do not assume liability for errors or omissions. © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 3 NEWS/BUSINESS

Vilsack says potential U.S. appeal to WTO on COOL ruling likely to come in early 2015 WASHINGTON — If the United States claiming it has a trade-distorting im- nual meeting of the National Dairy Board, there would have to be a review of the chooses to appeal a recent World Trade pact by reducing the value and number National Milk Producers Federation retaliation, and that would take some Organization (WTO) ruling on country- of cattle and hogs shipped to the U.S. and United Dairy Industry Association time,” Vilsack says. of-origin labeling (COOL), it likely will market. on Wednesday, Vilsack noted WTO has At this point, there’s no change or not be fi led until after the fi rst of the Backed by the finding, Canada a process for these situations in which impact, he adds. year, says U.S. Agriculture Secretary and Mexico may retaliate against a they accept appeals. “What I’m doing during this pe- Tom Vilsack. wide range of U.S products, including “We received indications from WTO riod of time is asking our team at The COOL rule requires most dairy products, with high, burdensome that they would be more willing to ac- USDA, does a way exist in which we retailers to provide country-of- tariffs, according to the International cept the appeal in January because they can comply with the congressional origin labeling for fresh fruits and Dairy Foods Association (IDFA). These have a queue of other appeals that they directive, which says “label,” and do vegetables, fish, shellfish, peanuts, countries represent two of the largest want to deal with,” Vilsack says. “So it’s it in a way that doesn’t require the pecans, macadamia nuts, ginseng, markets for U.S. agricultural goods, a timing issue, an issue of convenience segregation of livestock from Canada meat and poultry. IDFA notes. (See “WTO decision on for them.” and Mexico that the WTO has criti- WTO last week issued a compliance COOL puts dairy exports in jeopardy” There’s no implication at this point cized,” Vilsack says. “Is there a way panel report that found the U.S. COOL in last week’s issue of Cheese Market in time, he notes. that we can comply with Congress’ revised rule violates U.S. international News.) “The process is they’ve made a directive and not get ourselves in trade obligations. Canada and Mexico Speaking with Cheese Market News ruling that the U.S. could potentially trouble with WTO? We’ve tried it a had challenged the rule in the WTO, during a media briefi ng at the joint an- appeal ... That appeal process would couple of times, and the WTO has require at least 90-120 days. Assum- not signed off on what we’ve done. ing the U.S. was unsuccessful, there Is there another way? We’re in the CME FUTURES for the week ended October 30, 2014 would be the issue of retaliation and process of looking at that now.” CMN Class III Milk* Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 OCT14 23.88 5,588 23.90 5,510 23.90 5,472 23.90 5,427 23.79 5,430 National Dairy Products Sales Report NOV14 20.79 4,517 21.22 4,495 21.31 4,517 21.37 4,508 21.25 4,544 DEC14 18.63 3,927 19.05 3,906 19.12 3,908 19.36 3,920 19.28 3,960 For the week ended: 10/25/14 10/18/14 10/11/14 10/4/14 JAN15 17.83 3,450 18.04 3,452 18.07 3,471 18.34 3,500 18.24 3,514 FEB15 17.00 3,343 17.22 3,383 17.33 3,396 17.66 3,443 17.57 3,453 Cheese 40-lb. Blocks: 1 MAR15 17.06 3,001 17.07 3,016 17.10 3,016 17.26 3,064 17.21 3,102 Average price $2.2243 *$2.2637 $2.3429 $2.3839 APR15 16.92 2,523 16.88 2,545 16.89 2,550 17.00 2,538 17.02 2,552 Sales volume2 13,335,658 *13,601,073 11,618,127 12,988,244 MAY15 16.85 2,407 16.83 2,430 16.90 2,460 17.04 2,494 17.02 2,536 Cheese 500-lb. Barrels: JUN15 16.95 2,199 16.98 2,227 17.04 2,253 17.11 2,281 17.10 2,303 Average price1 $2.2754 $2.3171 $2.4402 $2.5981 JUL15 17.02 17.08 1,656 1,594 17.00 1,644 17.13 1,673 17.15 1,708 $2.1701 $2.2149 $2.3300 $2.4762 AUG15 17.15 1,538 17.22 1,572 17.27 1,586 17.30 1,590 17.34 1,625 Adj. price to 38% moisture SEP15 17.22 1,456 17.35 1,479 17.38 1,489 17.38 1,505 17.41 1,528 Sales volume2 9,883,909 9,378,425 8,367,413 9,634,610 OCT15 17.25 1,147 17.40 1,183 17.40 1,192 17.40 1,195 17.42 1,212 Moisture content 34.99 35.14 35.07 34.95 NOV15 17.20 1,039 17.30 1,054 17.35 1,060 17.31 1,065 17.31 1,076 Butter: DEC15 17.10 972 17.20 992 17.24 998 17.24 1,007 17.20 1,017 Average price1 $2.1995 *$2.6983 $2.9215 $3.0130 Total Contracts Traded/ Sales volume2 3,498,298 *3,090,820 3,234,534 2,889,766 Open Interest 1,014/39,360 1,349/39,035 1,297/39,224 1,370/39,546 1,098/39,890 Nonfat Dry Milk: Class IV Milk* Average price1 $1.4915 *$1.5118 *$1.4950 $1.4931 Sales volume2 17,053,007 *17,949,447 *16,550,593 17,542,219 Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 Dry Whey: OCT14 21.76 1,017 21.80 1,016 21.80 1,016 21.84 1,013 21.50 1,013 Average price1 $0.6392 $0.6523 *$0.6664 $0.6662 NOV14 18.15 974 18.02 975 17.75 992 17.72 1,002 17.46 1,030 2 7,683,060 7,784,703 *6,937,929 6,773,416 DEC14 17.07 967 16.93 971 17.00 970 16.98 974 16.98 974 Sales volume JAN15 17.06 345 17.04 345 16.85 345 16.85 350 16.85 350 * 1 2 FEB15 16.66 281 16.66 281 16.66 281 16.42 287 16.42 287 /Revised. /Prices weighted by volumes reported. /Sales as reported by participating manufacturers. MAR15 16.52 281 16.52 281 16.47 281 16.32 286 16.32 286 Reported in pounds. More information is available by calling AMS at 202-720-4392. APR15 16.70 185 16.70 185 16.38 186 16.32 191 16.32 191 MAY15 16.72 155 16.72 155 16.45 156 16.44 163 16.44 163 JUN15 16.73 156 16.73 158 16.55 159 16.46 169 16.46 169 JUL15 17.02 76 17.05 78 17.05 78 17.05 78 17.05 78 AUG15 17.10 77 17.10 78 16.97 83 16.97 83 16.97 88 Total Contracts Traded/ Selling YOUR Dairy Business Open Interest 21/4,819 28/4,829 35/4,853 81/4,907 50/4,944 Creative Business Services was Cash-Settled NDM* Is OUR Business formidable in their national search of a plant for our yogurt operation. Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 “ Once they found a suitable plant, OCT14 151.23 537 151.23 537 151.20 537 151.00 536 150.70 535 Bob and Michael were invaluable NOV14 145.00 624 145.00 624 144.55 626 144.30 630 142.75 626 in their expertise negotiating with DEC14 137.75 721 137.00 724 137.00 725 137.00 724 136.50 724 the seller, Arla Foods. With their JAN15 136.00 508 135.50 513 135.50 513 134.50 510 133.50 511 knowledge of the industry, they were FEB15 133.00 478 133.00 478 133.00 484 132.00 484 131.00 483 keenly instrumental guiding us through MAR15 131.75 476 131.75 475 131.00 475 130.00 475 130.00 475 the process; and we were always APR15 131.75 356 131.75 355 131.00 355 130.00 359 129.00 364 confident of their professionalism. MAY15 132.50 266 132.25 274 131.75 283 130.80 307 129.25 310 Even though Buyer and Seller had JUN15 134.00 240 134.00 247 133.00 263 132.00 277 131.00 293 to make adjustments, we were Total Contracts Traded/ able to strike a deal that was Open Interest 66/4,549 40/4,573 68/4,614 99/4,655 88/4,684 acceptable to both parties. Bob and Michael were there every step of the Cash-Settled Butter* way to make this an exciting, Since 1979, Creative Business Services successful acquisition for us. Fri., Oct. 24 Mon., Oct. 27 Tues., Oct. 28 Wed., Oct. 29 Thurs., Oct. 30 has sold hundreds of businesses. We — Besnik Fetoski and Mustafa Dogan, OCT14 260.93 1,155 260.93 1,154 260.93 1,154 261.98 1,141 253.00 1,142 are actively assisting individuals and Founders of Philos Foods and Buyers of the 185.00 1,189 183.00 1,184 1,192 1,191 ” NOV14 178.00 177.25 175.88 1,198 national/international companies Arla Foods Cheese Plant in Norton Shores, MI DEC14 172.75 970 174.00 976 170.75 982 172.75 985 174.50 990 to acquire businesses in the dairy JAN15 173.50 461 173.00 472 171.75 484 173.50 493 174.00 492 industry — especially cheese and FEB15 173.30 419 172.00 430 172.00 450 173.00 464 173.75 463 dairy-oriented distribution and MAR15 174.00 370 173.00 378 172.00 388 173.50 402 173.75 403 manufacturing companies. APR15 174.50 322 173.50 343 172.00 336 173.50 349 174.00 355 ______MAY15 175.00 238 174.50 239 173.00 253 173.50 255 173.50 256 SOLD 224 250 Ron’s Cheese — Producer and distributor of JUN 15 174.00 215 174.48 173.03 242 174.00 175.00 251 www.CBS-Global.com JUL15 175.00 94 176.48 114 174.78 127 175.50 127 177.00 133 specialty cheeses in the Midwest Muskegon Cheese Manufacturing Plant — Total Contracts Traded/ Creative Business Services 38,000 sq. ft. purchased by national distributor 920.432.1166 800.366.5169 Open Interest 93/5,786 144/5,854 334/6,022 238/6,073 139/6,105 for yogurt and other dairy products Daily market prices are available by visiting CME’s online statistics sites at http://www.cmegroup.com. *Total Contracts Traded/Open Interest reflect additional months not included in this chart. For more information please visit www.CBS-Global.com

DISCLAIMER: Cheese Market News® has made every effort to provide accurate current as well as historical market information. However, we do not guarantee the accuracy of these data and do not assume liability for errors or omissions. © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 4 CHEESE MARKET NEWS® — October 31, 2014 GUEST COLUMNIST CMN Exclusive!

rent Congressman from my home state and corporate executives, a meeting Perspective: of Ohio who was fi rst elected in 1990: on Capitol Hill, a trip to visit members John Boehner. When Congressman and a lunch or dinner to celebrate the Industry Issues Boehner joined the House Agriculture achievements of others in my commu- Committee, I went to introduce myself nity. It takes time — face time — to Connie Tipton is president and and explained our members’ interests develop these relationships, which have CEO of the International Dairy in getting the federal government to provided such rich opportunities for my Foods Association. She contributes adopt a more market-oriented dairy personal and professional growth. this column exclusively for Cheese policy. He took an interest in our efforts, Market News®. understood our goals and got involved. Over the years, John Boehner rose through many leadership positions in “It’s not just about the House, including chairman of the House Republican Conference in 1995, your endeavors and chairman of the House Committee on achievements; it’s Education and Workforce in 2001, House Majority Leader for a year in 2006 and about the people, House Minority Leader beginning in friendships and The importance of industry relationships 2007. Then on January 5, 2011, my friend, John Boehner, swore in the 112th relationships that you Having worked with the dairy foods immediately it became obvious to all Congress as the 53rd Speaker of the form and that form you industry for more than 30 years, I’ve of us that Dave would no longer be at House and was re-elected for a second been fortunate to know and work with industry meetings, nor would his fun term as Speaker in January 2013. over time.” an intriguing and interesting array of wife, Sandy, be there for the receptions, While the Speaker leads the actions leaders from companies across North dinners and occasional Green Bay Pack- of the House, he also is just behind the Connie Tipton America and ally with people in orga- ers games in the hotel sports bars. So Vice President of the United States INTERNATIONAL DAIRY nizations around the world. Through much is tied to our work relationships in succession to the presidency. That FOODS ASSOCIATION the years, several of my friends in that it goes unnoticed until we realize means he’s a pretty big deal with a lot Washington, D.C., have grown into lead- these relationships can end abruptly on his plate. But, fortunately for the ers in other associations, in Congress as people move on to other endeavors. dairy industry, he wasn’t too busy to and in government agencies. It’s not This isn’t a maudlin refl ection on remember our issues when the farm The dairy industry has many extraor- something I think about very often; in what is past, but rather a valuable les- bill came up for votes in the House. He dinary people who give of themselves ev- fact, I pretty much take these relation- son for those who are in the process of got involved and helped us win a fl oor ery day to make their organizations, the ships for granted. But at our recent building careers as well as ending them. amendment in the House of Representa- people who work with them, and their board meetings, I was reminded of It’s not just about your endeavors and tives during the 113th Congress. Thanks, products and services better than ever just how important these relationships achievements; it’s about the people, Mr. Speaker. before. Working together, we can do awe- and friendships are and how they have friendships and relationships that you Not all relationships can yield that some things to encourage innovation become an integral part of my life. form and that form you over time. You kind of result, but it’s a valuable lesson and growth for the U.S. dairy industry, When Dave Fuhrmann, CEO of never know how those relationships to remember, so you’ll be sure to nurture but equally important are the contribu- Foremost Farms, announced that the might change your life or have an impact each and every relationship. They are all tions we make to each other through our October board meeting would be his on your pursuits, but surely many of important, and you never know where relationships. There aren’t many things last because he’s beginning a well- them will make a difference or a lasting you and your friends may end up. in life more important than that. CMN earned retirement, we all refl ected on impression. In today’s era of social media, I cer- the happy, sad, diffi cult and triumphant An important example from my tainly value my Facebook friends and The views expressed by CMN’s guest times we had shared together through career in Washington, D.C., which LinkedIn relationships, but I didn’t fi nd columnists are their own opinions industry challenges and through our en- has involved quite a bit of dabbling in them online. On any given day, I may and do not necessarily refl ect those of counters at industry meetings. Almost politics, is my relationship with a cur- have breakfast with association CEOs Cheese Market News®.

Products. Customer service. Industry expertise. We deliver.

Safety & Personnel Sanitation & Janitorial Production & Material Handling Processing & Flow Control Laboratory & QA/QC Packaging & Ingredients

Request your FREE copy of our NEW catalog today!

