DOCSLIB.ORG

The Diversity of Culturable Yeasts in the Phylloplane of Rice in Thailand

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Diversity of Culturable Yeasts in the Phylloplane of Rice in Thailand Ann Microbiol (2015) 65:667–675 DOI 10.1007/s13213-014-0905-0 ORIGINAL ARTICLE The diversity of culturable yeasts in the phylloplane of rice in Thailand Savitree Limtong & Rungluk Kaewwichian Received: 2 January 2014 /Accepted: 21 April 2014 /Published online: 10 May 2014 # Springer-Verlag Berlin Heidelberg and the University of Milan 2014 Abstract One hundred and fifty-six yeast strains were obtained Cyberlindnera fabianii, Cyberlindnera rhodanensis and by the enrichment technique from the phylloplanes of 85 rice leaf Wickerhamomyces ciferrii in Wickerhamomycetaceae; samples collected from seven provinces in Thailand. On the basis Debaryomyces nepalensis, Meyerozyma caribbica, of the D1/D2 domain of the large subunit rRNA gene sequence Meyerozyma guilliermondii, Millerozyma koratensis,and analysis, 156 strains were identified as 34 known species in 18 Yamadazyma mexicanum in Debaryomycetaceae; Pichia genera consisting of 25 species in 13 genera of the phylum kudriavzevii in Pichiaceae; and Lachancea thermotolerans in Ascomycota and nine species in five genera of the phylum Saccharomycetaceae. The species in Basidiomycota viz. Basidiomycota. The species in the phylum Ascomycota com- Cryptococcus flavescens, Cryptococcus laurentii, Cryptococcus prised 24 species in 12 genera of the order Saccharomycetales aff. laurentii and Cryptococcus rajasthanensis in the Tremellales and one species viz. Yarrowia lipolytica in Saccharomycetales lineage, Bulleromyces clade, Tremellales, Tremellomycetes, incertae sedis. The 24 species viz. Candida glabrata in the Agaricomycotina; Pseudozyma antarctica and Pseudozyma Nakaseomyces clade of Saccharomycetaceae, Candida jaroonii, aphidis in Ustilaginales, Ustilaginomycetes, Candida membranifaciens and Candida terebra in the Ustilaginomycotina; Rhodotorula taiwanensis and Yamadazyma clade of Debaryomycetaceae, Candida Sporobolomyces blumeae in Sporidiobolales, pseudolambica in the Pichia clade of Pichiaceae, Candida Microbotryomycetes, Pucciniomycotina; and Trichosporon ruelliae in the Metschnikowia clade of Metschnikowiaceae, and asahii in Trichosporonales, Tremellomycetes, three unaffiliated clade Candida species (Candida catenulata, Agaricomycotina. The most prevalent species was Candida rugosa and Candida tropicalis); Clavispora lusitaniae, R. taiwanensis with a 23 % frequency of occurrence followed Kodamaea ohmeri, Metschnikowia koreensis and by Candida tropicalis (16 %) and Cryptococcus fabianii (12 %). Metschnikowia lopburiensis in Metschnikowiaceae; Keywords Phylloplane . Rice . Yeast . Thailand . D1/D2 Electronic supplementary material The online version of this article domain (doi:10.1007/s13213-014-0905-0) contains supplementary material, which is available to authorized users. * : S. Limtong ( ) R. Kaewwichian Introduction Department of Microbiology, Faculty of Science, Kasetsart University, Bangkok 10900, Thailand e-mail: [email protected] Rice is one of the world’s most important food crops. About 90 % of the world’s rice is cultivated in Asia. In Thailand, a S. Limtong tropical Asian country, the Office of Agricultural Economics, Center for Advanced Studies in Tropical Natural Resources, National Research University- Kasetsart University, Kasetsart University, Ministry of Agriculture and Cooperatives reported the rice Bangkok 10900, Thailand cultivation area to be approximately 13,192,400 hectares and the production of rice for the year 2012 to be 38,830,600 tons. Present Address: Rice is a type of grass belong to the family Poaceae, a group of R. Kaewwichian Bioresources Technology Unit, National Center for Genetic monocotyledonous plants. The rice species that is cultivated in Engineering and Biotechnology (BIOTEC), Pathumthani, Thailand Thailand is Asian rice, Oryza sativa. 