KA WAI OLA THE LIVING WATER of OHA

OFFICE of HAWAIIAN AFFAIRS • 711 Kapi‘olani Blvd., Ste. 500 • Honolulu, Hawai‘i 96813-5249 Ke¯ke¯mapa (December) 2007 Vol. 24, No. 12 affordable housing: Hot topic at Maui biz gathering page 04

The way and art of PIKO page 08

Books for holiday gift giving page 17

Letters to the editor page 20

The epic tale of

Hi‘iakaikapoliopele Healing page 16 native lives page 14 Students seek to heal through the ‘Imi Ho‘öla Post-Baccalaureate Program that helps the disadvantaged enter the John A. Burns School of Medicine

www.oha.org Photo: Blaine Fergerstrom

- NU HOU • NEWS Ke¯ke¯mapa2007 |  OHA Mälama Loan for businesses, education and home improvement Board of Trustees The OHA Mälama Loan aims to By Lisa Asato | Publications Editor help businesses grow and consum- Haunani Apoliona, MSW ers pay for home improvements hen Maui kalo farmer Chairperson, Trustee, At-large and education. It offers five-year, John Kaina Jr. wanted 5 percent loans for up to $75,000 Tel: 808.594.1886 to start a business, he Fax: 808.594.1875 W for Native Hawaiians, based on got a low-interest loan from the Email: [email protected] credit score. Office of Hawaiian Affairs that “Achieving a strong and vibrant allowed him to buy equipment, John D. Waihe‘e IV Hawaiian people and nation requires rent a backhoe and more than Vice Chair, Trustee, At-large successful enterprise and participa- Maui kalo farmer John Kaina Jr. eyes expansion of his business with an OHA loan. double the number of patches he Tel: 808.594.1838 tion in economic and commercial - Photo: Lisa Asato. had from two to five. Fax: 808.594.0208 activity, while opening opportunity Loan program. They include OHA to add more loan products, “It’s just a matter of growing Email: [email protected] to infuse Hawaiian culture, values Catherine Kin Lee, who wants speed up the loan-approval pro- the product. Most people love to and world view into these initia- to start a Christian Café Ministry cess and become the lender of first eat poi,” said Kaina, owner of Rowena Akana tives,” said OHA Board of Trustees in Wai‘anae Mall, where people resort for Native Hawaiians. JJ’s Kalo, Fish and ‘Äina Co., Trustee, At-large Chairperson Haunani Apoliona, at could eat, drink and come for As a result, loan-approval times which also grows ti leaf, bananas, Tel: 808.594.1860 the Nov. 15 unveiling. spiritual nourishment, and Therese will be decreased to within five and last year started selling lü‘au Fax: 808.594.0209 A sneak preview of the new Sanchez and Christine Hall, who days for eligible applicants, from leaf to Takamiya Market in Happy Email: [email protected] program was shared with more want to start a wellness academy six months or more. OHA and Valley. than 250 attendees of Maui Native based on Native Hawaiian values First Hawaiian Bank, its strategic Donald B. Cataluna Attracted by the low-inter- Hawaiian Chamber of Commerce’s and beliefs. lending partner in the venture, also Trustee, Kaua‘i and Ni‘ihau est rate, Kaina received $10,000 Business Fest earlier in the week, “This is all about getting credit strive to lend the fund’s entire $24 from OHA’s Native Hawaiian Tel: 808.594.1881 where Lt. Gov. James Aiona told and capital to Native Hawaiians,” million in two years. Fax: 808.594.0211 Revolving Loan Fund, which he the group that about 8 percent of Glick said. First Hawaiian Bank president Email: [email protected] noted, “is strictly for those of Hawaii businesses are owned by Congress established the Native and chief executive Don Horner Hawaiian ancestry.” Two years Native Hawaiians but they account Hawaiian Revolving Loan Fund said his bank is up to the chal- Robert