Products. Customer service. Industry expertise. We deliver. www.nelsonjameson.com • 1-800-826-8302

For more information please visit www.nelsonjameson.com For more information please visit www.epiplastics.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 5 NEWS/BUSINESS

DuPont marks 50 years of innovation at Brabrand, Denmark, R&D facility for food ingredients BRABRAND, Denmark — As it cel- of our global food research activities,” healthier life.” Biosciences — are working together ebrates 50 years of innovation this week says Craig F. Binetti, president, DuPont DuPont says that overcoming threats and are committed to making food more at the company’s largest R&D facility for Nutrition & Health. “It is here where we to the global food supply will require nutritious, safer and available to people food ingredients in Brabrand, Denmark, consolidate our knowledge to anticipate taking scientifi c innovation well beyond everywhere, the company says. DuPont’s Nutrition & Health business is and address human needs around the the lab into fi elds and local communi- “We know it will take continued co- hosting food industry, government and world. As we look to the next 50 years, ties, especially in developing economies operation, innovation and investment in academic leaders in discussions on how we continue to work in close collabora- such as Sub-Saharan Africa and South agriculture, food and nutrition to over- food and nutrition will evolve to meet tion with our customers, governments, and Southeast Asia where the majority come the vast challenges to feeding the growing global population needs in the academia, NGOs and others to fi nd new of chronically-malnourished people live. world’s growing population,” Binetti says. next 50 years. and better ways to solve food and nutri- DuPont businesses — Pioneer, Crop “At DuPont, collaboration and innovation “Today we are celebrating 50 years tion challenges, and to create sustainable Protection, Nutrition & Health, Packag- are tools for success here and around the of science and innovation at the core solutions essential to a better, safer and ing & Industrial Polymers and Industrial world; it is where we come together.” CMN National average price of conventional Ultura intends to sell membrane business butter decreases 38 cents from last period after fi ling Chapter 11 bankruptcy petitions WASHINGTON — The weighted had a weighted average advertised OCEANSIDE, Calif. — On Oct. 20, Ul- ties as debtors-in-possession. average advertised price of national price of $5.30, up from $4.34 two weeks tura (LA) Inc. and Ultura (Oceanside) The Rochem and Sepro brands conventional butter in 1-pound packs earlier and $3.27 one year earlier, while Inc. filed voluntary petitions in the will be purchased by UAC Finance this week is $3.82, down from $4.20 two 2-pound blocks had a weighted average United States Bankruptcy Court for Inc., who also is expected to buy out weeks earlier but up from $2.74 one advertised price of $8.45, up from $7.83 the District of Delaware seeking relief Ultura (Oceanside) Inc., along with year earlier, says USDA’s Agricultural two weeks earlier and $6.29 one year under the provisions of Chapter 11 of its nearly $25 million worth of debt, Marketing Service (AMS) in its latest earlier, AMS says. the United States Bankruptcy Code. if there is not a higher bid submitted. biweekly National Dairy Retail Report Meanwhile, 8-ounce cheese shreds Ultura (Oceanside and LA divi- The court approved a bid deadline released this week. this week had a weighted average adver- sions) was the new name for the com- for Nov. 25, an auction for Dec. 3 and AMS says this week national con- tised price of $2.46, down from $2.69 two bined Rochem, Sepro Membranes and an approval hearing for Dec. 4 from ventional varieties of natural cheese in weeks earlier but up from $2.28 one year APTwater businesses consolidated in motions filed by Ultura (Oceanside) 8-ounce blocks had a weighted average earlier, AMS says, while 1-pound shreds February. The two affiliates of parent Inc. on Oct. 21. advertised price of $2.41, down from $2.63 had a weighted average advertised company Ultura (which is not filing Ultura (LA) Inc. will be di- two weeks earlier and $2.43 one year ago. price of $4.98, up from $4.35 two weeks bankruptcy) continue to operate their vested or sold, although de- This week 1-pound cheese blocks earlier and $3.05 one year earlier. CMN businesses and manage their proper- tails are not yet clear. CMN

Specialty Membranes for Dairy Applications

Process and Polisher RO, NF 10K and 5K UF, and MF Membranes Milk and Whey Protein Concentration. Milk Solids Concentration, De-ashing, Preconcentration, and Permeate Polishing. CUTTING Toray offers a suite of leading edge membrane elements applying latest innovations in membrane chemistry and element construction techniques SYSTEMS for use in dairy applications ranging from Microfiltration and Ultrafiltration to Nanofiltration and Reverse Osmosis. Robust and reliable cutters Toray dairy process products are: designed to suit your production USDA Accepted, 3A/FDA compliant. Made in America. From one-way, two-way, and three-way cutting machines to custom cutting systems designed for unique applications, Johnson Innovation. Contacts: Industries has delivered exceptional reduction Madalyn Epple Toray Membrane USA equipment for over three decades. Quality. ph. 952 484 9233 Madalyn Epple [email protected] Product Manager – Specialty Expertise. Lee Telin Separations ph. 715 205 5991 Poway, CA 92064 [email protected] www.toraywater.com Mark Chilton FOR MORE INFORMATION, VISIT US ON THE WEB AT Toray Membrane Europe ph. +44 (0) 7793 287 505 www.johnsonindint.com [email protected]

For more information please visit www.toraywater.com For more information please visit www.johnsonindint.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 6 CHEESE MARKET NEWS® — October 31, 2014 GUEST COLUMNIST CMN Exclusive!

every consumer need from infancy to June, making these connections was the golden years, to options that can a key strategy, creating opportunities Perspective: be both healthy and indulgent, dairy for consumers to not only meet but also Dairy Marketing offers clean label, natural foods from interact with the people, cows, farms real people who are concerned about the and food that come from the “Land of land and the animals that make their Milk & Sunny.” As director of communications for origin. And the way we communicate On the social side where content the California Milk Advisory Board, that to our target audience has become is king, it’s no longer good enough to Jennifer Giambroni oversees as diverse as the category itself. throw everything up on all channels consumer, trade and industry out- How consumers look for information just to feed the beast, it’s about being reach to build awareness and demand and incorporate brands into their lives strategic about the type of information for Real California Milk and dairy as well as the media tools they use refl ect that gets shared, where and how often. products. She contributes this column our changing lifestyles: grab-and-go, Earlier this year we audited our social exclusively for Cheese Market News®. multiple platforms and multiple func- media channels to update our approach tions. Just as the old model of sitting and increase opportunities for engage- down with a bowl of cereal and milk ment. For some platforms, that meant in the morning has morphed into a reducing the amount of information that smoothie in the car on the way to the was put out, for others it meant taking offi ce, gathering on the sofa in front of a more visual approach to telling the Ready, set, engage for dairy demand the TV has become catching a favorite California dairy story. show on a mobile device between meet- Beyond these tools, we’ve put The arrival of fall and the holiday consumer packaged goods company, ings. As demand-builders, we have to dairy — a category often taken for season is an exciting time for dairy the entire focus of our activities is on bring dairy into that same world and granted — into the same places where marketers. When it comes to seasonal building demand for dairy, for us spe- be as nimble as consumers when com- consumers spend their time. In an age cooking and baking, dairy rules the cifi cally California dairy, and tying into munications tools change. where coffee shops are programming day. It is also a time where checkoff the elements that infl uence consumer One example is the classic website, their own digital music channels and organizations like the California Milk purchase decisions from awareness to which used to be a company’s primary moms are catching a game of Candy Advisory Board are out in the community interest, trust, usage and, ultimately, online presence. The old, fl ash-heavy Crush between soccer matches, if you’re connecting with the dairy producers who advocacy. encyclopedic style website of even three not mobile, you’re out of consideration. fund the activities we conduct and mak- We have an advantage in a product years ago has now become an “infotain- And it’s not about advertising to this ing program plans for the coming year. as diverse and nutritious as dairy, which ment” hub with spokes pointing and consumer but engaging with her. The program planning exercise al- has never been more relevant to how connecting to social media platforms Over the past several years, casual lows us to revisit our role in the dairy consumers live and eat today. From to like, share, pin and Tweet. When we gaming has become an important tool marketing chain. Because we’re not a the sheer variety of products that fi t launched our new Califarmia site in Turn to GIAMBRONI, page 7 D DairySpec FT Next Generation of Dairy Product Analysis

Engineered for dairy laboratories and dairy processing facilities that require highly reliable and accurate instrumentation for the analysis of a wide range of fluid dairy products. A&B Process Systems designs, fabricates & • Fat, protein, lactose, total installs the finest Process Systems available! solids and many more ON TIME & IN BUDGET components • Powerful software integrates We are located in the heart of Dairyland having control, data collection, decades of experience serving the dairy industry. archiving, and reporting We inspect, & test our products and components • Calibration assistance for to precise standards using the latest technology specific products in our Hygienic & A.S.M.E. Certified facilities. • Extensive remote diagnostic and network functionality Products: (not limited to) • Bentley Instruments, serving Clean-in-Place (CIP) the Dairy Industry’s analytical Mix Tanks needs for over 30 years Melt Systems Process Piping Installation HTST & Vat Pasteurization BactoCount IBCm HTST Balance Tanks HTST Hold Tubes A rapid test for total bacteria and somatic cell counts making it an ideal VacuShear® and unique solution for any processing plant or laboratory in the quality Flavor Vats assessment of milk. Services Provided: (not limited to) Batching & Blending Systems • Dual application in a single platform Process Engineering Transfer Panels • Rapid results (1 minute for SCC, 11 minutes for Custom Design & Fabrication Modular Process Systems bacteria) Automation & Controls Water & Wastewater Management • Instrument is pre-calibrated with a universal Factory Acceptance Testing calibration equation Installation • Real time detection of milk tanker Documentation contamination before unloading Start-up & Training • Improves end product quality and consistency • Fast return on investment

4004 Peavey Road Chaska, Minnesota 55318 t. 952 448 7600 201 S Wisconsin Ave Stratford WI 54484 f. 952 368 3355 Call today 888.258.2789 Another Choice, A Better Choice [email protected] visit us at www.abprocess.com

For more information please visit www.bentleyinstruments.com For more information please visit www.abprocess.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 7 NEWS/BUSINESS Bob Constantino’s Diversifi ed Management Group to offer affordable menu of services By Emily King of Anco Fine Cheese. He has served on profi ts and utilize my national contacts and packaging, develop reasonable and numerous boards and was inducted into has resulted in a very successful career.” affordable go-to market strategies, all BOSTON — Bob Constantino has set out the California Cheese & Butter Associa- Constantino’s networking has given at an affordable cost,” Constantino says. to create his own business venture that tion’s Hall of Fame in 2009. Constantino him unique access to decision makers in Constantino offers a menu of services offers more than 30 years of experience says he has successfully introduced and the retail, club and food service channels, custom-designed to fi t a client’s specifi c in the cheese industry to companies who sustained some of the largest iconic he adds. needs. cannot afford certain services on a full- brands in the United States (e.g., Jarls- DMG was started based on the needs “In today’s environment, companies time basis. berg, Boursin, Pub Cheese, Sonoma Jack, of companies that have communicated a need to realize their capabilities, under- Aptly named Diversifi ed Management Rondele, Roth Käse and Old Croc) and desire to engage a seasoned professional stand the market conditions and costs Group (DMG), Constantino’s repertoire has developed some of the best sales and that understands the market. He is seek- associated with growing their businesses will include, but is not limited to: man- marketing organizations in the specialty ing clients in the dairy, deli, bakery and and engage a knowledgeable and trusted agement, business planning, budget de- cheese business. deli snack categories. professional who has achieved a high level velopment, sales, marketing, product and “I have spent more than 30 years “Clients should choose DMG based of success,” Constantino says. packaging development, team building, owning and running companies whose on their specifi c needs to improve their For more information contact DMG mentoring, public relations, advertising, annual volume is $20 million to $250 market presence and share, require some- at 781-956-8603 or rac.diversifi edma- website design, and trade show develop- million,” Constantino says. “My ability to one that can train and mentor their staff, [email protected], or visit ment and management. lead and mentor people, develop go-to establish and manage their direct sales www.racdiversifiedmanagementgroup. “My mission is to offer my 30-plus years market strategies, sustain volume and and broker network, create new products com. CMN of national experience and expertise to companies that could utilize my services at a very affordable cost,” Constantino says. “I can custom-tailor a program that addresses their specifi c requirements that can be executed in a reasonable amount of time.” Constantino’s experience includes serving as president, partner and CEO of Rondele Specialty Foods. During his time there his responsibilities covered all aspects of the business, and he increased sales by 35 percent, he says. Constantino’s career also has included serving as president at Cappiello Cheese Co., vice president of retail sales at Emmi Roth Käse and executive vice president

GIAMBRONI Continued from page 6 for this type of engagement with our pri- mary dairy buyers, women 25-54. Earlier this year, we extended our partnership with social gaming company Zynga to make Real California Milk and the seal Good seal. Perfect seal. the fi rst in-game integration during the launch of FarmVille2 for mobile. This launch generated more than 123 million impressions with more than 1 million players interacting with California’s cows in the game and talking about it on Facebook and other social platforms. We’re also using digital banner ads to drive traffi c to the new website and tap- Repak horizontal form-fill-seal packaging ping into partners like Hulu to bring our machines from Reiser offer the best sealing commercials into the digital and mobile integrity in the industry. Only Repak machines space with pre-roll and in-program spots. Just as modern farming practices are constructed with two 4-point lifting stations, are making dairy more effi cient, sus- generating up to five metric tons of closing tainable and safer than ever before, pressure for uniform forming and reliable sealing. these modern communications tools No matter how complicated your package, Repak are not only building awareness but will produce it perfectly. For more information, integrating dairy into consumers’ lives contact Reiser today. in new and exciting ways. And moving forward, they will be opening up new opportunities to engage the consum- ers who want to know where their food www.reiser.com comes more closely with the people Reiser responsible for food production. CMN Canton, MA • (781) 821-1290 Reiser Canada The views expressed by CMN’s guest Burlington, ON • (905) 631-6611 columnists are their own opinions 2014 and do not necessarily refl ect those of Cheese Market News®. For more information please visit www.reiser.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 8 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

Licensed cheese imports total 17.1 million pounds in September, up 10 percent from last year

WASHINGTON — September imports date licensed imports of these cheeses of this year, up 1 percent from the same 486,209 pounds in September, down of cheese subject to licensing require- totaled 35.0 million pounds through period last year. 43 percent from a year ago. January- ments totaled 17.1 million pounds, up September, up 7 percent from the same September licensed Cheddar imports September licensed imports of processed 10 percent from September last year, nine months last year. totaled 842,622 pounds, up 1 percent Gruyere totaled 3.9 million pounds, down according to the latest data released Imports of Italian-type cheeses sub- from September 2013. January-Septem- 7 percent from the same period last year. by USDA’s Foreign Agricultural Service. ject to licensing requirements totaled ber licensed Cheddar imports totaled 8.4 Licensed imports of other cheese January-September licensed U.S. cheese 2.5 million pounds in September, up 92 million pounds, up 25 percent from the not-specifically-provided-for totaled imports totaled 121.7 million pounds, up percent from a year earlier. January- fi rst three quarters of 2013. 7.1 million pounds in September, up 1 3 percent from the fi rst three quarters September licensed imports of these September licensed imports of Blue percent from September 2013. January- of 2013. (The fi gures released by USDA cheeses totaled 9.7 million pounds, up mold cheeses totaled 623,492 pounds, up September licensed imports of these are in kilograms; Cheese Market News 13 percent from the same period in 2013. 8 percent from September 2013. Year- cheeses totaled 51.5 million pounds, has converted the data to pounds by Edam and Gouda imports subject to to-date licensed imports of Blue mold down 2 percent from the same nine multiplying by 2.2046.) licensing requirements totaled 1.1 mil- cheeses totaled 3.9 million pounds, down months in 2013. Licensed imports of Swiss and Em- lion pounds in September, down 3 per- 11 percent from January-September September licensed butter imports menthaler with eye formation totaled cent from September last year. Licensed last year. totaled 702,948 pounds, up 8 percent 4.4 million pounds in September, up 19 Edam and Gouda imports totaled 9.1 Imports of processed Gruyere sub- from September last year. Licensed percent from September 2013. Year-to- million pounds in the fi rst three quarters ject to licensing requirements totaled butter imports during the fi rst three quarters of this year totaled 12.1 million pounds, up 63 percent from the fi rst three quarters of 2013. Licensed imports of butter substi- tutes totaled 572,310 pounds in Septem- ber, up 85 percent from September 2013. January-September licensed imports of Asset butter substitutes totaled 4.5 million pounds, up 15 percent from the same 2013 period. Imports of high-tier cheese and Solutions other dairy products totaled 25.0 million pounds from January-September, up 23 percent from the fi rst three quarters Experts! of 2013. Leading high-tier imports are Italian-type cheeses at 9.7 million pounds AUCTION: Obtaining year-to-date, down 7 percent from the TURN-KEY FACILITY SALES Maximum Value same nine months of last year. Following Harry Davis & Company’s recent brokered is other cheese not-specifi cally-provided- turnkey sales include complete Cheese Harry Davis & Company has for at 5.5 million pounds imported from Manufacturing, Fluid Milk and Ice Cream delivered powerful solutions to January-September, up 31 percent production facilities across North America. the Cheese, Dairy, Food and from the same 2013 period. CMN Beverage industries for 60 YEARS! &HUWLÀHG$335$,6$/6 UK consumer group Harry Davis & Company is the leader in RECENT AUCTION the valuation of equipment and operating CAMPAIGNS INCLUDE: uncovers fake facilities in the cheese, dairy and beverage • Former Borden Facilities – industries. goat’s milk cheese New Jersey, Kentucky, Tennessee Our clients include leading banks and • Land O’ Lakes – LONDON — Which?, a London-based con- ÀQDQFLDOLQVWLWXWLRQVDVZHOODV)RUWXQH Cheese & Whey – Denmark, WI sumer watchdog group, recently conducted companies and major players in the an investigation that uncovered sheep’s • Nestle Nutritional Products – cheese, dairy, food processing and milk cheese being sold as goat’s milk cheese beverage industries. St. Louis Park, MN in locations across the United Kingdom. • Nestle/Dreyers Ice Cream – Which? says it became suspicious over %DNHUVÀHOG&$ +RXVWRQ7; the large amount of goat’s milk cheese on • Foster Farms – Fluid Milk – sale, despite a goat’s milk shortage in the Fresno, CA UK, so it teamed up with the author of the British government’s independent review • Unilever – Milwaukee and into food crime, Chris Elliot, to investigate Atlanta facilities the cheeses. • Many Additional Dairy, Food Which? and Elliot tested 76 samples and Beverage facilities! of goat’s milk cheese from supermarkets, delis and markets from eight locations around the UK. A total of nine samples were adulterated, Which? says. Three contained more than 80-percent sheep’s milk, another three contained more than 50 percent and the fi nal three around 5 percent. Which? says these results reinforce the need for better oversight and has started a petition to stop food fraud. www.HarryDavis.com In other investigations, Which? found 412.765.1170 | [email protected] takeout meat sold as “lamb” contained other meats such as chicken or beef, and several samples of fi sh sold in fi sh and For more information please visit www.harrydavis.com chips shops also were mislabeled. CMN © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 9 NEWS/BUSINESS