668 Ann Microbiol (2015) 65:667–675 The phylloplane, or phyllosphere, is a term for the above strains isolated from the phylloplane of sugarcane in Thailand ground surface of plants and usually refers to the external surface (Kaewwichian et al. 2012, 2013a, 2013b; Kaewwichian and of plant leaves, a dominant aerial part of plant (Phaff and Starmer Limtong 2014). 1987; Fonseca and Inacio 2006). The phylloplane is known to be Although yeasts inhabiting the phylloplane have been stud- colonized by a large number of microorganisms including bac- ied intensively, the diversity of yeasts in the phylloplane of teria, yeasts and fungi (Andrews and Harris 2000;Lindowand rice has received little attention, and only a few articles have Brandl 2003). The growth of microorganisms in the phylloplane been published so far. Among them, one article reported the is dependent on nutrients from plant metabolites that are secreted use of the ballistoconidium-fall isolation method to study to the phylloplane or materials from external sources that drop on yeasts in rice phylloplane in Thailand (Nakase et al. 2001). the plant surface. The plant metabolites are organic substances, Therefore, this study aimed to investigate the diversity of mostly simple sugars, e.g., glucose, fructose and sucrose, while yeasts in the phylloplane of rice in Thailand by using the amino acids, organic acids and sugar alcohols are also present enrichment isolation technique. (Fiala et al. 1990;Xinetal.2009). On the other hand, nutrients in the materials from external sources are inorganic nutrients (Xin et al. 2009). In addition to having relatively limited nitrogen Materials and methods sources, the microbial inhabitants of the phylloplane encounter strong ultraviolet radiation, low or fluctuating water activity, Sample collection fluctuating temperature, and antimicrobial compounds that are produced by plants or other microorganisms; as a consequence, Green and healthy leaves of rice (Oryza sativa)wererandom the microorganisms on the phylloplane are often irregularly collected from rice fields. Leaf samples were put in plastic distributed (Inácio et al. 2005; Fonseca and Inacio 2006; bags, sealed and brought in an ice-box to the laboratory. The Remus-Emsermann et al. 2012; Vorholt 2012). samples were kept at 8 °C until subjected to yeast isolation. Bacteria are the most abundant phylloplane microorganisms; however, yeasts and yeast-like fungi are also active phylloplane Yeast isolation colonizers (Andrews and Harris 2000; Lindow and Brandl 2003). The phylloplanes of both dicotyledonous and monocoty- Yeasts were isolated by an enrichment technique using yeast ledonous plants are colonized by both basidiomycete and asco- extract malt extract (YM) broth (3 g/L yeast extract, 3 g/L malt mycete yeasts (Nakase and Suzuki 1985; de Azeredo et al. 1998; extract, 5 g/L peptone and 10 g/L glucose) supplemented with Nakase et al. 2001;Inácioetal.2005; Fonseca and Inacio 2006; 250 mg/L sodium propionate and 200 mg/L chloramphenicol Glushakova et al. 2007; Slavikova et al. 2007, 2009; Glushakova (Limtong et al. 2007). Three grams of cut leaves, derived from and Chernov 2010; Landell et al. 2010). Fewer studies on yeasts cutting a few leaves to the size that could be put into a 250 ml that colonize the phylloplanes of monocotyledonous plants have Erlenmeyer, were inoculated into 50 ml enrichment broth in been reported. The ballistoconidium-fall method was used to the flask and incubated on a rotary shaker at room temperature isolate ballistoconidium-forming yeasts from dead leaves and (30±2 °C) for 2 days. A loopful of the enriched culture was stems of rice in Japan and from rice and various plants in directly