K. Lindsey Jr. later he’s eyeing a larger, 2-acre for only 2 percent of state tax 20 years ago to provide business- lenge. “All I can say to you is, E Trustee, Hawai‘i site in Kapuna and is considering revenue. related funding on reasonable Komo Mai – as of today we are applying for another loan from Tel: 808.594.1855 Mark Glick, OHA’s Economic terms and conditions for Native making loans!” Fax: 808.594.1883 OHA to help him buy a fishing Development Director, said that Hawaiians. The fund is imple- Applications are available at Email: [email protected] boat to further grow his business. about 700 Native Hawaiians over mented by OHA and overseen all 58 branches of First Hawaiian Last month, OHA unveiled a the past year have said they want by the Administration for Native Bank. The fund’s board of directors Walter M. Heen new loan program to do just that. to participate in the OHA Mälama Americans, which has called on retains loan-approval authority. Trustee, O‘ahu Tel: 808.594.1854 Fax: 808.594.0210 No Akaka Bill recommendation by civil rights panel Email: [email protected] Colette Y. Machado By the Public Information Office Agbayani, Robert Alm, Daphne E. was pleased with the committee’s Sullivan said. Trustee, Moloka‘i and La¯na‘i Barbee-Wooten, Jennifer Benck, vote taken during a meeting at the OHA reviewed the 2006 USCCR Tel: 808.594.1837 controversial local advi- Linda Colburn, Michelle Nalani Hilton Hawaiian Village in Waikïkï. decision, and documented its Fax: 808.594.0212 sory panel to the U.S. Fujimori, Wayne Tanna and “As we have maintained for many flaws. OHA also reviewed Email: [email protected] ACommission on Civil Jackie Young. Voting to continue months, this Hawai‘i committee the HSAC, whose members are Rights decided against taking a new debate were members H. William was being positioned into mak- appointed by the USCCR, and the Boyd P. Mossman position on the Native Hawaiian Burgess, Vernon Char, Rubellite ing a decision through manipula- local hearings that were held. All Trustee, Maui Government Reorganization Act Johnson, James Kuroiwa, Thomas tion by majority members of the that is contained in a report titled: Tel: 808.594.1858 of 2007, leaving intact the panel’s MacDonald and Paul Sullivan. USCCR in Washington, D.C., and Correcting the Record: The U.S. Fax: 808.594.1864 support of the Akaka Bill. One member, Kheng See Ang, was their staff director,” said Haunani Commission on Civil Rights and Email: [email protected] The Hawaii State Advisory absent from last month’s proceed- Apoliona, chairperson of the Justice for Native Hawaiians. A copy Committee voted 8-6 not to make ings at the Hilton Hawaiian Village. Board of Trustees for the Office of of the OHA report is available on the Oz Stender a recommendation to the civil Critics of the panel have argued Hawaiian Affairs. OHA website at www.oha.org. Trustee, At-large rights commission on the measure that the committee was “stacked” HSAC opponents of the Akaka OHA alerted the public about Tel: 808.594.1877 that is pending before Congress. with Akaka Bill opponents who Bill argued that the panel should irregularities in the USCCR selec- Fax: 808.594.1853 Voting to table further debate are seeking to dismantle Hawaiian have taken. a position. tion process after none of the nine Email: [email protected] and deliberation on the Akaka programs. “We now owe those folks some names OHA submitted were select- Bill were HSAC members Amy The Office of Hawaiian Affairs accountability,” member Paul ed for placement on HSAC. - 4 | Ke¯Ke¯mapa2007 PAHAwAiiAN‘OiHANA • ENgLISHBuSINESS Affordable housing options discussed at Maui Hawaiian chamber conference