Synder Filtration offers array of membrane technology, superior customer service for dairy

By Alyssa Mitchell membrane development.” customers. able in both spiral-wound and fl at-sheet Synder Filtration is an ISO-9001:2008 “Sometimes this results in the need formats, Synder’s NF membranes are VACAVILLE, Calif. — A Bay Area fi l- certifi ed manufacturer of membrane to develop new membranes, and we can capable of rejecting multivalent salts, tration technology company is making products, including systems designed for develop membranes specifi cally for cus- lactose and larger molecules, while increased inroads into the dairy sector industrial process applications. tomers’ applications,” Yeh says. selectively rejecting varying amounts with its wide array of membrane technol- ISO-9001 is the manufacturing stan- In fact, 20 percent of Synder Filtra- of monovalent salts. ogy offerings and services. dard for total quality management, Yeh tion’s current membranes are from “If required, we can even develop new Synder Filtration, Vacaville, Calif., notes. The company is audited twice a custom developments, he adds. nanofi ltration membrane materials to has a unique understanding of the year by an independent fi rm, and it has to The company offers nanofi ltration meet specifi c process goals, in partner- membrane industry from its history as show continuous improvement in order (NF), ultrafi ltration (UF) and microfi l- ship with our customers,” Yeh adds. both a buyer and a supplier of membrane to maintain its certifi cation. tration (MF) technologies. The company also offers a wide range technology, notes Jeff Yeh, president, At Synder Filtration, membrane prod- Synder Filtration offers a suite of of ultrafi ltration membranes to provide Synder Filtration. ucts can be fully customized to achieve nanofiltration membranes that are maximum fl exibility in solving process Established in 1989, Synder Inc. the specifi c process separation goals of engineered to provide optimal fl ux and challenges, Yeh says. Available in both originally specialized in manufactur- the company’s customers, Yeh says. rejection and can be customized to meet spiral and fl at-sheet confi gurations, ing industrial enzymes, in which spiral He adds that the company does a the unique requirements of specifi c Synder can customize ultrafi ltration membrane technology was a vital part lot of feasibility and pilot testing for its process applications, Yeh says. Avail- Turn to SYNDER, page 10 D of the overall process. Jeff Yeh’s father, Edward Yeh, founded the company with two partners. The dairy industry wasn’t the company’s main focus at fi rst as it focused on bioprocess applications. Over time, the founders became frustrated with the inconsistent product quality and lack of support from their existing membrane supplier, Jeff Yeh says. After a search for suitable alterna- tives ended in futility, the founders saw an opportunity to fi ll a void in process separations. As a result, Synder Filtration was established in 1994, a U.S. wholly- owned membrane manufacturer in the San Francisco Bay Area. The founders had a vision to provide customers with the outstanding membranes, special- ized process knowledge, flexibility and service demanded by the founders Our mission is to work closely with themselves. our customers to provide timely, “The company was built from scratch with our own money,” Jeff Yeh says, knowledgeable and friendly service noting this fi nancial independence has in support of their unique process allowed the company to do some unique separation goals in these areas: things. “It’s one of the things that sets us • Nanofiltration apart and is a foundation for how we do • Ultrafiltration business,” he says. For example, the fi nancial indepen- • Microfiltration dence has allowed the company the • Custom Membrane Development ability to quickly make decisions on • Membrane Accessories & Spare Parts ways to invest in its infrastructure and • Process & Application Development technology, Yeh says. • Case Studies In 2012, Synder Filtration pur- chased the building next door to the • Pilot Study Program 66,000-square-foot facility it has oc- • Global Distribution & cupied since 2004 to make room for an Service Network expansion of its R&D and application • Flexibility & Responsiveness development labs to push its capabilities even further, he notes as one example. “We now have four full-time R&D and We are rooted in doing business application development staff,” Yeh says. the right way, and this is what you Sixty-three people work at Synder should expect from Synder Filtration Filtration, with 55 working out of the company’s headquarters, Yeh says. every single day. The company’s new 53,000-square- foot building is now completely reno- 4941 Allison Parkway | Vacaville, CA 95688, USA vated and supporting the R&D team in developing new products and applica- Phone: (707) 451-6060 | Fax: (707) 451-6060 tions, he adds. Email: [email protected] “The most exciting part of this ex- www.synderfiltration.com pansion is that we were able to design a lab for development,” Yeh says. “We All inquiries will be responded to by a Synder employee can now synthesize our own polymers as personally within 24 hours. well to use in membrane development. This opens a lot of doors for us in quick For more information please visit www.synderfi ltration.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 10 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

SYNDER Yeh says. They also are commonly used as has not lost sight of its roots in quality, years, serving as president of Synder a pretreatment step for other membrane fl exibility and service, he adds. Filtration for six years,” Yeh says. “I have Continued from page 9 separation processes. “The company is very near and dear to every intention to continue growing the membranes and membrane systems to The company keeps an extensive me; I’ve worked here since I was 14 years company, not just in the dairy industry, meet the specifi c application goals of its inventory of its most common membrane old, and I’ve been in the industry for 20 but in other industries as well.” CMN customers. models, allowing it to have some of the Yeh adds that as opposed to conven- fastest lead times in the industry, Yeh adds. USDA’s KCCO to buy natural American cheese tional fi ltration which causes a quick “Invariably, every plant will have an build-up of solids onto the membrane upset at some time,” he says. “We answer KANSAS CITY, Mo. — USDA’s Kansas Minn., will supply up to 14.2 million surface, cross-fl ow fi ltration increases the phone when people call us and are City Commodity Offi ce (KCCO) this week pounds of natural American cheese in the passage of permeate through the able to deliver quickly. announced it is purchasing up to 76.2 mil- 500-pound barrels, $0.2374-$0.2874, and membrane. Also known as tangential fl ow “We can ship products quickly, some- lion pounds of natural American cheese up to 1.1 million pounds of reduced-fat ultrafi ltration, this is a separation process times overnight,” he adds. in 2015 from six U.S. companies. natural American cheese in 500-pound where the feed stream is in parallel to the The company has been featured on the The purchase price for each delivery barrels, $0.2874-$0.3374. membrane surface, which helps to control Science Channel’s “How It’s Made,” Yeh period is the accepted differential price Land O’Lakes Inc., Arden Hills, Minn., the formation of the gel layer, greatly notes. An episode featuring “Membrane per pound indicated below plus the will supply up to 40.4 million pounds of improving fl ux stability and membrane Filtration” on April 24, 2014, was shot applicable previous month’s average of natural American cheese in 500-pound life vs. perpendicular fl ow systems. at Synder Filtration’s headquarters in the Chicago Mercantile Exchange’s cash barrels, $0.3046-$0.3046. In addition, Synder Filtration of- Vacaville. market price for block or barrel cheese Masters Gallery Foods Inc., Plymouth, fers a wide selection of microfi ltration Synder Filtration also recently re- trading as reported in USDA’s Dairy Wis., will supply up to 10.3 million pounds membranes developed specifi cally to vamped its website at www.synderfi ltra- Market News. of generic reduced-fat, shredded Ched- solve complex process challenges such as tion.com. Up to 53 percent was awarded under dar in 6/5-pound bags, $0.2054-$0.3044, microbial removal, protein fractionation “We really wanted to highlight some small business set-aside programs to fi rms and up to 3.5 million pounds of generic and pretreatment to other membrane of our new capabilities and wanted to eligible to compete for these set-aside shredded Cheddar in 6/5-pound bags, processes, Yeh says. Available in both make the site more of a learning tool for quantities. A maximum of 3.0 million $0.2191-$0.2985. spiral-wound and fl at-sheet confi gura- membrane technology,” Yeh says. pounds of cheese was not awarded due to Pacifi c Cheese Inc., Hayward, Calif., tions, microfi ltration membranes and The new website features education no offers. KCCO says it reserves the right will supply up to 38,400 pounds of ge- membrane systems can be customized videos on membrane technology as well to solicit for this cheese at a later date. neric reduced-fat, shredded Cheddar in to meet specifi c application goals with as an extensive collection of technical Associated Milk Producers Inc., New 6/5-pound bags, $0.2594-0.2594, and up to effi ciency. articles that R&D staff wrote, he notes. Ulm, Minn., will supply up to 5.8 million 230,400 pounds of generic shredded Ched- Synder Filtration currently offers three “It really showcases what we can of- pounds of natural American cheese in dar in 6/5-pound bags, $0.2345-$0.2594. types of polymeric microfi ltration fi lters, fer,” he says. 500-pound barrels for a differential of Robert H. Barrios, San Diego, will supply all of which maintain good resistance to Despite expansion into many new $0.0000-$0.6050. up to 799,000 pounds of generic Cheddar pH, temperature and fouling tendencies, industries throughout the world, Synder Bongards’ Creameries, Norwood, in 4/10-pound cuts, $0.3820-$0.4270. CMN

TM

Sanitation and so much more... ProActive Solutions USA can maximize your profits by providing you with the best possible sanitation programs at the most reasonable cost. The quality of your sanitation program isn’t measured in dollars. You measure it in product quality, down time, environmental concerns and labor costs. Product Categories s Food Ingredients s Commodity Chemicals s Acids s Alkaline & Chlorinated Alkaline s Caustics s Defoamers s General Cleaners s Hand Sanitizers s Sanitizers s Membrane Cleaners s Laundry Detergents s Conveyor Lubricants Let’s talk about the “PRO-ACTIVE” approach in your plant! Providing These Plant Solutions: •Silos s Establishing Cleaning Procedures s Employee Training •Processors s Cleaning Equipment Recommendations s Program Monitoring s Inventory and Cost •Horizontal Storage Tanks s Controls Let our Food Quality Specialists •Custom Specialty Equipment individualize a program for your plant. …and More! PROACTIVE SOLUTIONS USA, LLC™ "RIDGE3TREETs'REEN"AY 7) Paul Mueller Company • 1600 W. Phelps St. • Springfield, MO 65802   s&AX   [email protected] • 1-800-MUELLER • www.paulmueller.com www.proactivesolutionsusa.com ©2013 Paul Mueller Company 382-7

For more information please visit www.proactivesolutionsusa.com For more information please visit www.paulmueller.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 11 NEWS/BUSINESS

MPP signup, comment deadline extended

We are your custom sourcing specialists for procuring Quality Cheddar Cheese to meet your specific needs. Celebrating  years in business and staffed with over  Years Combined Experience in the cheese industry. Please contact a “WAG” employee today for more info. We are here to meet your needs. Visit us on the web at www.wagcheese.com

Photo by Alyssa Mitchell/Cheese Market News

GRAPEVINE, Texas — U.S. Agriculture Secretary Tom Vilsack spoke to attendees Monitored Set Aside Cheddar Programs Wednesday at the 2014 joint annual meeting of the National Dairy Board, National Milk 40# Colored & White Producers Federation and United Dairy Industry Association, held here Oct. 27-29. 640# Colored & White Vilsack announced that the deadline to enroll in the new Dairy Margin Protec- tion Program (MPP) has been extended to Dec. 5. The program provides fi nancial Cheddar Cheese Aging Programs assistance to participating farmers when the margin — the difference between the 40# White & Colored; 640# Colored & White price of milk and feed costs — falls below the coverage level selected by the farmer. Cheddar Spot Sales (colored & white) “We want dairy producers to have enough time to make thoughtful and well- Fresh to 10 years. Available in LTL & T/L's studied choices,” Vilsack says. “Markets change, and the Margin Protection Program can help protect dairy producers from those changes.” Grading Services In addition, the public comment deadline on MPP and the Dairy Product Donation FIVE Licensed WI Cheese Graders Program has been extended to Dec. 15. Submit comments at http://go.usa.gov/GJSA. CMN 2nd & 3rd Generations Flavor & Functionality Profiling BAKER of jobs created and retained during Mild, Medium, Sharp, XSharp & Beyond that period. Chunk, Shred, Slice, Dry, Process, Etc. Continued from page 1 “Baker Cheese Factory is one of Warehouse & Financing Available many family-owned cheese companies Throughtout Wisconsin Baker Cheese label and for several that has a rich history in Wisconsin, and private labels. The company has the we are pleased to support the company capability to produce string cheese in a in its modernization efforts,” says Reed 3051 Progress Way, Suite 206, Kaukauna, Wisconsin 54130 variety of fl avors and styles for custom- Hall, secretary and CEO, WEDC. “This P: 920.759.1534 F: 920.759.1529 ers of various sizes. award, like others WEDC has provided Ken Neumeier, President & CEO, [email protected] “Baker Cheese is committed to the to cheesemakers throughout the state, Kate Neumeier Clarke, V.P. & COO, [email protected] growth of the Wisconsin dairy industry will help ensure that Wisconsin con- photo copyright WMMB by investing in our Wisconsin cheese tinues to produce the most — and the plant operations,” says Brian Baker, best — cheese in the country.” CMN For more information please visit www.wagcheese.com president, Baker Cheese. “High-quality Wisconsin milk and dedicated employ- ees allow our company to supply award- winning string cheese to the growing domestic and international markets. Over 75 Years As an organization, we have remained focused on providing high-quality jobs to our local economy and are excited of Setting The about this next project for the continued growth of our company.” Standard of Excellence In addition to making building and equipment improvements in St. Cloud, Baker Cheese is investing in a United Industries is the technology leader new wastewater treatment facility that manufacturing 100% laser-welded tubing! will help the company expand its whey • Experience, Stability & Reliability operations. • Manufacturing Stainless Steel Tubing up to 8" OD According to the Wisconsin Eco- • Extensive Inventory Available for Immediate Shipping nomic Development Corp. (WEDC), the demand for whey has grown both Demanding application environments call for the highest quality tubing. domestically and internationally. It has been proven that laser-welded tubing outperforms TIG welded During the fi rst three months of 2014, tubes, and United Industries has been perfecting its laser welding Wisconsin companies exported $44 mil- capabilities since 1992. lion in whey to other countries — a 53 percent increase over last year. WEDC has authorized up to $800,000 in Economic Development Tax Credits 100% Made for the company over the next three in the USA 1546 Henry Avenue • Beloit, Wisconsin 53511 years. The actual amount of tax credits Phone 608.365.8891 • Fax 608.365.1259 • www.unitedindustries.com awarded will depend upon the number For more information please visit www.unitedindustries.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 12 CHEESE MARKET NEWS® — October 31, 2014 EVENTS