streaked on YM agar supplemented with 250 mg/L Thailand (Nakase and Suzuki 1985;Nakaseetal.2001). The sodium propionate and 200 mg/L chloramphenicol and incu- prevalent yeast species associated with leaves, stems and rhizo- bated at room temperature (30±2 °C) for 2–7daysoruntil spheres of sugarcane in Brazil were found to be Cryptococcus yeast colonies appeared. Yeast colonies of different morphol- laurentii, Cryptococcus albidus, Rhodotorula mucilaginosa and ogies were picked and purified by cross streaking on YM agar. Debaryomyces hansenii (de Azeredo et al. 1998). In a recent Purified yeast strains were suspended in YM broth supple- investigation, Pseudozyma graminicola was proposed from two mented with 10 % v/v glycerol and maintained at −80 °C. strains isolated from the leaves of pasture plants in Russia (Golubev et al. 2007). Candida aechemae and Candida vrieseae Yeasts identification were proposed as two novel yeast species isolated from phyllophanes of bromolids in southernBrazil(Landelletal. Yeasts were identified by analysis of the D1/D2 domain of the 2010). Bensingtonia rectispora, a ballistoconidium-forming large subunit (LSU rRNA) gene sequence similarities (Kurtzman yeast, was a new species proposed from strains isolated from and Robnett 1998). The sequence of the D1/D2 region of the bamboo (Wang et al. 2012). Metschnikowia lopburiensis,was LSU rRNA gene was determined from PCR products amplified proposed as a new species from one strain isolated from the from genomic DNA. The D1/D2 region of the LSU rRNA gene surface of green rice leaves in Thailand (Kaewwichian et al. was amplified and sequenced with primers, NL1 and NL4 2012). Four novel yeast species viz. Metschnikowia (Kurtzman and Robnett 1998). Methods for DNA extraction saccharicola, Yamadazyma siamensis, Wickerhamomyces and amplification of the D1/D2 region of the LSU rRNA gene siamensis and Nakazawaea siamensis were proposed from and ITS region were as described previously (Limtong et al. Ann Microbiol (2015) 65:667–675 669 2007). The PCR products were checked by agarose gel electro-
Load more

Recommended publications
  • Expanding the Knowledge on the Skillful Yeast Cyberlindnera Jadinii
    Journal of Fungi Review Expanding the Knowledge on the Skillful Yeast Cyberlindnera jadinii Maria Sousa-Silva 1,2 , Daniel Vieira 1,2, Pedro Soares 1,2, Margarida Casal 1,2 and Isabel Soares-Silva 1,2,* 1 Centre of Molecular and Environmental Biology (CBMA), Department of Biology, University of Minho, Campus de Gualtar, 4710-057 Braga, Portugal; [email protected] (M.S.-S.); [email protected] (D.V.); [email protected] (P.S.); [email protected] (M.C.) 2 Institute of Science and Innovation for Bio-Sustainability (IB-S), University of Minho, 4710-057 Braga, Portugal * Correspondence: [email protected]; Tel.: +351-253601519 Abstract: Cyberlindnera jadinii is widely used as a source of single-cell protein and is known for its ability to synthesize a great variety of valuable compounds for the food and pharmaceutical industries. Its capacity to produce compounds such as food additives, supplements, and organic acids, among other fine chemicals, has turned it into an attractive microorganism in the biotechnology field. In this review, we performed a robust phylogenetic analysis using the core proteome of C. jadinii and other fungal species, from Asco- to Basidiomycota, to elucidate the evolutionary roots of this species. In addition, we report the evolution of this species nomenclature over-time and the existence of a teleomorph (C. jadinii) and anamorph state (Candida utilis) and summarize the current nomenclature of most common strains. Finally, we highlight relevant traits of its physiology, the solute membrane transporters so far characterized, as well as the molecular tools currently available for its genomic manipulation.