By Lisa Asato | Publications Editor tion for their children in Hawai‘i, he said. he Office of Hawaiian “We need to figure out how Affairs should partner with we can keep our Hawaiians here, Tdevelopers across the state and that is why OHA needs to get to provide affordable housing for involved in affordable housing,” Native Hawaiians, OHA Trustee Mossman said to about 260 attend- Boyd Mossman said last month at ees of the Maui Native Hawaiian a Native Hawaiian business con- Chamber of Commerce’s inaugu- ference on Maui. ral Business Fest, held Nov. 13-14 The move would mark a change at the Grand Wailea Resort. for OHA, which primarily supports Mossman, the past president affordable housing issues through and founder of the nearly 3 year- donations to various organiza- old business group, spoke as part tions. It would also help provide of an affordable and workforce Members of a panel on afforable housing discussed solutions last month at the Maui Native Hawaiian Chamber of Commerce Conference. a solution for Native Hawaiians housing panel along with Micah - Photo: Lisa Asato. who say they have to move to the Kane, chairman and director of Rodriguez, president of Nä Hale Maui Economic Opportunity Inc. fellowship, networking – which U.S. continent, because they can’t the state Department of Hawaiian O Maui community land trust; and Mossman said OHA staff is could lead to partnering in matters afford a home and a good educa- Home Lands; Tom Blackburn- Sandy Baz, executive director of working to get authorization from like government contracts – and its Board of Trustees to pursue a help to increase membership to blueprint for OHA’s involvement about 150 from 100 by year’s end. in affordable housing. He also The chamber accepts members Now available on DVD said OHA has been working with who are Hawaiian or Hawaiian Hawaiian Home Lands “to see at heart. where we can partner up and assist Other conference highlights Through Namaka’s Eyes each other.” included: “They have the land; we have • Kane said DHHL has had a THE LIFE OF PATIENCE BACON the money. So the question is how “very active past five years,” with can we work it out together,” he Maui County receiving almost Raised by preeminent Hawaiian scholar said, adding that “every single 60 percent, or $70 million, of Mary Kawena Pukui and her mother Paahana developer we’ve talked to has been DHHLs infrastructure budget. He Wiggin, Patience Namaka Bacon is today one willing to work with us.” said several Maui projects have of Hawai‘i’s most beloved küpuna and keeper Of the possible partnership been completed or are underway. of Hawaiian traditions. Her storied life unfolds between DHHL and OHA, Kane For example, the agency’s Waiehu in this 60-minute documentary produced by told the audience: “That’s one Kou in Wailuku expects its first Ka‘iwakïloumoku, the Hawaiian cultural center resource that we’re looking at. families to move into the 98-unit at Kamehameha Schools Kapälama. The second resource is the State of project in mid-December. “Those Hawai‘i. They have an obligation are some of the things we’ve been To purchase your copy, visit to fund our program adequately.” working on,” he said. “And we’ve kaiwakiloumoku.ksbe.edu or contact The invitation-only event offered benefited from a tremendous rela- Ka’iwakïloumoku Coordinator Jamie Fong at exhibits, various panel discussions tionship from the trade unions (808) 842-8655. DVDs also available at the and speeches by Maui County here.” Kamehameha Schools Kapälama school Mayor Charmaine Tavares, Lt. • OHA’s radio show Nä ‘Öiwi store (1887 Makuakäne St.). Gov. James Aiona and developer ‘Ölino made its broadcast debut