One-day seminars to offer guidance for farms, food businesses to grow Wisconsin’s markets MADISON, Wis. — The Dane County, of Agriculture, Trade and Consumer Protec- “These low-cost seminars are great • Know Your Buyer: 9 a.m. to 12:15 Wis., University of Wisconsin-Extension has tion (DATCP) and other partners to offer ways to gain technical knowledge from p.m., Feb. 9-12. partnered with the Wisconsin Department the Local Food Business Seminar Series. industry experts,” says Sarah Elliott, local • Selling Through a Distributor: 9 a.m. and regional agriculture program supervi- to 12:15 p.m., March 2-5. sor, DATCP. “We are excited to continue • Finding the Dollars: 8:30 a.m. to to provide a wide array of resources 12:45 p.m., March 16-19 that promote the economic viability of During each week listed above, the Wisconsin’s local food industry.” locations are as follows: Registration is now open. The one-day Mondays are at the Retzer Nature classes each cost $15 and will include Center in Waukesha, Wis.; Tuesdays are lunch. Something Special from Wisconsin at the Portage County UW-Extension in members get a $5 discount per class. Stevens Point, Wis.; Wednesdays are at The dates and topics are as follows: the Kickapoo Culinary Center in Gays • Legal/Business Structures: 9 a.m. Mills; and Thursdays are at the DATCP to 3:15 p.m., Nov. 3-6. in Madison, Wis. • Food Safety: 9 a.m. to 3 p.m., Dec. 1-4. For a full schedule or to register • Marketing: 9 a.m. to 3:15 p.m., Jan. visit datcp.wi.gov/business/buy_local_ 5-8. buy_wisconsin/blbw_workshops. CMN USDA, HHS set sixth DGAC meeting for Nov. 7 WASHINGTON — USDA and the U.S. report to be given to USDA and HHS. Department of Health and Human Ser- The report will outline science-based vices (HHS) in Monday’s Federal Reg- recommendations and rationales which ister announced that the sixth meeting will serve as the basis for developing the of the 2015 Dietary Guidelines Advisory eighth edition of the Dietary Guidelines Committee (DGAC) will be held Nov. 7 for Americans. from 10 a.m.-5:30 p.m. EST. The meeting As legislatively mandated, delibera- will be accessible via webcast online. tions of the DGAC will occur in a public The DGAC, comprised of 14 mem- forum. It is currently planned for the bers appointed by USDA and HHS DGAC to hold approximately seven secretaries in May 2013, will examine public meetings to review and discuss the current Dietary Guidelines for recommendations. Americans, take into consideration Registration is required and is expect- new scientifi c evidence and current ed to open Oct. 23. For more information, resource documents and develop a visit www.dietaryguidelines.gov. CMN FDA holding FSMA public meeting Nov. 13 COLLEGE PARK, Md. — FDA has on the foundational FSMA proposed rules, announced a public meeting to discuss FDA issued supplemental notices of pro- proposed revisions to four rules originally posed rulemaking that propose signifi cant proposed in 2013 to implement the FDA changes to four of the proposed rules Food Safety Modernization Act (FSMA). including: Current Good Manufacturing The meeting will take place Nov. 13 at Practice and Hazard Analysis and Risk- the Wiley Building in College Park, Md. Based Preventive Controls for Human For more information please visit www.prospectanalytical.com In response to the comments received Food; Standards for the Growing, Harvest- ing, Packing, and Holding of Produce for Human Consumption; Current Good Man- The Standard of Excellence ufacturing Practice and Hazard Analysis and Risk-Based Preventive Controls for in Cheesemaking Equipment Horizontal Cheese Vats Food for Animals; and Foreign Supplier 10,000 - 80,000 lb. capacity Verifi cation Programs for Importers of CheeseCh VatsV featuring OptiSet Technology Food for Humans and Animals. The purpose of the public meeting is to solicit oral stakeholder and public Block Formers comments on the new content of the supplemental proposed rules and to inform the public about the rulemaking Cottage Cheese Vatss process (including how to submit com- ments, data, and other information to the rulemaking dockets), and to respond Draining/Salting Beltslts to questions about the supplemental proposed rules. There is no fee to register and reg- Curd Tables istration is on a fi rst-come, fi rst-served basis. Early registration is recommended Process Engineeringg because seating is limited. A live webcast of the event is being offered through the registration process. For more information or to register con- tact Courtney Treece of Planning Profes- Innovative process solutions, engineered right. USA . The Netherlands . New Zealand sionals Ltd., at 704-258-4983 or ctreece@ / +1 (320) 231-2210 www.relco.net planningprofessionals.com, or visit www. fda.gov/food/newsevents/workshops For more information please visit www.relco.net meetingsconferences/default.htm. CMN © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 13 EVENTS PEOPLE

Weston A. Price Obituary Comings and goings ... comings and goings to hold Raw Milk Glanbia Foods USA, Twin Falls, organization’s National Dairy FARM Symposium Nov. 10 Hans Lehner Sr. Idaho, has announced the retirement of (Farmers Assuring Responsible Manage- MADISON, Wis. — Hans Lehner Sr., 58, president and CEO, Jeff Williams. His ment) program. Before joining Animal WASHINGTON — The annual Raw Milk retirement is effective in January after Agriculture Alliance, Meredith was a Symposium presented by the nutrition of Browntown, Wis., died here at the Uni- versity of Wisconsin Hospital on Oct. 15. 25 years of service, including the last litigation assistant in the New York At- education non-profi t, The Weston A. 11 years being in his current position. torney General’s offi ce. She also served Price Foundation, will be held Nov. 10 Lehner managed and was the head cheesemaker at Valley View Cheese Upon his retirement, Glanbia’s executive as a speech writer at the Department of from 9:15 a.m. to 4 p.m. EST, and will leadership team will report directly to Agriculture. be available online during and after the Cooperative, South Wayne, Wis. He was a member of the Wisconsin Cheese Mak- Brian Phelan, CEO, global ingredients, PMMI, The Association for Pack- symposium. Glanbia Foods USA, pending a leadership aging and Processing Technologies, The symposium will feature raw ers Association and the Southwestern Wisconsin Cheese Makers Association, restructure. Reston, Va., producer of the Pack milk experts and activists, namely Mark The National Milk Producers Fed- Expo portfolio of trade shows, has McAfee, raw milk dairy owner and and he won many awards for his cheese. He is survived by his wife eration (NMPF), Arlington, Va., has welcomed Ray Luca to the staff as chairman of the Raw Milk Institute, announced that Emily Metz Meredith, director of expositions. Luca oversees Pete Kennedy, president of the Farm- Denise Lehner; children Hans Lehner Jr. and Gabriela Lehner; brothers vice president of communications and the team responsible for the opera- to-Consumer Legal Defense Fund, membership for the Animal Agriculture tions and management of Pack Expo and Sally Fallon Morell, founder of A Willi Lehner (Kitas McKnight) and Seppi Lehner; and sisters Mary (James) Alliance, will join NMPF next month as events. Prior to PMMI, Luca worked Campaign for Real Milk. vice president of animal care for the with NaylorCMG in Fairfax, Va. CMN Specifically the symposium will Meives and Heidi (Chris) Fannin. CMN cover raw milk legal updates for the United States and Canada; the produc- tion of safe raw milk cheese; an update from the Raw Milk Institute; and a ses- sion on the steps required to become a raw milk dairy in California. For more information visit www. westonaprice.org/press/raw-milk-sym- posium-will-explore-raw-milk-safety- issues. The symposium will stream live and be available after the sym- posium at www.fl eetwoodonsite.com/ wise/2014annual/live_raw_milk. CMN NCIMS gearing up TRUST THE FIRST for biennial meeting PORTLAND, Ore. — The National Conference on Interstate Milk Ship- INSTALL ments (NCIMS), a non-profit milk safety organization, is meeting for its biennial conference April 24-29 at the Doubletree by Hilton Hotel Portland in THE BEST Portland, Ore. The main purpose of the confer- ® ence is to deliberate proposals submit- SÜDMOSSÜDMOD 365IT COMPLETE PMO ted by various individuals from state or CHEESEC E CURDC & TANK OUTLET MIX PROOF VALVES local regulatory agencies, FDA, USDA, producers, processors and consumers. The proposals are assigned to one of ɒFirst PMO mix proofpro valve with less than a full three councils, who then discuss the port leakageeakage chamberchambe to meet 3-A standards merits of each proposal assigned to ɒEHEDGG certified Type EL Class I for in place cleanability that council, with a resulting recom- ɒPatentedted deflector provideprovides a true mechanical barrier for mendation to the delegate body. securee separationseparation of productprod / CIP The delegate body is composed of representatives from each state and ɒ,QWHOOL7RS&RQWURO8QLW7RS  &RQWURO 8 U.S. territory that chooses to send - Providesides required feedback to meet PMO such a representative. Each state and - Fast and easy setups territory has one vote. - IP65,, IP67, IP69 protection classes The NCIMS is governed by an executive board comprised of rep- TYPE EL - CLASS 1 resentatives from state and local August 2012 regulatory agencies from three dif- Arla Foods’ Hollandtown Dairy in ferent geographical regions, FDA, Kaukauna, WI automated its cheese USDA, industry, and laboratories and vats with Pentair Südmo valves, including the 365it Complete PMO academia. Cheese Curd Outlet Mix Proof Valves. In addition to the executive board, To discuss your applications and committees have been established to our success stories, contact 262.725.9026 or [email protected] study various proposals and report their findings. These studies and WWW.SUDMONA.COM reports aid the council members and delegates in making decisions as they deliberate and vote on the proposals. For more information vis- it www.ncims.org. CMN For more information please visit www.sudmona.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 14 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

RENEW diffi cult than, for example, cosmetic companies who have larger margins and Continued from page 1 can afford to spend more on packaging, Castle says. “What’s happening here (in the Major retailers such as Walmart and United States) is that there is a higher Costco have driven the trend by re- cost on sustainable-type packaging. In questing renewable packaging for their Europe they use more sustainable pack- customers, which has helped increase 40LB aging that is lightweight and greener and promote renewable packaging, but because of a government mandate on not nearly to the scale seen in Europe, CHEESE taxing the carbon footprint of packaging Castle adds. manufacturing, which causes them to “Lactalis will revisit renewable BLOCK be more innovative,” Castle adds. packaging in the future,” Castle says. Castle says the European mandate “I would like to see it embraced more causes packaging manufacturers to in the United States. There is a similar HANDLING fi gure out the best way to create renew- carbon-based taxing making its way in FULLY AUTOMATED, able packaging. With the carbon tax, Canada and I think the United States de-cartoning, companies in Europe are looking and will be close behind. I do see it coming succeeding in creating cost-effective in the next 10 years.” de-bagging & in-line renewable packaging solutions for the Another type of renewable packag- block tracking turnkey dairy and cheese industries. This is ing possibility is coming from the dairy system solutions why European-based companies like industry in the form of whey. Haden & Custance is the preferred Tetra Pak create renewable products Two years ago, 14 partners from that fi t into its current production seven European Union countries formed supplier of choice amongst leading CONTACT machinery. WheyLayer Ltd. and set out to develop cheese processors globally for the US TODAY: “Environmental excellence is one a patented, sustainable packaging ma- following key reasons: USA 800 351 1745 of Tetra Pak’s strategic priorities and terial with an economical production UK +44 (0) 78 3113 3375 • Increased production output/ a driver of our product development process that uses the barrier properties AU +61 (0) 437 095 162 yield/efficiency activities,” says Charles Brand, vice of whey protein against oxygen and president of marketing and product humidity to replace the conventional • Dramatically reduced management, Tetra Pak. “Together polymer layers in packaging with a overhead costs with suppliers, customers and other natural product. • Complete product[s] ASK OUR stakeholders, we are leading the in- Whey, a cheese byproduct, can CUSTOMERS: dustry toward 100 percent renewable be highly polluting if not properly traceability from pallet packaging. We believe that increasing handled due to its high organic con- to packet “Haden & Custance is the only the renewable content of our packages tent. Fifty percent of the 50 million company that we are aware of • Automated cheese is not only good for the environment, but metric tons of whey produced annu- globally who can provide a fully also offers our customers a competitive ally in Europe is still unprocessed, mold detection functional and reliable one-stop advantage in the overall environmental WheyLayer says. • Complies with all USA/EU turnkey solution that meets our specific needs” profi le of their products.” Unfortunately, WheyLayer’s first dairy industry standards According to Castle, in the United material was limited in terms of the States renewable packaging is more deformation it was able to withstand of a marketing trend, and the cheese during the thermoforming process 210 Wilson Road, Hastings 4120 industry is market-driven, but also after a few days of storage. Currently, PO Box 143, Hastings 4156, New Zealand P +64 (0)6 872 7140 F +64 (0)6 877 0591 cost-driven. The production of cheese WheyLayer II is underway. www.hadencustance.com and dairy products is expensive, making Meanwhile, IRIS, a research insti- the use of renewable packaging more tute in Barcelona, Spain, kicked off For more information please visit www.hadencustance.com ThermoWhey this summer. Scientists will focus on creating a new bio-based, thermoformable whey barrier coating Innovation, Dedication, and that can be used for sensitive foods. Similar projects exist throughout Integrity Every Step of the Way! Europe, South America and Canada. Whey bioplastics in the United Our winning combination of experience, technology, and state-of-the-art States have been researched by USDA equipment will take your business to a higher level in the domestic or and other entities. However, there have international marketplace. not been signs of commercialization, • Over 30 Years of Experience • Value-Added Services says Dean Sommer, a cheese and food • Efficient and Cost Effective technologist with the senior manage- ment team at the Wisconsin Center for MSS Equipment & Services: Dairy Research. • Membranes (RO, UF, NF, MF) • Fabrication “To my knowledge, I have not heard • Engineering • Pilot Testing • Field Installation or seen commercialization in the United • Project Management • Membrane Testing • Replacement Parts States,” Sommer says. “There was much • Process Design • Feasibility Studies • Troubleshooting • Automation • Consulting • Technical Seminars talk of it around 2011. It’s possible it • Systems Integration • Comprehensive Plant Surveys could happen in the future, but there’s a • Control Upgrades lot of competing interest for whey here.” The outcome for whey bioplastics in the United States will be dependent on the driving force behind the movement, Sommer adds. “If commercialization does happen, it will have to be pushed from more of a P. O. Box 998 • 1430 Second Street North • Wisconsin Rapids, WI 54495 green perspective, not that whey is just (715) 421-2333 • Fax (715) 423-6181 a waste product,” Sommer says. “There’s Email: [email protected] • Web: www.mssincorporated.com so much value in whey these days, we’re For more information please visit www.mssincorporated.com even fi nding uses for acid whey.” CMN © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 15 NEWS/BUSINESS