    [Show full text]
  • Discordant Evolution of Mitochondrial and Nuclear Yeast Genomes at Population Level
    bioRxiv preprint doi: https://doi.org/10.1101/855858; this version posted November 27, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. ARTICLE Discordant evolution of mitochondrial and nuclear yeast genomes at population level Matteo De Chiara1, Anne Friedrich2, Benjamin Barré1, Michael Breitenbach3, Joseph Schacherer2,* and Gianni Liti1,* 1Université Côte d'Azur, CNRS, INSERM, IRCAN, Nice, France 2Université de Strasbourg, CNRS, GMGM UMR 7156, F-67000 Strasbourg, France 3Universität Salzburg, Fachbereich Biowissenschaften, Salzburg, Austria *Correspondence should be addressed to GL ([email protected]) or JS ([email protected]) Abstract Mitochondria are essential organelles partially regulated by their own genomes. The mitochondrial genome maintenance and inheritance differ from nuclear genome, potentially uncoupling their evolutionary trajectories. Here, we analysed mitochondrial sequences obtained from the 1,011 Saccharomyces cerevisiae strain collection and identified pronounced differences with their nuclear genome counterparts. In contrast with most fungal species, S. cerevisiae mitochondrial genomes show higher genetic diversity compared to the nuclear genomes. Strikingly, mitochondrial genomes appear to be highly admixed, resulting in a complex interconnected phylogeny with weak grouping of isolates, whereas interspecies introgressions are very rare. Complete genome assemblies revealed that structural rearrangements are nearly absent with rare inversions detected. We tracked introns variation in COX1 and COB to infer gain and loss events throughout the species evolutionary history. Mitochondrial genome copy number is connected with the nuclear genome and linearly scale up with ploidy. We observed rare cases of naturally occurring mitochondrial DNA loss, petite, with a subset of them that do not suffer fitness growth defects.
    [Show full text]
  • Supplementary Materials
    Supplementary Materials C4Y5P9|C4Y5P9_CLAL4 ------------------MS-EDLTKKTE------ELSLDSEKTVLSSKEEFTAKHPLNS 35 Q9P975|IF4E_CANAL ------------------MS-EELAQKTE------ELSLDS-KTVFDSKEEFNAKHPLNS 34 Q6BXX3|Q6BXX3_DEBHA --MKVF------TNKIAKMS-EELSKQTE------ELSLENKDTVLSNKEEFTAKHPLNN 45 C5DJV3|C5DJV3_LACTC ------------------MSVEEVTQKTG-D-----LNIDEKSTVLSSEKEFQLKHPLNT 36 P07260|IF4E_YEAST ------------------MSVEEVSKKFE-ENVSVDDTTATPKTVLSDSAHFDVKHPLNT 41 I2JS39|I2JS39_DEKBR MQMNLVGRTFPASERTRQSREEKPVE----AEVAKPEEEKKDVTVLENKEEFTVKHPLNS 56 A0A099P1Q5|A0A099P1Q5_PICKU ------------------MSTEELNN----ATKDLSLDEKKDVTALENPAEFNVKHPLNS 38 P78954|IF4E1_SCHPO ------------------MQTEQPPKESQTENTVSEPQEKALRTVFDDKINFNLKHPLAR 42 *. : *.:.. .* **** C4Y5P9|C4Y5P9_CLAL4 KWTLWYTKPQTNKSETWSDLLKPVITFSSVEEFWGIYNSIPVANQLPMKSDYHLFKEGIK 95 Q9P975|IF4E_CANAL RWTLWYTKPQTNKSENWHDLLKPVITFSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIR 94 Q6BXX3|Q6BXX3_DEBHA KWTLWYTKPQVNKSENWHDLLKPVITFSSVEEFWGIYNSIPQANQLPMKSDYHLFKEGIK 105 C5DJV3|C5DJV3_LACTC KWTLWYTKPPVDKSESWSDLLRPVTSFETVEEFWAIHNAIPKPRYLPLKSDYHLFRNDIR 96 P07260|IF4E_YEAST KWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVR 101 I2JS39|I2JS39_DEKBR KWTLWYTKPAVDKNESWADLLKPIVSFDTVEEFWGIYHAVPKAVDLPLKSDYHLFRNDIK 116 A0A099P1Q5|A0A099P1Q5_PICKU TWTLWYTKPAVDNTESWADLLKPVVTFNTVEEFWGIFHAIPKVNELPLKSDYHLFRGDIK 98 P78954|IF4E1_SCHPO PWTLWFLMPPTPG-LEWNELQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVR 101 ****: * . * :* : : :*.:*****.* : : **:**** .*: .:: C4Y5P9|C4Y5P9_CLAL4 PEWEDEQNAKGGRWQYSFNNKRDVAQVINDLWLRGLLAVIGETIEDD---ENEVNGIVLN 152 Q9P975|IF4E_CANAL PEWEDEANSKGGKWQFSFNKKSEVNPIINDLWLRGLLAVIGETIEDE---ENEVNGIVLN