John DeFries. The event, which from Maui. (See sidebar.) was free to attendees, attracted 20- • OHA announced its new year-olds through küpuna. Mälama Loan for businesses and “We’re reaching a wide spec- consumers a day ahead of the offi- trum of people,” said MNHCC cial announcement. (See page 03.) board member Mercer “Chubby” For more information on Kamehameha SchoolS Vicens, who chaired the event. the Maui Native Hawaiian Conference organizers said they Chamber of Commerce, call hoped the event would encourage 808-870-1177. Ho‘olakoHo‘olako PonoPono forfor DHHLDHHL LesseesLessees

American Savings Bank is privileged to offer the Ho‘olako Pono loan program, which provides expanded financing options available to Department of Hawaiian Home Lands (DHHL) lessees.

Ho‘olako Pono Loan Program Benefits:

Conventional loans up to $625,500 Actor Branscombe Richmond and wife 103% financing available (some restrictions apply)* Lei Ma‘a Richmond (inset) join radio Fixed interest rates – principal and interest payments will not change hosts Kimo Kaho‘¯ano and Brickwood Galuteria. - Photo: Lisa Asato Cash out refinances (some restrictions apply)* Loans are serviced locally – no need to call out of state with OHA radio questions. A toll-free phone number is available for neighbor island borrowers show on the road One-time-close construction loan By Lisa Asato | Publications Editor actor Branscombe Richmond and Here is what a couple of our Ho‘olako Pono customers had to say. his wife, Lei Ma‘a Richmond, he Office of Hawaiian an entertainer and former Miss “As first time homebuyers, my wife and I were a bit reluctant going into Affairs’ radio show, Hawaii USA. the whole process, but our friendly loan officer, Rosie, explained details and Nä‘Öiwi ‘Ölino, made T Wrapping up the broadcast, live even provided options for us. She kept us informed every step of the way. its Maui debut last month, and from the Maui Native Hawaiian Thanks to the Ho‘olako Pono loan program at American Savings Bank, we co-hosts Brickwood Galuteria Chamber of Commerce’s first Business Fest, Kaho‘äno recalled were finally able to buy a home of our very own.” cultural specialist Akoni Akana’s – Ricky and Kamomi Carvalho tagline from the previous day’s show, “You gotta up your amps!” “We’d considered other lenders in the past, but none offered the which had the hosts cracking up. convenient combination of a construction and home loan at the time. Getting “(Akana) said, that’s my phrase, it’s a Maui phrase, don’t you steal our first loan from American Savings Bank was like being helped by ‘ohana. Vianne, our loan officer, answered our questions, eased our concerns and Brickwood Kimo that from me.” The two-day broadcast was accommodated our busy schedules to make the process as easy as possible.” Galuteria Kaho‘¯ano “over too soon,” Kaho‘äno told listeners. “There’s so much to – Harold and Wendy Vidinha and Kimo Kaho‘äno hit the road share.” And Galuteria expressed in style, broadcasting from the hope of future road trips, telling Speak to one of our loan officers or apply online today. Grand Wailea Resort. the audience: “It’s the first time “We’re gazing across the we’re on the road. We hope it’s Oahu 593-1226 • Maui 872-4999 channel and we’re looking at not the last time we’re on the road Kauai 632-5050 • Hilo 933-7599 • Kona 933-8215 Kaho‘olawe,” Galuteria said to because it’s a wonderful opportu- an O‘ahu audience during the nity for us to take the show here Toll Free 1-800-272-2566 morning drive time, as majestic there and everywhere.” Haleakalä shone in the sun. Where might the show visit *Call us for details. A string of prominent locals next? Stay tuned. Nä ‘Öiwi joined the Nov. 13-14 broadcast, ‘Ölino can be heard 7 to including OHA Trustee Boyd 9 a.m. weekdays on AM 940 Member FDIC asbhawaii.com Mossman, kahu Charles Maxwell, or by live web streaming at developer John DeFries, and www.am940hawaii.com.