FLUID meet consumer needs through a variety less sugar than traditional milk. The Gallagher notes other poten- of efforts including new products, new product also is lactose-free and comes in tial new products may include 100 Continued from page 1 channels, enhanced distribution, mer- a sleek hand-held bottle that highlights percent milk products as well as chandising and more. the connection to dairy farmers. milk-and-juice-blend products. CMN sales in the fl uid milk category.” “We can’t stay just with the traditional DMI’s fl uid milk partnerships repre- gallon and half-gallon options that exist sent marketplace leaders chosen for their now,” Hoff says. “We need to have innova- anticipated catalytic effect in causing tive, on-the-go fl uid milk products. And others in the business to follow with in- we want new packaging to get into new novation and investment, he adds. channels in innovative ways.” Clean-In-Place Systems The companies bring strong fi nancial, Gallagher notes that products will be technological and marketing capabilities geared largely toward extended-shelf-life to the partnerships; DMI’s commitment or shelf-stable products, with new packag- is assisting in product development, con- ing and smaller, on-the-go sizes. sumer insights, nutritional consulting, One of the fi rst new products that will technical and formulation support, and be launching toward the end of 2014 or introductions to perspective marketplace early 2015 is fairlife, an innovate new milk partners. product created through collaboration “We know that growing the fl uid milk between Coca-Cola and Sue and Mike Clean-in-Place Systems business won’t be quick or easy, but we McCloskey, owners of Fair Oaks Farms, believe these seven partners put us on Fair Oaks, Ind., through the cooperative Value-Added Technology the right footing,” says Neil Hoff, Texas Select Milk Producers. The product has dairy farmer and UDIA chairman. “We been tested in the Denver area and has see health and wellness and demand for been well-received, says Mike Saint John, Featuring EDT Liquid-Activated,Activated, RetractableRetractable protein as a consistent need for U.S. con- president of Coca-Cola North America’s sumers, and also for consumers around Minute Maid Business Unit. CIP Spray Nozzles designedignned to remain in placplacee the world.” The product has 50 percent more during production. The seven partnerships will work to protein, 30 percent more calcium, and This value-added technologynollogy eliminates the repetitivee taskstasks of • Sharp Cheddar CONTEST installing and removing First: Team 3, Tillamook County Continued from page 1 spray devices; and providesvides Creamery Association, Tillamook, Ore., a reliable, repeatable CIPCIP cycle.cycle. Sharp Cheddar, 99.00. Joint Annual Meeting of the National Second: Team 1, Tillamook County Creamery Association, Tillamook, Ore., Various styles and optionsons Dairy Promotion and Research Board, available. NMPF and United Dairy Industry As- Sharp Cheddar, 98.75. sociation held here this week. Third: Team Chateaugay, Agri-Mark Give us a call. Today. Designa’s Regular Provolone also was Inc., Chateaugay, N.Y., McCadam Sharp named “Best Italian” at the cheese con- New York Cheddar, 98.55. test. “Best Cheddar” went to Tillamook • Extra Sharp Cheddar County Creamery Association’s Team 1, First: Luke Kopecky, Land O’Lakes Tillamook Ore., for its Medium Cheddar, Inc., Kiel, Wis., Extra Sharp Cheddar, 99.50. while the “Best Cottage Cheese” title £näxÊ,ˆ`}iÜ>ÞÊ-ÌÀiiÌÊÊUÊÊ>““œ˜`]Ê7ˆÃVœ˜Ãˆ˜Êx{ä£xÊÊ1-
Second: Team Chateaugay, Agri-Mark /i°ÊÇ£x°Ç™È°ÓΣÎÊÊUÊÊ>Ý°ÊÇ£x°Ç™È°ÓÎÇn went to cheesemaker Jim Hoffman of 7iLÈÌi\ÊÜÜÜ°iÛ>«`ÀÞiÀÌiV °Vœ“ÊÊUÊÊ “>ˆ\ʈ˜vœJiÛ>«`ÀÞiÀÌiV °Vœ“ Prairie Farms Dairy Inc., Quincy, Ill., for Inc., Chateaugay, N.Y., McCadam Extra his 4-percent small curd variety. Category Sharp New York Cheddar, 98.50. winners from the contest were featured Turn to RESULTS, page 16 D For more information please visit www.evapdryertech.com at the meeting’s “Welcome to Texas” reception Tuesday evening. 241%'55'0)+0''4+0)(#%+.+6;#4%*+6'%674' Cheese competition judges were #0&'0)+0''4+0)&'5+)0#..70&'410'411( Noreen Ratzlaff and Allison Reynolds of USDA’s Dairy Division; Mark Johnson, as- sistant director, University of Wisconsin Center for Dairy Research; and Timothy 9GJCXGCWPK9GJCXGCWPKSWGCRRTQCEJKPSWGCRRTQCEJKP WPWPFGTUVCPFKPIVJGMG[FKUKRNKPGUFGTUVCPFKPIVJGMG[FKUKRNKPGU Meyers, assistant professor, food admin- QQHCHCEKNKV[D[KPEQTRQTCVKPIQWTHCHCEKNKV[D[KPEQTRQTCVKPIQWT istration, College of DuPage. CTEJKVGEVWTCNCPFGPCTEJKVGEVWTCNCPFGPIKPGGTKPIIKPGGTKPI Award winners and scores in each UGTXUGTXKEGUCUCTGUWNVKVETGCVGUKEGUCUCTGUWNVKVETGCVGU category are as follows: CUGCOCUGCONGUUTGNCVKQPUJKRDGVYGGPNGUUTGNCVKQPUJKRDGVYGGP • Mild Cheddar VJGOCPWHCEVWTKPVJGOCPWHCEVWTKPIRTQEGUUCPFIRTQEGUUCPF VVJGDWKNFKPICTQWPFKV6JKUJGDWKNFKNFKKPICTQWPFFKKV6JK6J U First: Tom Daul, Land O’Lakes Inc., WPWPKSWGCRRTQCEJFGNKXGTUCDGVKSWGCRRTQCEJFGNKXGTUCDGVVGT Kiel, Wis., Mild Cheddar, 98.00. QWVEQOGCPFGPUWTGUQWTENKGPVU Second: Team Middlebury, Agri-Mark CCNYC[UIGVCDGVVGTRNCPNYC[UIGVCDGVVGTRNCP Inc., Middlebury, Vt., Cabot Mild Vermont Cheddar, 97.50. (QTOQTGKPHQTOCVKQP(QTOQTGKPHQTOCVKQPIQVQIQVQ Third: Foremost Farms USA, Marsh- GGZEGNGPIKPGGTEQOQTGOCKNZEGNGPIKPGGTEQOQTGOCKN WUCVKPHQWUCVKPHQ"GZEGNGPIKPGGTEQOH "GZEGNGPIKPGGTEQO fi eld, Wis., Mild Cheddar, 97.25. • Medium Cheddar First: Team 1, Tillamook County Creamery Association, Tillamook, Ore., Always a better plan Medium Cheddar, 97.75. Second: Team Cabot, Agri-Mark Inc., Cabot, Vt., Medium Vermont Cheddar, 97.25. GZEGNGPIKPGGTEQO Third: Team Chateaugay, Agri-Mark GZEGNRTQEGUUGPIEQO Inc., Chateaugay, N.Y., Medium New York Cheddar, 96.75. For more information please visit www.excelprocesseng.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 16 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

RESULTS Valley Farms, Faribault, Minn., Gorgon- Iowa, Cut Swiss, 99.20. & Monterey Jack with Peppers, 98.60. zola, 99.40. • Processed American Plain • Unique or Flavored Continued from page 15 Third: Caves of Faribault, Swiss Val- First: Russ Evans, Associated Milk First: Swiss Valley Farms, Luana, ley Farms, Faribault, Minn., Blue, 99.20. Producers Inc., Portage, Wis., Colored Iowa, Smoked Maasdam, 99.20. Third: Team Middlebury, Agri-Mark • Natural Slices, 98.80. Second: Team Cabot, Agri-Mark Inc., Inc., Middlebury, Vt., Cabot Extra Sharp First: Team 2, Tillamook County Second: Ralph Schutz, Associated Cabot, Vt., Cabot Chipotle Cheddar, 98.90. Vermont Cheddar, 98.20. Creamery Association, Boardman, Ore., Milk Producers Inc., Portage, Wis., Swiss Third: Swiss Valley Farms, Luana, • Provolone Co-Jack, 99.50. Slices, 98.50. Iowa, Gouda Plus, 98.80. First: Albert Designa, Dairy Farm- Second: First District Association, Third: Roger Davis, Associated Milk • Reduced Fat ers of America, Turlock, Calif., Regular Litchfi eld, Minn., Marbled Monterey Jack Producers Inc., Portage, Wis., EZ Melt First: Team 2, Foremost Farms USA, Provolone, 99.70. & Cheddar, 99.30. Loaf, 98.20. Clayton, Wis., Reduced Fat Smoked Second: Team 3, Foremost Farms USA, Third: Team Chateaugay, Agri-Mark • Processed American Flavored Provolone, 98.70. Chilton, Wis., Smoked Provolone, 99.30. Inc., Chateaugay, N.Y., McCadam New First: Chris Dickson, Dairy Farmers of Second: Team 1, Foremost Farms Third: Sam Lopes, Dairy Farmers of York Muenster Cheese, 99.20. America, West Middlesex, Pa., Processed USA, Clayton, Wis., Reduced Fat Provo- America, Turlock, Calif., Regular Provo- • Swiss American Cheese with Peppers, 99.10. lone, 98.50. lone, 99.20. First: Swiss Valley Farms, Luana, Second: Team Chateaugay, Agri-Mark Third: Team 1, Tillamook County • Hard & Mold Ripened Italian Iowa, Baby Swiss, 99.50. Inc., Chateaugay, N.Y., Horseradish Ched- Creamery Association, Tillamook, Ore., First: Associated Milk Producers Inc., Second: Swiss Valley Farms, Luana, dar Cheese, 99.00. Reduced Fat Monterey Jack, 98.40. Hoven, S.D., Aged Romano, 99.50. Iowa, Maasdam, 99.30. Third: Ralph Schutz, Associated Milk • Open Class Second: Caves of Faribault, Swiss Third: Swiss Valley Farms, Luana, Producers Inc., Portage, Wis., American First: Salvador Beltran, Dairy Farm- ers of America, Houston, Texas, Queso Fresca, 98.60. Second: Swiss Valley Farms, Luana, Iowa, Cream Cheese, 98.50. Third: Salvador Beltran, Dairy Farm- Industrial Flooring ers of America, Houston, Texas, Panela Fresca, 98.40. • Cottage Cheese Specialists for First: Jim Hoffman, Prairie Farms Dairy Inc., Quincy, Ill., 4-percent Small Curd, 99.20. Over 50 Years! Second: Jason, Zack, Lance, Prairie Farms Dairy Inc., Chandler, Okla., 4-per- cent Small Curd, 98.90. We combine the highest quality Third: Dwayne Elkins, Prairie Farms Dairy Inc., Fort Wayne, Ind., 4-percent materials with time-proven Small Curd, 98.50. • Reduced Fat Cottage Cheese installation. First: Jim Hoffman, Prairie Farms Dairy Inc., Quincy, Ill., 2-percent Small Curd, 99.00. Second: Dwayne Elkins, Prairie Farms ANY ONE OF THESE SITUATIONS Dairy Inc., Fort Wayne, Ind., 4-percent CAN SHORTEN YOUR FLOOR’S Small Curd, 98.70. LIFESPAN: Third: Mike Nappo, Upstate Niagara • Low Grout Joints Cooperative Inc., West Seneca, N.Y., 1-percent Small Curd, 98.60. • Cracked Chipped or Broken Brick/Tile • Flavored Cottage Cheese First: Mike Nappo, Upstate Niagara • Expansion Joint Failure Cooperative Inc., West Seneca, N.Y., • Chemically Attacked 4-percent Pineapple, 98.70. Brick and/or Joints Second: Tony Lepkowski, Upstate • Heaving or Dis-bonded We also manufacture Niagara Cooperative Inc., West Seneca, Brick/Tile heavy-duty cast N.Y., Nonfat Pineapple, 98.40. 316 stainless steel Third: Tony Lepkowski, Upstate floor drains. A properly maintained acid brick/tile floor Niagara Cooperative Inc., West Seneca, • Handles Fork Lift N.Y., 4-percent Chive, 98.20. provides excellent protection from chemical Truck Traffic and physical attack and can last a lifetime! • Offers Good • Natural Cheese Snack Chemical/Acid First: Joe Hines, Ellsworth Coopera- Think of your acid brick/tile floor as an Resistance tive Creamery, Ellsworth, Wis., Ranch • Built To Receive investment. The preventative maintenance a Membrane Cheddar Cheese Curds, 98.90. you provide TODAY will save you money Second: Joe Hines, Ellsworth Coop- in the future. erative Creamery, Ellsworth, Wis., Garlic Cheddar Cheese Curds, 98.80. Third: Joe Hines, Ellsworth Coop- erative Creamery, Ellsworth, Wis., Cajun Cheddar Cheese Curds, 98.70. • Processed Cheese Snack First: Team Cabot, Agri-Mark Inc., A national leader, Stogsdill Tile Company has Call 800.323.7504 today Cabot, Vt., Cabot Extra Sharp Spreadable specialized in the design, installation and repair for a free, no-obligation estimate or Cheddar, 98.60. (with a focus on preventative maintenance) Visit us on the web at Second: Team Cabot, Agri-Mark Inc., of acid brick/tile flooring since 1963. www.stogsdilltile.com Cabot, Vt., Cabot Habanero Spreadable Cheddar, 98.00. Estimating Department: Joe Kline • Email: [email protected] • Phone: 610-583-0582 • Web: www.stogsdilltile.com Third: Team Cabot, Agri-Mark Home Office: 14604 Harmony Road • Huntley, IL 60142 • Phone: 847-669-1255 • Fax: 847-669-1278 • Toll Free: 800-323-7504 Inc., Cabot, Vt., Cabot Horseradish Spreadable Cheddar, 97.90. CMN For more information please visit www.stogsdilltile.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 17 NEWS/BUSINESS

Texas elementary school shines as Fuel Up To Play 60 program grows across the nation

By Alyssa Mitchell dents can log their own activity hours than 200 are involved in the program, staff, parents and community on the and other points online. with Sharon Foster at the helm. importance of eating healthier foods and DALLAS — With U.S. fl uid milk con- In addition, schools can apply for Foster, physical education teacher participating in physical activity daily. sumption declining and childhood funding. Up to $4,000 per year is avail- and FUTP60 program adviser at James “Regular physical activity utilizing obesity climbing at an alarming rate, able to qualifying schools enrolled Bowie, teaches grades pre-kindergar- the physical activity plays of Fuel Up the dairy industry, the National Football in the program to kick-start healthy ten through fi fth grade, with grades 3-5 To Play 60 assists in promoting growth League (NFL) and schools nationwide changes. To qualify for the competitive, participating in the program. and development,” she says. “Students came together to start schoolchildren nationwide funding program, schools There are 250 students currently that are more active show greater at- on a healthier path. must participate in the National School enrolled in the program at James tention, have faster cognitive speed They did so with the 2009 national Lunch Program and have a registered Bowie, with 50-some that have reached and have overall improved academic launch of Fuel Up To Play (FUTP) 60, program adviser. ambassador-level status, Foster says. performance.” a program founded by the National With more than 73,000 schools “Every year, more students want Foster works in tandem with the Dal- Dairy Council (NDC) and NFL, in col- enrolled across the nation today, an to join the program,” Foster says. las Independent School District (ISD) laboration with USDA, that empowers elementary school in Texas has been “Sometimes, they may have had an Food and Child Nutrition Services. students to take charge in making a standout in program implementation older sibling who participated, which Dallas ISD school meals are planned by small, everyday changes at school. and success. gets them excited to join.” a team of foodservice nutrition profes- FUTP 60 is a customizable in-school James Bowie Elementary, Dallas, Foster says she became interested in sionals to provide a variety of nutritious program that encourages youth to im- has more than 550 students, and more FUTP60 as an effort to educate students, Turn to FUTP60, page 26 D prove nutrition and physical activity at their school and for their own health by consuming nutrient-rich foods — including lowfat and fat-free dairy, fruits, vegetables and whole grains — and achieving at least 60 minutes of physical activity every day. The ultimate goal is to ensure changes made at school are sustainable and complement an academics-focused environment, NDC says. With the support of dairy farmers, NDC brings nutrition expertise and nearly 100 years of science-based research; the NFL provides physical fi tness expertise and the “star power” of its teams and players; and USDA brings a long-standing commitment to better nutrition for children and all Americans. The program is primarily focused on kindergarten through eighth grade but is especially geared toward elementary students. There are six steps to implement the program: • Join the League — An adult must join FUTP60 and become a program ad- viser. The adviser encourages students to join the program and/or displays CRAFT YOUR PROGRAM OF program signage in a prominent place in the school and works with students CHEESE MARKET DOMINANCE to create fl yers and posters. Learn 10 ways Weber helps cheese processors dominate • Build Teams and Draft Players — with perfect execution. At least one student who has earned at Unmatched blade technology and exclusive Discover the most complete, flexible and hygienic least 20,000 points (points are earned WEBER INC. Vario Grippers™ are just two of the ways that natural cheese slicing solutions ever created. 10701 N. Ambassador Drive Weber is helping today's most successful natural Check out weberslicer.com for a list of 10 by logging healthy eating and physical Kansas City, Missouri 64153 Phone: (816) 891-0072 cheese processors to create perfect slices, ways that Weber can help you dominate activity online) must become a School Fax: (816) 891-0074 on-weight portions and more profitable operations. your cheese market. Ambassador for the current school www.weberslicer.com e-mail: Better yet, call and arrange a product [email protected] Consider just two of the essential ways that Weber year. FUTP60 ambassadors lead healthy can help you succeed: demonstration. changes in the school and encourage youtube.com/weberslicer others to stay healthy and active. Superior Blade Technology (#3) linkedin.com/company/weber-inc- • Innovative round and involute blade geometry • Kickoff — The school must host • Special coatings and micro-perf edges a kickoff event to get excitement go- We proudly support • Proprietary, market-tested alloys the missions of ing for the program and encourage In combination, these features increase slice and participation. on-weight portion perfection at blade speeds up to • Survey the Field — The school 1,500 RPM. Longer blade life is also assured. must complete an online school well- Weber’s proprietary gripping system and superior blade Vario Gripper product security (#8) technology combine to eliminate product waste and assure ness investigation. • Firmly secures any natural cheese product consistently on-weight portions – www.weberslicer.com. • Game Time — Schools must select • Automatically adjusts to variations in cheese contours and firmness. Healthy Eating and Physical Activity plays to implement in the school. Weber’s patented gripping system assures slicing flexibility and precision, reducing give-away to • Light Up the Scoreboard — A reg- near zero. istered adult at the school must submit a success story on the FUTP60 website. 1-800-505-9591 There is a student website, sup- porter site and educator site, and stu- For more information please visit www.weberslicer.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 18 CHEESE MARKET NEWS® — October 31, 2014 NEW PRODUCTS FOR DAIRY MANUFACTURERS