    [Show full text]
  • University of California Santa Cruz Responding to An
    UNIVERSITY OF CALIFORNIA SANTA CRUZ RESPONDING TO AN EMERGENT PLANT PEST-PATHOGEN COMPLEX ACROSS SOCIAL-ECOLOGICAL SCALES A dissertation submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in ENVIRONMENTAL STUDIES with an emphasis in ECOLOGY AND EVOLUTIONARY BIOLOGY by Shannon Colleen Lynch December 2020 The Dissertation of Shannon Colleen Lynch is approved: Professor Gregory S. Gilbert, chair Professor Stacy M. Philpott Professor Andrew Szasz Professor Ingrid M. Parker Quentin Williams Acting Vice Provost and Dean of Graduate Studies Copyright © by Shannon Colleen Lynch 2020 TABLE OF CONTENTS List of Tables iv List of Figures vii Abstract x Dedication xiii Acknowledgements xiv Chapter 1 – Introduction 1 References 10 Chapter 2 – Host Evolutionary Relationships Explain 12 Tree Mortality Caused by a Generalist Pest– Pathogen Complex References 38 Chapter 3 – Microbiome Variation Across a 66 Phylogeographic Range of Tree Hosts Affected by an Emergent Pest–Pathogen Complex References 110 Chapter 4 – On Collaborative Governance: Building Consensus on 180 Priorities to Manage Invasive Species Through Collective Action References 243 iii LIST OF TABLES Chapter 2 Table I Insect vectors and corresponding fungal pathogens causing 47 Fusarium dieback on tree hosts in California, Israel, and South Africa. Table II Phylogenetic signal for each host type measured by D statistic. 48 Table SI Native range and infested distribution of tree and shrub FD- 49 ISHB host species. Chapter 3 Table I Study site attributes. 124 Table II Mean and median richness of microbiota in wood samples 128 collected from FD-ISHB host trees. Table III Fungal endophyte-Fusarium in vitro interaction outcomes.
    [Show full text]
  • A Novel Bacteria-Free Method for Sour Beer Production 1 Kara Osburna
    bioRxiv preprint doi: https://doi.org/10.1101/121103; this version posted March 27, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Primary souring: a novel bacteria-free method for sour beer production 2 Kara Osburna, Justin Amaralb, Sara R. Metcalfa, David M. Nickensa, Cody M. Rogersa, 3 Christopher Sausena, Robert Caputoc, Justin Millerc, Hongde Lid, Jason M. Tennessend, and 4 Matthew L. Bochmana,c* 5 aMolecular and Cellular Biochemistry Department, 212 South Hawthorne Drive, Simon Hall 6 MSB1, room 405B, Indiana University, Bloomington, IN 47405, USA. 7 [email protected] 8 [email protected] 9 [email protected] 10 [email protected] 11 [email protected] 12 [email protected] 13 14 bMainiacal Brewing Company, Bangor, ME 04401, USA. 15 [email protected] 16 17 cWild Pitch Yeast, Bloomington, IN 47405, USA. 18 [email protected] 19 [email protected] 20 21 dDepartment of Biology, Indiana University, 1001 East Third Street, Bloomington, IN 47405, 22 USA. 23 [email protected] 24 [email protected] 25 26 *Corresponding author: 27 Matthew L. Bochman, Ph.D. 28 Assistant Professor 29 Molecular and Cellular Biochemistry Department 30 212 South Hawthorne Drive 31 Simon Hall MSB1, room 405B 32 Indiana University 33 [email protected] 34 812-856-2095 1 bioRxiv preprint doi: https://doi.org/10.1101/121103; this version posted March 27, 2017.