ASBH-16899_KaWaiOla.indd 1 9/20/07 3:53:59 PM

JOB#: ASBH-16899 CLIENT: American Savings Bank TITLE: Ho‘olako Pono BLEED: No COLOR: CMYK PUB: Ka Wai Ola TRIM: 5.4722” x 11” SIZE: 3 col., 5.4722 x 11 RUN DATE: Oct. 2007 LIVE: If you have questions concerning this fi le, please contact our Fulfi llment Manager immediately at 808.531.9841  | Ke¯ke¯mapa2007 NA¯ PA¯pale • many hats Taste and enjoy farm products around a culturally diverse table By Jimmy F. “Jeno” Kona coffee fields, to dudes from home-grown lunch prepared by any more people of color. Don’t enrolled but they don’t participate. Enocencio Puna practicing perma-culture Sheraton’s chefs. And then, that’s get me wrong, these appeared to The association notifies them by on pahoehoe lava, to entrepre- all I saw; not very many locals be nice and caring folks concerned making announcements in news- neurs well-placed in the organic and no mo’ Hawaiians. Hopefully about the current methods used for letters and email, but to no avail. atmosphere. They brought with tomorrow, more Hawaiians would poisoning the land, and our food When I asked if they ever met with them an abundant crop of home- show up at the annual Hawaii and water source. The bad part any of these farmers and visited n mid-October, I enjoyed the grown lettuce, cabbage, bananas, Organic Farmers Association was there were no people of color their farms and got to know them company of many small busi- tomatoes, eggplant, sugar cane, (HOFA) meeting. voicing those same concerns. better by introducing themselves Iness ranchers and farmers both yams and sweet potato; including Because I didn’t want to go Once the meeting was pau, they with a firm handshake, for the from the organic and synthetic exotic fruits like rambutan, lichee, back to Hilo and waste diesel and asked if anyone had anything to most part the answer was no. world. Most of them came to the longon, soursop, dragon and jack I couldn’t afford the luxury suite share; and like a good Hawaiian I expressed my feelings con- Sheraton Keauhou Bay Resort & fruit. And then there were veg- at the Sheraton, I slept in the Ram I raised my hand and mentioned cerning the lack of participation Spa to participate in the Food etables that you would see grow- in the resort parking lot. It was all that I attend lots of conferences from people of color and the Summit conference. There were a ing in plantation camps that the right, I was able to stretch out in presented by CNHA, HTA, OHA, need for diversity, not only those lot of speakers and panelists who Filipinos and the Japanese grew the mega cab and enjoy the ocean KSBE and others who share intended for vegetables, fruits, talked about producing safe foods, like warabi, paria leaves, marun- and mountain breeze, but befo’ similar views as theirs, includ- flowers, trees, but in people too. prohibiting genetically modified gay, pipinola, daikon, gobo and even thinking about sleep I had to ing the preservation of culturally I expressed that to be an effec- crops on agriculture lands, and other ethnic produce. feed my face one mo’ time. I went significant lands, important agri- tive organization leaders need to supporting the concept of develop- These were all good to see, taste to KTA at Keauhou and picked up cultural lands, food sovereignty be sensitive not only to its kind ing “slow foods” by organic means and enjoy. The bummer part was I some smoked marlin, a sub and and environmental concerns, etc. (mono-cropping) but “culturally of composting and manure mix neva’ got to see people of color. some drinks. I also forgot to men- As each participant turned their sensitive” to a wealth of skills, rather than chemically enhancing There were a few, like noted taro tion that KTA was also at the food heads to the back of the large knowledge and abilities (diversi- fast growing produce that would and ‘awa specialist Jerry Konanui, summit encouraging folks to sup- patio I was sitting in, I could fication) that combines the human readily meet market demand. who shared his values on food port their Mountain Apple brand see their faces with concern (and factor link toward continual posi- There were all kinds of folks sovereignty and safety. There was label for locally grown foods that some lack of) when I asked, “By tive progression. there — from the Honolulu busi- Manu Meyer who presented her- includes grass-fed meat and fresh the way, how come I don’t see any In essence, without this strength nessmen of Whole Foods to the self as a well-defined servant of fish, and value-added products like Japanese and Filipino folks here? in cultural diversity of humans barefoot haoles living off the Hawaiian people. And then poi, külolo, haupia, smoked meats In fact, I don’t see any Korean or focused on issues toward the bet- the land in upper there was me, locally grown Hilo and fish, tofu all prepared by local Vietnamese farmers here. Where terment of the life we so love, boy taste-testing everything folks. are the Hawaiian farmers?” we are doomed to fail in what- in sight and indulg- At the HOFA meeting, I was As I addressed this question ever the endeavor may be. We, the ing in the there along with Juanita Kawamoto to the president, I could see the Haole, the Hawaiian, the Filipino, t a s t i e s t and ‘ohana of Fresh from the Farm, stunned and paralyzing effect that Korean, Japanese, the Portuguese extending her services to the pro- question had made. It was blunt and others need to sit knee-to-knee organic group. As the meeting force trauma to some, numb to at the kitchen table and wala‘au. If progressed I could not help but others. The president mentioned we are to survive in these islands, wonder why there weren’t that they do have we somehow need to get along. farmers There’s no better way to get along, then by sharing culturally prepared safe, healthy foods artistically cre- ated by loving hands of all colors.