Siemens will showcase new Sinamics S120M decentralized drive system at Pack Expo

ELK GROVE VILLAGE, Ill. — Expanding cabinet and directly onto the motor, and other processes, where machinery and tion drastically reduces the number and on its Sinamics S120M multi-axis drive thereby reducing both cabinet space and production lines require multiple servo length of cables and is easily expanded for system, Siemens — a manufacturer of required cooling, Siemens says. axes in a space-restricted environment. additional axes, Siemens says. production equipment for the cheese The addition of the S120M distributed The decentralized S120M axes are Additional design features of the and dairy industries — will introduce format into the S120M offering adds a high connected back to the central S120M S120M include a synchronous servomotor its new Sinamics S120M at Pack Expo in degree of fl exibility for new and existing components in the cabinet via a hybrid with multi-turn absolute encoder, optional Chicago, Nov. 2-5. machines, as well as introducing innova- cable and the AM600 adapter module. holding brake and an integrated power The S120M is a compact, ready-to- tive production line setups that can now The pre-assembled hybrid cable contains unit available in three shaft heights cover- connect motor with integrated drive be achieved, the company adds. all encoder and power cables and serves ing the power range of 0.25-1.5 kilowatts. that offers users the option of moving Typical applications for the S120M multiple S120M axes through a daisy For more information visit www. the motor inverter outside the control include packaging, printing, glass, textile chain connection. This single-cable solu- usa.siemens.com/S120M-PR. CMN Bosch Packaging Technology Inc. will present several new technologies at Pack Expo

CHICAGO — At Pack Expo Interna- system solution, Bosch offers technolo- the company says. the Elematic 3001, a wrap-around case tional 2014, taking place here Nov. 2-5, gies for individual customer needs,” Bosch also will display Module++ packer with improved ergonomics for Bosch Packaging Technology Inc., a says Paul Garms, marketing manager, lines, which link the company’s stan- increased workplace safety, according supplier of processing and packaging Bosch, New Richmond, Wis. “From ini- dard modules for customized process- to Bosch. solutions, will present several new tial consultation to after-sales services, ing and packaging solutions. At the Bosch also will highlight its latest technologies. Bosch’s extensive portfolio ensures show, Module++ will demonstrate robotics advancements. These include Ranging from entry-level solutions that manufacturers are equipped with product distribution and feeding, a Paloma Delta robot feeding a primary to high-end technology, Bosch will the right solution.” primary packaging and end-of-line packaging flow wrapper and a Presto showcase its Pack Series of horizon- At the show, Bosch will showcase cartoning, as well as case packing with Delta robot placing products into sec- tal flow wrappers, which range from two high-speed Seamless Systems. Bosch’s CCM 3100 case packer. ondary packaging. The Paloma features entry-level models to fully automated From product handling through Additionally, Bosch will make the the new GD33 Delta robot arm and technologies. The company also will case packing, the speed of all line North American debut of its new roller an open-frame design for expedited spotlight vertical packaging and robot- components is balanced to eliminate former, the WRF 600, which features cleaning and simplified operations, ics technologies. bottlenecks, minimize downtime and working width adjustment during pro- Bosch says. “Whether starting out with a stand- maximize product flow, which opti- duction without machine stops. Also For more information visit alone machine or seeking a high-end mizes overall equipment effectiveness, being introduced to North America is www.bosch-home.com/us. CMN

Our Expertise in World Dairy Markets Makes MCT Your Global Partner for Successful Results

3/52#).'!.$,/')34)# 3%26)#%3

Could you use assistance in managing your supply chain?

30%#)!,):%$&/2-5,!4)/.3 We have expanded our team to bring you unprecedented expertise and knowledge in today’s complex world markets. s3OURCINGAND,OGISTIC3ERVICES ,%!$).'3).',%3/52#% s3PECIALIZED&ORMULATIONS $!)293500,)%2

s,EADING3INGLE3OURCE$AIRY3UPPLIER s!GING0ROGRAMS s(EDGING3ERVICES

5.0!2!,,%,%$3%26)#%3 s5NPARALLELED3ERVICES s%XPERTISEINTHE'LOBAL$AIRY-ARKET s%XPORT3ERVICES

%80%24)3%).4(%',/"!, MCT Dairies is the leading $!)29-!2+%4 supplier of cheese and dairy ingredients, offering innovative solutions throughout the world.

0HONE OR %MAIL INFO MCTDAIRIESCOM 7EB WWWMCTDAIRIESCOM

For more information please visit www.meadhunt.com For more information please visit www.mctdairies.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 19 NEW PRODUCTS FOR DAIRY MANUFACTURERS

Dynamic Conveyor will unveil metal detector option and new conveyor at Pack Expo

MUSKEGON, Mich. — At this year’s tiple frequency range and vibration The company says its DynaClean on product and desired throughput. The Pack Expo International, hosted in Chi- immunity, along with an integrated conveyor reduces the cost of ownership conveyors will accept product from a cago Nov. 2-5, Dynamic Conveyor Corp. beacon and configurable inputs and by offering a design that is much easier vibratory feeder or the company offers will introduce its new Eriex Xtreme Metal outputs. In addition, multiple metal to clean than bucket conveyors, and the option for stand-alone or attached Detector option for its conveyors and the detector conveyors can be remotely that its DynaClean Vertical Z Conveyor hoppers for bulk product feeding. New Vertical Z Conveyor. monitored and controlled from a single — that will debut at Pack Expo — is an “The ease in which the DynaClean The Eriex Xtreme Metal Detector computer. ideal solution for food processing facili- comes apart for cleaning with no tools option is for the company’s DynaClean “Our goal is to provide our custom- ties who have a need to move product to is great, just a matter of minutes from food-grade conveyors and includes en- ers with high-quality, easy-to-clean higher elevations. start to fi nish of the sanitation process,” hanced features, great sensitivity, intui- equipment that saves them money,” The Vertical Z is custom-designed to says Dave Miller, maintenance supervi- tive operation and exceptional reliability, says Jill Batka, president, Dynamic the desired height and includes widths sor, Pan-O-Gold Baking Co. “The solid Dynamic Conveyor says. Conveyor Corp. “The integration of the up to 24 inches. A variety of belt styles, surface belting with scoop fl ights can The metal detector’s interface Eriex Xtreme metal detector with the including solid-surface ThermoDrive and be washed in a matter of minutes vs. the was designed after smartphones and DynaClean conveyor does that well. It’s plastic link style belting, are compatible hours it can take to clean the buckets includes a QWERTY keyboard, an auto user-friendly interface compliments the with the DynaClean conveyor. Drive fl ight on an elevator conveyor.” set-up, dedicated reject log and vivid simple design of the DynaClean conveyor options include standard, 75-degree and For more information visit display. The Eriex Xtreme has a mul- systems.” scoop fl ights, which are selected based www.dynamicconveyor.com. CMN PDC International to exhibit new shrink labeler at Pack Expo

NORWALK, Conn. — PDC International Corp. says food and beverage companies that need a robust shrink sleeve system and precise label orientation for all pack- age shapes should check out its newly If nature could choose... introduced R-250 COER Evolution Shrink Labeler at Pack Expo in Chicago, Nov. 2-5. The R-250 quickly orients round and non-round containers and precisely aligns graphics for maximum visual impact, the company says. By integrating a third party container handler and close-coupling it with the PDC R-250 applicator, a single machine system is created that provides seamless container handling from orientation through labeling, according to PDC. After sleeving, the container travels through a PDC shrink tunnel system to complete the shrinking of the sleeve labels. The R-250 uses PDC’s proprietary blade assembly and is controlled with an Allen-Bradley CompactLogix PLC, touch screen and servos. Among the R-250’s options is a barcode scanner with laser scan engine that reads both 1D and 2D barcodes. The R-250 applies full sleeve shrink South Hall labels and tamper evident sleeves at Booths: 3974South and Hall 3982 speeds of 50 to 300 containers per minute. Booths: 3974 and 3982 A changeover feature and menu-driven parameters on the touch screen allow mandrels, feed screws, and other change parts to be switched out quickly, PDC says. A new range of filling systems for the dairy industry. Designed Flavored milk Heat Treated ESL Containers can be fi lled or empty, for pasteurized ESL or UHT milk and drinkable yogurt in HDPE Beverages Yogurt

Juice and any size or shape. PVC, PETG, OPS or PET bottles in any shape or size. We process,UHT and PLA labels, in gauges as thin as 30- ESL Flavors Pasteurized Sports Drinks UHT 40 micron are all compatible. Systems Flavored Milk Beverages

Heat Treated Chocolate Milk Pasteurized

& Yogurt Nutritional Drinks UHT nectar can be built with optional modules for GEA Procomac Protein Drinks

Milk yogurt vertical and horizontal perforations and packyogurt it all Milk Aseptic processing Juices date coding. GEA Process Engineering Inc. Cream Pasteurized Flavored Milk

Milk Juices with fruit pieces PDC highlights the product’s ar- 1600 O’Keefe Road, Hudson WI 54016 USA Chocolate Milk nectar Beverages Nutritional Drinks ticulating splice table for precise roll Phone: +1-715 386 9371; Fax: +1-715 386 9376 splicing, and also adds that conveyors [email protected] www.gea.com and shrink tunnels, either dry heat or steam, can be supplied as part of an R-250 system. engineering for a better world GEA Process Engineering For more information, con- tact Gary Tantimonico at 203- 853-1516 or [email protected], or visit www.pdc-corp.com. CMN For more information please visit www.gea.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 20 CHEESE MARKET NEWS® — October 31, 2014 NEW PRODUCTS FOR DAIRY MANUFACTURERS

Eagle to release new inspection technologies Clear Lam to showcase latest PrimaPak

TAMPA, Fla. — At this year’s Pack Eagle says MDX guarantees the de- ELK GROVE VILLAGE, Ill. — Clear Lam ing System replaces heavy cans, bottles, Expo International, hosted in Chicago tection of contaminants, such as glass Packaging Inc. says it has some exciting jars, trays and select fl exible packaging. Nov. 2-5, Eagle Product Inspection will shards, rocks, rubber and plastic, in plans for this year’s Pack Expo, taking Produced on proprietary vertical form- be releasing its new range of advanced products which produce high variations place Nov. 2-5 in Chicago. fi ll-seal (VFFS) equipment from custom X-ray inspection and fat analysis tech- in image density. Clear Lam will have its latest Pri- rollstock, the PrimaPak technology nologies. The Eagle Easy MAT software maPak equipment and innovations on improves the package cube 30 percent “By further advancing our product auto-learns the material composi- display, including new vertical form-fi ll- or more compared to PET jars, the inspection technologies, manufacturers tion of the product and identifies seal equipment featuring its proprietary company says. can check for contaminated materials, contaminants which are different interface developed with Illapak. The PrimaPak package uses less verify weight and fi ll levels, and ensure from the product. The software has At Pack Expo, Clear Lam will be plastic than traditional rigid packag- seal integrity all within one machine,” an enhanced human machine inter- showcasing its PrimaPak technology ing. Each benefi t offers opportunities says Kyle Thomas, strategic business face, with intuitive pre-programed launched with the fi rst commercial for cost savings and sustainability unit manager, Eagle Product Inspection. operational interface that removes applications in North America last fall. improvements throughout the supply At Pack Expo, Eagle will showcase the need for third party set-up and Clear Lam will highlight new equip- chain. Applications include cheeses its Eagle Pack 430 with new Eagle Easy maintenance. ment, applications and features for the and other dairy products, along with MAT Material Discrimination X-ray For more information visit packaging. snack foods, fresh cut produce and (MDX) operating software. www.eaglepi.com. CMN Clear Lam says its PrimaPak Packag- more, Clear Lam says. Clear Lam also will unveil its new global licensing program for PrimaPak, which is expected to expand the global market for the technology and offer new business opportunities for converters Broader Capabilities and packagers, the company says. For more information visit From Concept to www.clearlam.com. CMN Start-Up . . . From Presto introduces Artisan to all Types and two new closure Sizes of Cheese Makers technologies APPLETON, Wis. — Presto Products • Complete Turn Key Capabilities Co. will introduce two closure technolo- • Engineering Feasibility Studies gies at Pack Expo International, taking place Nov. 2-5 in Chicago. • Project Management/Engineering Presto says its new sensory zipper • Installation of Cheese & Whey Plants is designed to deliver pronounced au- • Plant-wide Control & Integration dible and tactile cues when consumers • System Start-Up/Commissioning close packaging. The new technology is • Conceptual Process Design intended for use in the food industry, • Service & Support After the Sale among many others. “The development of our child- • Process Consultation Services resistant and sensory technologies was • Tank Fabrication & Electrical driven by two major consumer insights: Distribution Engineering improved safety for products that • NEWLY Expanded West Coast should not be consumed by children Coverage or taken without adult supervision and assurance in a secure seal to reduce MP&C is customer driven and provides exposure to oxygen, minimizing food service second to none at every level. waste,” says Brad Hansen, Fresh-Lock and Slide-Rite business unit director, We have a team of experienced, Presto Products Co. knowledgeable staff to find the best During each day of the show, Presto possible solution for your company's will feature live application demonstra- process and automation needs! tions at its booth. The company’s Slide- Rite sliders will be featured on Nov. 2 and Nov. 3, while its new sensory zipper technology will be run on the other two days of the show at speeds of 170 pouches per minute. Both technologies will be applied to pouches made from Sonoco fi lms using Totani’s CT-60 pouch- making machine. On-Call Technicians In addition to Presto’s new products, it also will highlight its Fresh-Lock Zip- per Spool Recycle and Reuse programs. Since 2009, Presto has supported the reuse of 3,000,000 pounds of High Im- 922 North 3rd Avenue • Edgar, WI 54426 pact Polystyrene, diverting this material 715.352.3206 • Fax 715.352.2194 from landfi lls and reusing the spools in [email protected] new shipments of Fresh-Lock Zippers. www.membranepc.com To learn more contact presto- [email protected] or For more information please visit www.membranepc.com visit www.prestoproducts.com. CMN © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 21 NEW PRODUCTS FOR DAIRY MANUFACTURERS Zip-Pak to showcase new PresSURE-Lok MANTENO, Ill. — Zip-Pak will intro- seal upon opening and closing the fl ex- duce a new product suited for milk and ible package, the company says. dairy beverages and also will feature its • Slider Select complete range of resealable solutions The ergonomically-designed Slider at Pack Expo, to be held in Chicago, Select is leak-resistant and delivers im- Nov. 2-5. proved processing and manufacturing Zip-Pak says consumer convenience effi ciencies over a wide range of product and sensory experience are the drivers applications, Zip-Pak says. Slider Select behind PresSURE-Lok, the new Zip-Pak has a high inside-burst strength; a slider innovation in development that will be that glides smoothly across the zipper on display this year. profi le; an ultra-compact slider system; PresSURE-Lok is an ideal solution and reduced mass of the zipper and for controlled dispensing of a variety the slider. of milk and dairy-based beverages, as • Sensus well as milk-based condiments, spreads Sensus is the fi rst in the Zip-Pak and toppings, Zip-Pak says. family of resealable closures called PresSURE-Lok combines a fl exible Sensory Feedback Fasteners. The prod- pouch with a fl exible and self-contained uct features a re-closure profi le that is fi tment, eliminating the need for a designed to create a tactile bumping separate dispensing component. The sensation and audible clicking noise user squeezes the fl exible pouch to when the zipper is opened or resealed. open the seal, allowing liquid product Zip-Pak also will be featuring reseal- to fl ow into the dispensing chamber. able packaging formats: The package then automatically reseals • Zip360 itself for future use. This proprietary The Zip360 resealable pouch creates sealing mechanism is designed to allow a wider opening and is designed to close the fl exible package to lie on its side, on itself with no end termination for or upside down, without unintentional full perimeter resealability. The Zip360 dispensing. fl exible pouch also accepts full-panel GEA Westfalia Separator Currently available for trial and test graphics. market production, PresSURE-Lok and • Pour & Lok the package is expected to serve as a vi- Pour & Lok is a resealable packaging able alternative to blow-molded bottles, solution that combines easy opening the company says. with pour spout functionality, Zip-Pak In addition to emerging technolo- says. A press-to-close, foldable zipper is gies, Zip-Pak will be showcasing its pre-applied to fi lm in the side gusset, latest selection of resealable solutions: creating a partial opening that forms Delivering More than • Vector the package’s resealable pour spout. A self-mating resealable closure, • Zipbox Just Our Parts Vector represents a distinct and easy- Zipbox is a hybrid packaging format to-use alternative to traditional zipper co-developed by Zip-Pak and T.H.E.M. It is profi les, Zip-Pak says. The closure has a resealing a carton that maintains prod- &GNKXGTKPIUCVKUHCEVKQPIWCTCPVGGF6JCVoUQWT a resealable matrix pattern, and Vec- uct freshness after opening, Zip-Pak says. RTQOKUGYJGP[QWQTFGTRCTVUHTQOWU1WT tor also delivers a more vivid tactile For more information visit IGPWKPGRCTVUCUUWTG[QWQHCRGTHGEVƂV#PFQWT response, assuring consumers of a tight www.zippak.com. CMN )NQDCN.QIKUVKEU0GVYQTMCPFGZVGPUKXG0QTVJ #OGTKECPKPXGPVQT[OGCPURCTVUCTGCXCKNCDNGHQT FGNKXGT[VQ[QWTHCEKNKV[QXGTPKIJVQTKPUQOGECUGU From the Brine or VJGXGT[UCOGFC[#UCPCFFGFXCNWGQWTUVCHHQH FGFKECVGFRCTVURTQHGUUKQPCNURTQXKFGUVGEJPKECN Tower to the Pallet UGTXKEGUWRRQTVHQTGXGT[RCTVYGUJKR Automation Solutions 6QNGCTPOQTGCDQWVQWTTGRNCEGOGPVRCTVU Robotic Cells TGRCKTQTUGTXKEGQHHGTKPIUCNNIWCTCPVGGF Vision Systems EQPVCEV-NCWU$TKPMTQFGCVQT Engineering & -NCWU$TKPMTQFG"IGCEQOQTXKUKVWUQPNKPG Design Services CVYYYYUWUEQO 40 lb. Block Cheese Palletizing ‡Proven Technology GEA Mechanical Equipment US, Inc. ‡Eliminates Safety/Ergonomic Issues GEA Westfalia Separator Division ‡Built to Last – Minimize Downtime Toll-Free: 800-722-6622 · 24-Hour Technical Help: 800-509-9299 ‡Increases Your Productivity – www.gea.com 20 Blocks Per Minute ‡Designed Within Your Budget