    [Show full text]
  • Adaptive Evolution of Non-Saccharomyces Yeasts to Produce Wines with Low Ethanol Content Catarina Rocha
    Adaptive Evolution of Non-Saccharomyces Yeasts to Produce Wines with Low Ethanol Content Catarina Rocha Abstract This work describes the implementation of adaptive evolution, a non-genetic engineering approach, applied to non- Saccharomyces yeasts to originate variants that produce reduced levels of ethanol, during alcoholic fermentation of grape must. Sub-lethal concentrations of potassium chloride and furfural were used as evolutive pressures. Both KCl and furfural impose stresses that affect the cell stability compromising the redox balance. The natural response of cell to regenerate NAD+ is increasing the production of glycerol. The original populations of two non-Saccharomyces strains, Metschnikowia pulcherrima 134|MET and Lachancea thermotolerans 483|LCH were subjected to adaptive evolution. In parallel, Saccharomyces cerevisiae 771|SAC strain was also put under adaptive evolution as a comparative evolutive line. At each 50 generations, the evolved populations were analyzed for ethanol and glycerol production and glucose and fructose consumption by enzymatic assays. The evolved populations under adaptive evolution did not show relevant differences regarding to the production of ethanol or glycerol, when compared with their originals. Additionally, ethyl methanesulfonate (EMS) was used as a mutagen to create a population of mutagenized cells. To assess the metabolome of yeasts, by identifying the metabolites present inside the cells and the ones exported to the environment, Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FTICR-MS) was applied along growth. In future, new adaptive evolution lines will be started with the EMS mutagenized cells and FTICR-MS Spectrometry will be used to compare the original yeast populations with the prospective evolved ones. Keywords: Non-Saccharomyces yeasts; Wine; Adaptive Evolution; Mutagenesis; Mass Spectrometry.
    [Show full text]
  • Evaluation of the Chitin-Binding Dye Congo Red As a Selection Agent for the Isolation, Classification, and Enumeration of Ascomycete Yeasts
    Archives of Microbiology (2018) 200:671–675 https://doi.org/10.1007/s00203-018-1498-y SHORT COMMUNICATION Evaluation of the chitin-binding dye Congo red as a selection agent for the isolation, classification, and enumeration of ascomycete yeasts Tomas Linder1 Received: 3 February 2018 / Revised: 19 February 2018 / Accepted: 21 February 2018 / Published online: 23 February 2018 © The Author(s) 2018. This article is an open access publication Abstract Thirty-nine strains of ascomycete yeasts representing 35 species and 33 genera were tested for their ability to grow on solid agar medium containing increasing concentrations of the chitin-binding dye Congo red. Six strains were classified as hyper- sensitive (weak or no growth at 10 mg/l Congo red), five were moderately sensitive (weak or no growth at 50 mg/l), three were moderately tolerant (weak or no growth at 100 mg/l), while the remaining 25 strains were classified as resistant (robust growth at ≥ 100 mg/l) with 20 of these strains classified as hyper-resistant (robust growth at 200 mg/l). Congo red growth phenotypes were consistent within some families but not others. The frequency of Congo red resistance among ascomycete yeasts was deemed too high for the practical use of Congo red as a selection agent for targeted isolation, but can be useful for identification and enumeration of yeasts. Keywords Antifungal · Cell wall · Phenotype · Yeast Introduction groups of yeasts. For example, chemically defined growth medium containing methanol as the sole carbon source is The development of genome sequencing over the past four commonly used to isolate species of methylotrophic yeasts decades has revolutionized yeast taxonomy and now enables (van Dijken and Harder 1974).
    [Show full text]
  • GRAS Notice for Pichia Kudriavzevii ASCUSDY21 for Use As a Direct Fed Microbial in Dairy Cattle
    GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle Prepared for: Division of Animal Feeds, (HFV-220) Center for Veterinary Medicine 7519 Standish Place Rockville, Maryland 20855 Submitted by: ASCUS Biosciences, Inc. 6450 Lusk Blvd Suite 209 San Diego, California 92121 GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle TABLE OF CONTENTS PART 1 – SIGNED STATEMENTS AND CERTIFICATION ................................................................................... 9 1.1 Name and Address of Organization .............................................................................................. 9 1.2 Name of the Notified Substance ................................................................................................... 9 1.3 Intended Conditions of Use .......................................................................................................... 9 1.4 Statutory Basis for the Conclusion of GRAS Status ....................................................................... 9 1.5 Premarket Exception Status .......................................................................................................... 9 1.6 Availability of Information .......................................................................................................... 10 1.7 Freedom of Information Act, 5 U.S.C. 552 .................................................................................. 10 1.8 Certification ................................................................................................................................