Jeno Enocencio picks Hawaiian chili peppers at his farm, Kalalau Ranch and Victory Garden. - Photo: Courtesy Jeno Enocencio KE¯¯KE¯¯ MAPA CALENDAR Nä Mele O Maui Tahitian at the 20th Hula Fri., Dec. 7, 9 a.m.-1:30 p.m. Hö‘ike. $10-$20. Kaua‘i Hundreds of Maui County War Memorial Convention students grades K to 12 sing Hall in Lïhu‘e. 808-822- their hearts out in an annual 1451 or 808-652-2111. song competition to perpet- uate the Hawaiian culture. Song of Christmas There’s an art contest for Sun., Dec. 16, noon and 7 p.m. high school students, too. Have yourself a merry Kä‘anapali Beach Resort’s little Christmas with the Hyatt Regency Maui Resort Grammy-nominated styl- & Spa, Grand Ballroom. ings of Ho‘okena and 808-661-3271 or www. special guest Uncle Willie kaanapaliresort.com. K. $50 luncheon concert, $65 dinner concert, half Kamehameha off for keiki 4 to 11, $100 Schools Christmas VIP. Doors open 90 minutes Concert before each show, and buf- Fri., Dec. 7, 11 a.m. dress fets open an hour before rehearsal and 2 p.m.; Sat., show time. Ala Moana Dec. 8, 4 p.m. and 7:30 p.m. Hotel, Hibiscus Room. 955- Features performances by 4811, ext. 4250, ask for Candy. elementary school keiki, the High School Orchestra, ‘Iolani Palace Symphonic Band, Drill Evening Tours Team, Hawaiian Ensemble Tues. and Wed., Dec. and Concert Glee Club. 27 and 28, 6-9 p.m. Free. Hawai‘i Theatre. ‘Iolani Palace opens for Tickets available one hour night tours one time of year before show time, or in to commemorate Queen advance by calling 842- Kapi‘olani’s birthday. 8495. Tickets not required Highlights include live for Friday shows. www. Hawaiian music on the front hawaiitheatre.com. steps and – reminiscent Barefoot Christmas of the royal era – there’ll Sat., Dec. 8, 7:30 p.m. be opera, piano and string Maui’s own Barefoot quartet in the Blue Room Natives Willie K and Eric and Throne Room. $6, $3 Gilliom rock, roll and croon keiki 5-12. 522-0822 or Island style, performing www.iolanipalace.org. holiday favorites as well as hits off their 2007 Best Masters of Hawaiian Contemporary Hawaiian Slack Key Guitar Album “Barefoot Natives” Wed., Jan. 2, 7:30 p.m. and their new CD “Slack Uncle Richard Ho‘opi‘i, a Key Circus.” $10, $28, master of leo ki‘eki‘e, or $37, half price for keiki 12 and younger. Maui Arts falsetto, kicks off the 2008 & Cultural Center, Castle leg of this weekly concert Theater. 808-242-7469 or series, now in its fourth www.mauiarts.org. year. Ho‘opi‘i is featured on the Grammy-award win- A Journey Thru ning compilation “Legends Polynesia of Slack Key Guitar – Live Fri., Dec. 14, 4:30 p.m. from Maui” and “Treasures dinner, 6:30 p.m. show of Hawaiian Slack Key Students of Healani’s Hula Guitar,” both culled from Hälau & Music Academy these concert performances. perform hula kahiko, hula $45. Näpili Kai Beach ‘auana, and dances from Resort in Lahaina. 808-669- across the Pacific, including Maori, Samoan, Tongan and 3858 or www.slackkey.com. 8 | Ke¯Ke¯mapa2007 PA¯HeONA • FINE ARTS The and show of the gathering, situated at PiKO eXhiBit Way art the far corner of the room. “Once they see the slide show then their of eyes are open to a whole new understanding,” he said. “Then PIKO they go back and look at all the ancestors were able to speak to pieces again.” this painting.” The 12-year-old PIKO gather- His painting “Pele-Moana- ing – held in Hawai‘i for the first Malamalama” – lightly soil- time – attracted more than 100 stained at its center – is part of the master and emerging indigenous “Mai Ka PIKO Mai: Gathering artists from Hawai‘i, Sämoa, New of Indigenous Artists” exhibit at Zealand, Australia, Torres Strait, Bishop Museum’s Joseph M. Long Mauritius, Australia, Cook Islands Gallery, running through April 6. and American Indian tribes from Featuring a little more than Alaska to the American Southwest. 1 By Lisa Asato | Publications Editor 40 creations, including painted Together, artists addressed PIKO, drums, wood carvings, glass work meaning navel or umbilical cord, Far left: Matthew Randall, Ngai t an international PIKO and a woven flax cloak, the travel- as the source of artwork and as a Tamanuhiri, Ngati Rakaipaaka, gathering for indigenous ing exhibit arrived in Honolulu by shared connection to ancestors, wood on stone. Aartists this summer, Kau‘i way of Hilo’s Wailoa Center and landscape and each other. - Photo: Lisa Asato Chun buried his unfinished paint- will next head to C.N. Gorman Over five days, artists pro- ing in the soil of Waimea, Hawai‘i Museum at the University of duced 136 works of art, many 1. Pahu, 2007, Kala Willis, Island so his ancestors could also California, Davis, in fall 2008. of which came out of their visit Hawai‘i. place their mark on it. Keömailani Hanapï Foundation to Halema‘uma‘u Crater. At least 2. Indian Drum, 2007, Joan “When our kupuna pass away, president Hiko‘ula Hanapï sug- several are shown in the exhibit. Staple-Baum, Chippewa, acrylic the iwi is infusing the ‘äina with gests this itinerary for visitors For more information about the on stretched hide. mana,” said Chun. “Since our to the exhibit: circle the gallery exhibit, call 847-3511 or visit family comes from Waimea, my before heading to a video slide www.bishopmuseum.org. - Photos: Courtesy of Bishop 2 Musuem