Contact Us!

engineering for a better world 1803H A great place to work with people committed to excellence, creating positive Phone: 920-662-1682 memorable experiences by providing Toll Free: 877-ZEPNICK “Personalized Automation Solutions.” [email protected]

For more information please visit www.zepnick.com For more information please visit www.gea.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 22 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

NMPF leaders to step up their efforts on immigration reform, trade, other issues

GRAPEVINE, Texas — With a major “Our industry and our members reform of the federal dairy safety net must continue to beat the drum in now complete, the leadership of the Washington, and — more importantly National Milk Producers Federation — in states and congressional districts (NMPF) pledged this week to step up across the nation, that immigration Service efforts on other key issues, including the reform must be dealt with, and fi nally fi ght for meaningful immigration reform resolved, in the coming year,” he says. Your One Stop and opening more foreign markets to Regardless of who controls Congress Equipment U.S. dairy products. after next week’s elections, the two Centrifuge Speaking at the organization’s an- leaders say NMPF will continue push- nual meeting here, Board Chairman ing for reform because it is crucial for Source Parts Randy Mooney and President and CEO dairy farmers. Jim Mulhern also stressed the need On exports, Mooney and Mulhern We specialize in the service, repair and to address environmental issues and say the U.S. dairy industry is intent on remanufacturing of Alfa Laval, Tetra Pak concerns over the treatment of animals being a major player in world markets on dairy farms. from here on out. and Westfalia centrifuges. Separators, Inc. The Mooney-Mulhern joint presenta- “World trade in dairy is today’s keeps your equipment in production and tion came less than two months after reality and tomorrow’s opportunity,” running efficiently. USDA formally launched the new dairy Mooney says. safety net, a margin insurance program Mulhern says dairy farmers have a 24/7 Parts & Service known as the Margin Protection Pro- lot riding on trade negotiations now un- Bowl Repair/Balancing gram (MPP). derway involving both Europe and Asia. Centrifuge Controls “The new Margin Protection Pro- “Japan is a huge potential oppor- gram is going to be more fl exible, more tunity,” he says. “We could export a Variable Frequency fair and more functional than the old lot more dairy products … if the U.S. Drives MILC program,” says Mooney, a dairy government can achieve a breakthrough farmer from Rogersville, Mo. in negotiations and bring back a trade “I want, most of all, to remind farm- agreement providing meaningful in- ers to take action and enroll their opera- creased market access there.” tion in the Margin Protection Program,” But both in Japan and Europe, Mul- says Mulhern, who took over as NMPF hern says, entrenched domestic dairy president and CEO 10 months ago. interests don’t want more competition “Even if you only want the bare bones from the United States. catastrophic coverage for next year, it “The European defense strategy in- will only cost you $100.” cludes an outrageous focus on bastard- Mooney and Mulhern say NMPF will izing the concept geographic indicators continue working with USDA to smooth in an attempt to claw back, for their own the implementation of MPP while also protectionist use, the names of many focusing on other key issues on its common foods,” he says. agenda in the months ahead. Both leaders also highlight the role (800) 233-9022 On immigration, Mulhern says con- of Cooperatives Working Together, an www.separatorsinc.com gressional inaction this year would not NMPF-managed program, in today’s keep NMPF from pressing the fi ght for favorable dairy export picture. reform in 2015. “The rise in exports in the past de- For more information please visit www.separatorsinc.com cade is due to a number of factors, but a big one is that we have, in our Coop- eratives Working Together program, a very effective tool to help seal the deal in markets where we are competing with products from other countries,” Mooney says. This year alone, CWT, which is funded by farmers, has helped assist exports of 86 million pounds of cheese, 51 million pounds of butter and 37 mil- lion pounds of whole milk powder in 43 countries on six continents. Turning to environmental issues, Mulhern says it is important for the dairy industry “to turn them from a liability to an opportunity.” As examples of this, Mulhern and Mooney cite NMPF’s work with the federal government to encourage methane gas generation from dairy farm waste and also efforts to recover and market valuable nutrients from livestock manure. Mulhern compares nutrient recovery to whey generation by cheese plants, which not long ago was considered an environmental problem. For more information please visit www.ivarsoninc.com Turn to LEADERS, page 23 D © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 23 NEWS/BUSINESS

LEADERS potential environmental problems evaluated under the program’s guide- IDFA wants Japan’s before they occur, and enhancing lines (see related article in this issue). Continued from page 22 import program to consumer and public attitudes toward “It means that all of our farms will our industry.” be held to the same high standards, be replaced in TPP “Today,” he says, “whey has been Finally, concerning animal care, with no exceptions,” Mooney says. transformed into something like white Mulhern notes that conscientious “And it helps us demonstrate that WASHINGTON — In a letter to U.S. gold, a nutritious high-protein source animal care is not just morally and farms, regardless of size, are run by Trade Representative Michael Froman of money to cheese plants, and a boost ethically right but also good business, families … who take pride in what and Secretary of Agriculture Tom Vilsack, for farmers’ Class III price. since healthy cows produce more milk. they do, and are committed to running the International Dairy Foods Association “We have a great deal more work “But it is also clear in this age of a successful business that centers (IDFA) this month called for the replace- ahead of us to turn this from a dream social media and the internet that on producing high-quality milk from ment of Japan’s current import admin- into a reality,” Mulhern says, “but we’re past the point where we can healthy cows.” istration program in the Trans-Pacifi c thanks to the vision, commitment ask people just to take our word” that Overall, while the dairy industry Partnership (TPP), calling it a potential and initial spadework of some of our we are providing proper care, he says. faces challenges, there are also tre- Achilles heel in the negotiations. co-ops, I firmly believe this will be a Both leaders praise the NMPF board mendous opportunities. Japan’s Agriculture and Livestock long-term boon to our farmers and for voting the previous day to require “We have a world of opportu- Industries Corporation (ALIC) is the cooperatives by creating new revenue dairy cooperatives participating in nities awaiting us that, working state-trading enterprise that administers sources, reducing regulatory pres- an industry animal care program to together, we can take advantage the country’s manufacturing milk quotas sures and legal challenges by solving require all their farmer members to be of,” Mooney says. CMN and imports of dairy products under tariff rate quotas. IDFA believes that ALIC oper- ates in a trade-distorting and inconsistent manner that makes it diffi cult for U.S. dairy exporters to access the market. “Suffi ce it to say that its administration Powder Processing Solutions of Japan’s import constraints on dairy products is the antithesis of free and open Tetra Pak’s proven technologies provide trade,” says Connie Tipton, president and optimized performance, uniform product CEO, IDFA. “The fi nancial benefi ts of the system fl ow entirely to the government, quality and gentle product treatment. after which those fi nancial ‘gains’ are shared with Japanese dairy producers.” IDFA sent the letter in advance of bilateral meetings and the TPP Ministe- rial held over the weekend in Sydney, Australia. IDFA urged the offi cials to seek to replace the current ALIC system with a tariff rate quota system as part of the bilateral negotiations with Japan. IDFA says it supports signifi cant and real market access into Japan for all dairy products that would reach across all tariff lines and ulti- mately bring tariffs to zero within a reasonable transition period. CMN Fire causes damage at Empire Specialty Cheese facility

FAIRFIELD, N.J. — Empire Specialty Cheese sustained smoke and water damage after a fi re in the early morning hours of Oct. 24. When offi cers and fi refi ghters ar- rived, they found water fl owing from the building and smoke. The Fairfi eld Fire Department, as- sisted by the Caldwell, North Caldwell, West Caldwell and Pine Brook Fire De- partments responded and extinguished the fi re in about 45 minutes. Preliminary investigation indicates the fi re was concentrated between a refrigeration unit and the ceiling, how- ever, the actual cause of the fi re is still under the investigation by the Fairfi eld Contact us: Fire Prevention Bureau. (320) 485-4401 Extensive water and smoke dam- [email protected] age occurred within Empire Specialty Tetrapak.com/cheese Cheese’s portion of the building. The building is also the home of Electronic Tetra Pak, , and PROTECTS WHAT’S GOOD are trademarks Business Solutions. The Fairfi eld Health belonging to the Tetra Pak Group. Department was contacted in regards to the damage sustained to the cheese product. No injuries were reported. CMN For more information please visit www.tetrapak.com/cheese © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 24 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

Americold opens new temperature-controlled facility in Magic Valley region of Idaho

ATLANTA — Americold announced Valley region is poised for exponential to the Union Pacifi c rail line and I-84 port full-truck load and less-than-truck last week that it has opened a facility growth potential in the dairy and agri- provides customers greater transporta- load consolidation. in Heyburn, Idaho. The 160,000-square- culture industries, and the demand for tion alternatives to suit their distribu- “Americold’s Nampa facility in Boise foot temperature-controlled building temperature-controlled, secure storage tion models.” is its primary dairy produce facility in has capacity for more than 17,000 pal- is rapidly increasing,” says Fred Boehler, Americold says it will condition the the region — it offers freezer, cooler lets — 10,000 steel-racked and 7,000 president and COO, Americold. “We’re facility to accommodate the local dairy and ambient dry conditions for prod- bulk-storage positions. very pleased to open this facility to ac- and agricultural market. The fully- ucts and is ideally suited to customers “Our customers have told us — and commodate current needs and future secured building, with 10 truck and with cheese goods,” says Daniel Cooke, research has shown — that the Magic demand. The facility’s close proximity seven rail dock doors, has the ability marketing director, Americold. “The to maintain temperatures ranging from Heyburn facility was opened as a freezer -5 F to 50 F. facility supporting local agriculture Possible Listeria contamination found in The company says it will employ as customers and to accommodate freezer raw milk from Sullivan County, N.Y., farm many as 35 people from the local area peak volume increases from our Nampa at the new facility, which will offer and Burley, Idaho, locations.” LIVINGSTON MANOR, N.Y. — On was subsequently tested by the depart- cross-docking, labeling and ticketing For more information visit Tuesday, New York State Agriculture ment’s food laboratory and discovered solutions, product tempering, and ex- www.americold.com. CMN Commissioner Richard A. Ball warned to be contaminated with Listeria consumers in Sullivan County, N.Y., and monocytogenes. the surrounding area not to consume The producer was notified of a Nestlé Mexico announces plans to invest unpasteurized raw farm milk from preliminary positive test result Oct. over next 6 years to increase milk output the Richard Dirie Farm in Livingston 23, and he volunteered to suspend raw Manor, N.Y., due to a possible Listeria milk sales until the sample results were MEXICO CITY — Nestlé Mexico has Another 300 million pesos (approxi- monocytogenes contamination. confi rmed. Further laboratory testing, announced plans to invest 700 million mately $22 million) will be invested in According to the New York State completed Oct. 28, confi rmed the pres- pesos (approximately $52 million) over providing technical assistance in the Department of Agriculture & Markets ence of Listeria monocytogenes in the the next six years to increase milk pro- milk and whey supply chains in Mexico. there are no illnesses known to be as- raw milk sample. duction in the country. Nestlé buys milk directly from produc- sociated with this product to date. The producer is now prohibited Under the commitments announced, ers in Mexico. Nestlé Mexico is the coun- A sample of the milk, collected by from selling raw milk until subsequent Nestlé Mexico will invest 400 million try’s third biggest milk buyer. The com- an inspector from the Division of Milk sampling indicates that the product pesos (approximately $30 million) to pany has been buying milk directly from Control and Dairy Services Oct. 21, is free of harmful bacteria. CMN fi nance production and infrastructure. dairy farmers in Mexico since 1935. CMN

New Innovation In Cheese Cutting Technology Automatic Exact Weight Cheese Cutter 3001 AEW Tu-Way

Featuring: „ Patented Cutting Head „ Fully Automated Cut Adjustment „ Continuous Feed System „ Minimal Floor Space Needed

PUTTING YOU FIRST SINCE 1949 Phone: 1-888-243-6622 or 1-920-458-2189 E-mail: [email protected] Web: www.genmac.com

SPRAY DRIERS HEAT RECOVERY POWDER COOLING EVAPORATORS

925 EAST MAPLE ROAD BIRMINGHAM, MICHIGAN 48009 P: (248) 644-6868 F: (248) 642-1213 [email protected] www.marriottwalker.com IMPROVE YOURR PRODUCTION PRODUCTIO WITH GMC CUTTERS

For more information please visit www.marriottwalker.com For more information please visit www.genmac.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 25 CLASSIFIED ADVERTISING