    [Show full text]
  • The Species-Specific Acquisition and Diversification of a Novel Family Of
    bioRxiv preprint doi: https://doi.org/10.1101/2020.10.05.322909; this version posted October 7, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 The Species-specific Acquisition and Diversification of a Novel 2 Family of Killer Toxins in Budding Yeasts of the Saccharomycotina. 3 4 Lance R. Fredericks1, Mark D. Lee1, Angela M. Crabtree1, Josephine M. Boyer1, Emily A. Kizer1, Nathan T. 5 Taggart1, Samuel S. Hunter2#, Courtney B. Kennedy1, Cody G. Willmore1, Nova M. Tebbe1, Jade S. Harris1, 6 Sarah N. Brocke1, Paul A. Rowley1* 7 8 1Department of Biological Sciences, University of Idaho, Moscow, ID, USA 9 2iBEST Genomics Core, University of Idaho, Moscow, ID 83843, USA 10 #currently at University of California Davis Genome Center, University of California, Davis, 451 Health Sciences Dr., Davis, CA 11 95616 12 *Correspondence: [email protected] 13 14 Abstract 15 Killer toxins are extracellular antifungal proteins that are produced by a wide variety of fungi, 16 including Saccharomyces yeasts. Although many Saccharomyces killer toxins have been 17 previously identified, their evolutionary origins remain uncertain given that many of the se genes 18 have been mobilized by double-stranded RNA (dsRNA) viruses. A survey of yeasts from the 19 Saccharomyces genus has identified a novel killer toxin with a unique spectrum of activity 20 produced by Saccharomyces paradoxus. The expression of this novel killer toxin is associated 21 with the presence of a dsRNA totivirus and a satellite dsRNA.
    [Show full text]
  • Foliar Application of Chitosan and Yeast Elicitor Facilitate Reducing Incidence and Severity of Alternaria Leaf Blight of Tomato and Brinjal F
    Research Article iMedPub Journals 2020 www.imedpub.com Research Journal of Plant Pathology Vol.3 No.2:4 Foliar Application of Chitosan and Yeast Elicitor Facilitate Reducing Incidence and Severity of Alternaria Leaf Blight of Tomato and Brinjal F. H. Tumpa and M. A. R. Abstract Khokon* Two pot experiments were conducted in the net house to investigate whether Department of Plant Pathology, aqueous solution of chitosan and yeast elicitor can suppress Alternaria leaf blight Bangladesh Agricultural University, of tomato and brinjal. Aqueous solutions of chitosan and yeast elicitor were Mymensingh-2202, Bangladesh applied on seeds and on the foliage of tomato and brinjal at three growth stages following 0.02, 0.05, 0.1 and 0.2% concentration respectively. The chitosan and yeast elicitor-treated plants were further inoculated artificially to create sufficient disease pressure to monitor incidence and severity. Differential responses were *Corresponding author: Khokon MAR, recorded for chitosan and yeast elicitor considering both growth stages and type of Department of Plant Pathology, Bangladesh crops. Chitosan performed superior in tomato plants while yeast elicitor in brinjal Agricultural University, Mymensingh-2202, plants considering both disease incidence and severity. In both cases, 42 DAT Bangladesh, E-mail: [email protected] was more suitable for chitosan and yeast elicitor spray to get maximum disease suppression. Chitosan and yeast elicitor at 0.2% showed superior performance in reducing blight incidence and severity by Alternaria. Citation: Tumpa FH, Khokon MAR (2020) Keywords: Chitosan; Yeast elicitor; Alternaria solani; Tomato; Brinjal Foliar Application of Chitosan and Yeast Elicitor Facilitate Reducing Incidence and Severity of Alternaria Leaf Blight of Tomato and Brinjal.
    [Show full text]
  • Úvod Abstract
    ZPRÁVY LESNICKÉHOLUKÁŠOVÁ VÝZKUMU, K. – HOLUŠA 57, 2012 J. (3): 230-240 PATOGENY LÝKOŽROUTŮ RODU IPS (COLEOPTERA: CURCULIONIDAE: SCOLYTINAE): REVIEW PATHOGENS OF BARK BEETLES OF THE GENUS IPS (COLEOPTERA: CURCULIONIDAE: SCOLYTINAE): REVIEW KAROLINA LUKÁŠOVÁ1) – JAROSLAV HOLUŠA1,2) 1)Česká zemědělská univerzita v Praze, Fakulta lesnická a dřevařská, Praha 2)Výzkumný ústav lesního hospodářství a myslivosti, v. v. i., Strnady ABSTRACT Some bark beetles of genus Ips occuring in Europe attack multiple tree hosts. is probably explains why some of the bark beetle diseases have also more hosts. For example Gregarina typographi was known from all of six analysed species and Chytridiopsis typographi from midgut epithelium of ve species of the genus Ips. On the other hand there is only one known species-speci c pathogen Larssoniella typographi described in Ips duplicatus. At present, around twenty species of pathogens were described in bark beetle subfamily Scolytinae, out of which ten are known in the spruce bark beetle Ips typographus. For most pathogens, only rare information is available about in uence on beetles: on the vitality, fertility, ight ability, hibernation, etc. Moreover, most experiments are conducted under laboratory conditions. In this paper we summarize the knowledge of pathogens (viruses, protozoa, fungi) and parasitic nematodes and give a comprehensive overview of detected pathogens in di erent species of genus Ips. Klíčová slova: rod Ips, mikrosporidie, gregariny, virus, populační hustota, předávání Key words: genus Ips, microsporidia, gregarines, virus, population density, transmission ÚVOD výzkum. Ještě slabší jsou znalosti o hlísticích. Všechny druhy vázané na rod Ips byly zpracovány v monogra i R (1956), od té doby Lýkožrouti rodu Ips (Coleoptera: Curculionidae: Scolytinae) napadají bylo napsáno jen několik studií na toto téma.
    [Show full text]
  • Snails As Taxis for a Large Yeast Biodiversity
    fermentation Article Snails as Taxis for a Large Yeast Biodiversity Madina Akan 1,2, Florian Michling 1, Katrin Matti 1, Sinje Krause 1, Judith Muno-Bender 1 and Jürgen Wendland 1,2,* 1 Department of Microbiology and Biochemistry, Hochschule Geisenheim University, Von-Lade-Strasse 1, D-65366 Geisenheim, Germany; [email protected] (M.A.); fl[email protected] (F.M.); [email protected] (K.M.); [email protected] (S.K.); [email protected] (J.M.-B.) 2 Research Group of Microbiology (MICR)—Functional Yeast Genomics, Vrije Universiteit Brussel, Pleinlaan 2, BE-1050 Brussels, Belgium * Correspondence: [email protected]; Tel.: +49-6722-502-332 Received: 24 August 2020; Accepted: 15 September 2020; Published: 18 September 2020 Abstract: Yeasts are unicellular fungi that harbour a large biodiversity of thousands of species, of which particularly ascomycetous yeasts are instrumental to human food and beverage production. There is already a large body of evidence showing that insects play an important role for yeast ecology, for their dispersal to new habitats and for breeding and overwintering opportunities. Here, we sought to investigate a potential role of the terrestrial snails Cepaea hortensis and C. nemoralis, which in Europe are often found in association with human settlements and gardens, in yeast ecology. Surprisingly,even in a relatively limited culture-dependent sampling size of over 150 isolates, we found a variety of yeast genera, including species frequently isolated from grape must such as Hanseniaspora, Metschnikowia, Meyerozyma and Pichia in snail excrements. We typed the isolates using standard ITS-PCR-sequencing, sequenced the genomes of three non-conventional yeasts H.
    [Show full text]