• HELP WANTED 7 • HELP WANTED 7

CHEESE MARKET NEWS helps keep a spotlight on your Sales Manager company’s momentum and reinforces your visibility in Growing organization in Southern Wisconsin is looking for a direct sales manager to sell the marketplace every week. We share the same level of multiple products. This position will be responsible for maintaining and growing existing passion and commitment as all of you manufacturers business as well as generating new accounts. and suppliers do to support and grow this business. 4XDOL¿FDWLRQV My goal is to help you increase your success rate no ‡6DOHVH[SHULHQFHUHTXLUHG'HOL'DLU\SUHIHUUHG matter what your needs are. Email or call me today ‡3URYHQWUDFNUHFRUGLQJURZLQJDQHVWDEOLVKHGEXVLQHVV to find out how we can set up an ad program or ‡+LJKFUHDWLYLW\DQGVWURQJJURZWKRULHQWDWLRQ classified placement to help you succeed. ‡3URYHQDELOLW\WREXLOGDQGPDLQWDLQVWURQJHIIHFWLYHUHODWLRQVKLSVZLWKFXVWRPHUV ‡6WURQJSUHVHQWDWLRQFRPPXQLFDWLRQRUJDQL]DWLRQDQGQHJRWLDWLRQVNLOOV MORE NEWS, MORE SOLUTIONS, MORE CHOICES! ‡%DFKHORU¶VGHJUHHIURPDUHJLRQDOO\DFFUHGLWHGFROOHJHRUXQLYHUVLW\ ‡0XVWEHZLOOLQJWRWUDYHOXSWRRIWKHWLPH 6HQGUHVXPHDQGFRYHUOHWWHUZLWKVDODU\UHTXLUHPHQWVLQFRQ¿GHQFHWR The Weekly Newspaper Of The Nation’s Cheese And Dairy/Deli Business [email protected] Susan Quarne [email protected] • (608) 831-6002 Publisher For more information please e-mail [email protected]

• EQUIPMENT 1 • EQUIPMENT 1

• MARKETING 10 • MISCELLANEOUS 11

• CHEESE/DAIRY 12 • CHEESE/DAIRY 12

WANTED GOT CHEESE? TO BUY We purchase scrap cheese • Under Grade Dairy Powders or (fish(fish bait,bait, floorfloor sweeps, etc.)etc.) Blends for Feed forfor feed.feed. WeWe cancan pickpick upup onon aa For more information please visit www.ullmers-dairyequipment.com • Will Purchase Retained spot, weekly or monthly basis. Sample Bags spot, weekly or monthly basis. • Will Purchase Whirl-Pak Bags • EQUIPMENT WANTED 2 • No Quantity Too Large or Too Small Please contact: Proudly Supplying the John Davis [email protected] [email protected] (866) 547-6510 Food and Dairy Industry (920) 878-0688 for Over 70 Years! BUSINESS SERVICES 3 Codie Wegener • [email protected] (920) 422-4767

Call today; FLOORING 4 we build lasting • partnerships! www.whalenfoodsinc.com For more information please • PLANTS: SALE/LEASE 5 visit www.mandjsalesllc.com For more information please visit www.whalenfoodsinc.com

FOR MORE INFORMATION, PLEASE CONTACT: NATIONAL SALES MANAGER – WEST More News, More Solutions, Yes, Mike Veatch • 417-575-9257 please send me [email protected] More Choices! the Exclusive NATIONAL SALES MANAGER – EAST 2014 Key Players Jim Hall • 417-575-9214 [email protected] Reprint for ©2013 Paul Mueller Company 429-1 only $30! 1-800-MUELLER • www.paulmueller.com (Credit Card or Prepayment Only) For more information please visit www.paulmueller.com CHEESE MARKET NEWS® SUBSCRIPTION FORM: 1 Year Rates (52 issues) 2 Year Rates (104 issues) ELECTRONIC 1 Year Rates (52 issues) F $135 (2nd Class) F $190 (1st Class/Canada) F $195 (2nd Class) F $315 (1st Class/Canada) F $135 (Email Only. Without Mail Service) F $330 (International) F $525 (International) F $210 (Email With 2nd Class Mail Service Only)

Let Cherney’s team of technical experts at both locations ensure the safety of your products and the protection of your brand and reputation.

Photo courtesy of James Bowie Elementary School Why should I ■ Providing a High Level of participate in a Customer Service (all incoming FUELED UP — Students at James Bowie Elementary School, Dallas, participate in the Fuel Up SURÀFLHQF\ inquiries answered either same To Play 60 Super Bowl Breakfast Challenge. The challenge requires students to create an oatmeal testing program? or next business day) breakfast, and James Bowie students created a Strawberry Oatmeal Smoothie and hosted a taste test ■ Customer Specialized Data Trending and Reporting of oatmeal for other students. ■ Personalized Approach and Support in all Areas eat sometimes and which to eat only ■ ISO 17025 and ISO 17043 FUTP60 occasionally. Accredited Food Laboratory and microbiological Continued from page 17 The posters also encourage stu- Offering extensive , nutritional Proficiency Program Provider chemical testing , ■ dents to “color your plate with fruits and labeling, consultation Mitigating Risk Through testing and and Proactive Testing foods in age-appropriate portion sizes, and veggies galore.” Daily offerings projects and studies ■ Extensive Microbiological including vegetables, fruits, whole of lowfat or nonfat milk and 100 per- basic technical training and Analytical Testing ■ Offering Hands-on grain-rich items, protein-rich entrees cent fruit or fruit/vegetable juice are Microbiology “Basics” through and lowfat and nonfat milk. included at meals. Quarterly Training Courses In addition to milk, dairy products “The healthy eating plays assist in KNOWLEDGE • PRECISION used in meals include various cheeses giving our students a greater under- NEW LOCATION! SUPERIOR CUSTOMER SERVICE Cherney announces the as well as yogurt. standing of how to prepare healthy Cherney delivers solutions, opening of a new facility in not just results! One of the “healthy eating plays” snacks, how to read food labels and Clovis, New Mexico. used at the school is Cafeteria Culture, their importance,” Foster says. Cherney – Clovis! which includes making the cafeteria Milk also is an integral part of the brighter and providing nutritional info nutrition halo, particularly in the for students. Breakfast in the Classroom program, which Foster notes also has been suc- CHERNEY MICROBIOLOGICAL SERVICES, LTD. One of the Cafeteria Culture 1110 S. Huron Rd. • Green Bay, WI 54311 posters promotes Go, Slow, Whoa, cessful, with students drinking more Green Bay Facility Only P: 920.406.8300 • F: 920.406.0070 Testing Cert. #2986.01 412 Mitchell Street • Clovis, NM 88101 • P: 575.219.3318 with coordinating green (go), yellow milk in the morning. Proficiency Testing Provider Cert. #2986.02 [email protected] • www.cherneymicro.com (slow) and red (whoa) dots to show “Milk consumption here has defi - nitely increased since Fuel Up To Play For more information please visit www.cherneymicro.com which foods to eat always, which to 60 was implemented,” she says. “Our students at James Bowie understand that breakfast jump starts their day and provides nourishment that they need to focus and be atten- tive in class,” she adds. “The staff at Bowie has commented on the notice- able difference in students’ improved ability in class.” James Bowie has been a FUTP60 “Touchdown School” for the past three years, and one of its students was se- lected as a 2011-2012 Texas National Student Ambassador, as well as one in 2013-2014 who was selected as Texas State Ambassador. “To achieve the goal of our school being a healthier place, our student leaders are very involved and take charge in each event that is promoted at our school,” Foster says. She notes one example is each year’s kickoff event, which is the fi rst event held to provide information about the program and motivate stu- dents to participate. This year’s kickoff event was a healthy eating tailgate assembly,

For more information please visit www.foodtools.com Turn to STUDENTS, page 27 D © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) October 31, 2014 — CHEESE MARKET NEWS® 27 NEWS/BUSINESS

STUDENTS relationship with the students, it helps the physical fi tness program become Continued from page 26 easier to achieve,” she says. Healthy incentives also aid in par- Foster says. Prior to the event, stu- ticipation, she says. dent leaders —which included six “I started a breakfast incentive to 4th-grade students and six 5th-grade increase the consumption of break- students — made posters and hung fast at our school, and to inform our them in visible areas of the school students of the importance of eating and encouraged students and staff breakfast every morning. I created to attend the kickoff assembly in the a breakfast log. Each morning as morning announcements. students went through the breakfast Celebrating Over 80 Years The students also wore Dallas Cow- line, the cafeteria staff stamped their of Service to the Industry... boys attire and hung Cowboys posters breakfast log,” Foster says. “At the in the gym and decorated tables with end of four weeks, all students who Cowboys tablecloths and banners. received a stamp, which indicated At the assembly, students discussed they went to breakfast, received a the objective of the program, the smoothie celebration. This has been healthy eating and activity plays that a great incentive for our students.” were planned, and held a question and Foster adds that being a role model answer session. and following healthy guidelines is “At the conclusion, we gave essential to students understanding students healthy snacks along with their importance. FUTP60 key rings and pencils,” Foster “My students understand that OFFERING INCLUDING A COMPLETE says. health, wellness and physical activity • Pumps & Circulation LINE OF SUPPLIES & PARTS: Parents also are informed of the promotes academic learning and is a Systems • Chemicals program at parent conferences and preventive measure against disease,” • CIP & Cleaning Systems • Clothing & Safety Items • Metering, Batching & • Testware & Scientific Items PTA nights, where FUTP60 partici- she says. “Following health, wellness and physical activity guidelines also in- Blending Systems • Paper Goods pants provide fl yers of healthy meal • Instrumentation • Filtering Medium and snack options, coordinated by creases longevity of life and promotes • Chemical Tanks & Materials student leaders. a healthy lifestyle for years to come.” • Production Systems • Brushes & Brooms & Equipment “Our student leaders also meet Margaret Lopez, director of nutri- • Sanitary Fittings, Valves, tion, training and quality assurance • Valves, Fittings, Tubing, Etc. weekly to plan monthly events at our Air Actuated Controls, Etc. programs for ISD Food and Child • Processing Plant Supplies school, which range from taste tests • Pumps, Pumping to Play 60 challenges,” Foster says. Nutrition Services, notes James Bowie The Name You Can Trust Equipment, Parts, In addition to program excitement Elementary has been a stand-out And Rely On For Your Supplies/Service school in the district for health and Capital Equipment And • Repair/Parts for within the school environment, James Systems Investments Gauges, Instrumentation, Bowie Elementary has been nationally wellness. Gaskets, Valves recognized. “They’ve really set an example in Last month, the Alliance for a our district and community and have Healthier Generation 2014 Leaders been willing to step up and do extra Summit honored 250 award-winning things,” she says. “It’s wonderful to see schools from across the country for in a community setting what you can exceeding federal nutrition standards do to bring about change.” For more information on the R. D. SMITH CO., INC. and becoming a healthier place. Foster 2703 Bauer Street | Eau Claire, WI 54701 | (715) 832-3479 attended on behalf of James Bowie program, visit www.fuelupto (800) 826-7335 | Fax: (715) 832-7456 | Website: www.rdsmithco.com play60.com. CMN Elementary and met former President For more information please visit www.rdsmithco.com Bill Clinton, who presented the award. James Bowie Elementary is the fi rst school in Texas to achieve the Gold National Healthy Schools Award. “We are so excited to receive the National Healthy Schools Award,” Foster says. “The Alliance’s Healthy Schools program has helped us create a healthier and happier environment for our students, staff and our school community. We are proud of our great results.” Foster also was selected as the 2013-2015 Texas Ambassador for the Alliance for a Healthier Generation. She also achieved National Silver Recognition in 2013-2014 and National Bronze Recognition in 2012-2013. James Bowie Elementary also has achieved 2014 Let’s Move Active School Recognition, and was the winner of the 2013-2014 NFL Dallas Cowboys Play 60 Challenge six-week fi tness/health program. When asked what has made the program so successful at James Bowie, Foster says it’s important to develop a good rapport with students, admin- istration and school staff. “When a teacher develops a positive For more information please visit www.powder-solutions.com © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected]) 28 CHEESE MARKET NEWS® — October 31, 2014 NEWS/BUSINESS

Winona Foods announces facility expansion in Kaukauna, Wis. NMPF to require

KAUKAUNA, Wis. — Winona Foods, a “To gain value to our customers, we focus to expand and grow to meet its FARM participants national supplier of cheese, sauces and need to increase our internal product customers’ needs, the company says, to enroll all dairies salsas based in Green Bay, Wis., this offerings, increase our distribution noting Winona Foods understands its week announced the expansion of its systems and lower our costs of opera- need to increase customer awareness in supply chain new facility in Kaukauna, Wis. tions,” adds Terry Steinmann, president, of the value the company brings to its The new facility began full op- Winona Foods. customers. GRAPEVINE, Texas — The board of eration in May 2014 and features a The commercial kitchen, which The Kaukauna facility will offer directors of the National Milk Produc- fully-functioning commercial kitchen, will be expanded as part of the project, customers a better understanding of ers Federation (NMPF) voted Monday technology and equipment to offer gives Winona Foods the opportunity Winona Foods and its ability to service to require that each dairy marketing customers performance-orientated to test its performance-orientated customers and work with them to in- organization participating in the organi- products and support Winona Foods’ products for the end user, company crease the market segments they are zation’s National Dairy FARM (Farmers current manufacturing facilities, com- officials note. Winona Foods will have targeting together, company offi cials Assuring Responsible Management) pany offi cials say. the capability of bringing executive add. program must enroll all its farmer- “Our vision is to further the depth of chefs in to work with Winona Foods’ “We plan to continue to expand suppliers to ensure full participation products we offer customers and provide sales team, R&D and owners to test and offer our customers the qual- in the program. additional value to the customer,” says its products. ity performance products items The unanimous vote came as the Dave Meyer, vice president, Winona Foods. It has always been Winona Foods’ they desire,” Meyer says. CMN board, meeting here during NMPF’s annual meeting, reviewed the struc- ture and participation levels of the FARM program. Now in its fi fth year, the FARM program features a set of on-farm practices demonstrating farm- ers’ commitment to responsible animal care. In addition to dairy cooperatives, the program is open to milk processors and individual farmers. Cooperatives and processors han- dling 75 percent of the nation’s milk supply are implementing the FARM Are You Really Cutting It? program, although not all farms involved in those organizations have reviewed and adopted the program’s practices. Under the new policy, cooperatives and processors must require that every farmer supplying them must enroll in the program. “The FARM program has become the dairy industry animal care stan- dard because of its integrity, rigor and authenticity,” says Randy Mooney, board chairman, NMPF. “This decision means each farm in a participating cooperative will be held to the same high standards, with no exceptions. It demonstrates that the nation’s dairy farms, regardless of size, are commit- ted to high-quality animal care across the supply chain.” This week, the NMPF board also reviewed new provisions in the FARM to increased capacity, you get better cut quality, FAM DEVILLE Shredders and Dicers program that establish a clear process produce a perfect cut quality; are cleaner, less waste, impeccable hygiene and assured to investigate allegations of animal smarter and more efficient. employee safety, all while reducing your labor and mistreatment on farms enrolled in maintenance costs. the program. Any such farm will be We cater to cheese processing companies that Contact us for a consultation or demonstration subject to an independent review and demand sanitary, durable, practical and efficient food with one of our product specialists to discuss how may be temporarily suspended from the cutting equipment. we can help you achieve your goal. program if the allegations are substan- Our advanced technology is designed to improve tiated. A corrective action plan will be your processing and your bottom line. In addition developed to address any issues. Once any needed remedial actions are taken, the dairy operation can be reinstated in the FARM program. Please Visit Us In Booth #7147 1.866.404.4545 www.devilletechnologies.com Jim Mulhern, president and CEO of NMPF, says this new policy will fur- ther strengthen the consistency of the program, and help such farms improve their animal care practices. “The goal of the FARM program is to assure a high level of quality animal care on our farms,” Mulhern adds. “We want the program to be inclusive and

FS40 Hymaks CMD-3D Flexifam CHS-2D adaptive. And where we fi nd problems, we want to address and improve the situ- ation rather than fi nd ways to exclude in- For more information please visit www.devilletechnologies.com dividual farms from the program.” CMN © 2014 CHEESE MARKET NEWS® — This is Cheese Market News’ E-subscription and may not be forwarded to anyone other than the intended paid subscriber without the express permission of Cheese Market News (For more information, contact [email protected])