3 4 Still Looking for a Meaningful Gift? Give the Gift of Higher Learning

Help to to ensure that our haumäna will receive educational opportunities for generations to come. 5 By sharing Pauahi’s vision, you will help to build scholarships through Ke Aliÿi Pauahi Foundation.

Available while supplies last for a Ornament is high quality 24K gold plating on suggested donation of $20.00 each. brass. Mounted and presented as a fine art card with envelope, sealed in a cellophane bag. Order online at 3. Hei Tiki, 2007, Stacy Gordine, Tribal Affiliation: Ngati Porou (New Zealand); carved Pauahi.org/keepsake pounamu, New Zealand greenstone. Questions? (808) 534-3966 4. Ceramic Bowl, 2007, Wi Taepa, Tribal Affiliation: Te Avawa (New Zealand) or [email protected] 5. Flax Cloak, 2007, Christina Wirihana, Tribal Affiliation: Ngati Maniapoto (New Zealand), New Zealand flax. - Photos: Courtesy of Bishop Musuem mO‘OmeHeU • CuLTuRE Ke¯Ke¯mapa2007 | 9

Isotope and trace el- stone with quarry sites on volcanic Finney says this bolsters the Full circle ement data indicate that the source islands. Using new techniques for Polynesian view that the Tuamotus New adze research rock for this basalt identifying the unique chemical functioned as a crossroads of the adze collected on composition of stone material, Pacific, a navigational way-station provides evidence of the low coral island they found that most of the ancient where ancient seafarers stopped ancient voyaging of Napuka in the tools came from all directions, to make offerings and engage in northwest Tuamotus was including the Austral Islands to the trade while transiting between round-trips obtained from Kaho‘olawe, south, the Marquesas to the North, Hawai‘i and nearby Tahiti. The 2,500 miles away. Photo: Tahiti to the west and the Pitcarin inaugural Hökülea voyage in 1976 By Liza Simon | Public Affairs Specialist courtesy Betty Lou Kam, group to the southeast. traveled this route, putting in at a Bishop Museum. Most stunning of all, nine adzes Tuamotu atoll for a brief stopover olynesian oral histories came from 2,500 miles away on before making landfall at its Tahiti describe back-and-forth Finney, a co-founder of the Kaho‘olawe. Their chemical sig- destination. Pocean-crossings between Polynesian Voyaging Society. nature was an exact match to stone Bigger mysteries remain about Hawai‘i and the ancestral home- “The significance (of the new found on the island’s western-fac- why ancient voyagers dispersed land of Kahiki, and voyaging study) is that it stands in stark ing point known as Kealaikahiki as they did on long journeys. Adze experiments by Höküle‘a and other Polynesian voy- contrast to the typical western put- — “the way to Tahiti.” Noting researcher Collerson says that his modern-day canoes have demon- aging experts hail the study because down of the technology of native in their paper that these findings newly published work affirms the strated that these journeys could they say it affirms the accomplish- people.” are consistent with a pattern of purposefulness of Polynesian mar- be accomplished in traditional ments of ancestral navigators and Scientists Kenneth Collerson travel and trade in pre-contact itime activity and will only serve to Polynesian vessels. Now, for the their traditional vessels. “Science and Marshall Weisler of Australia’s Polynesia, the researchers say bolster scientific interest in shed- first time, hard physical evidence has been inclined to dismiss University of Queensland have that the stone is from Kaho‘olawe ding more light on still unanswered has been found that seems to con- cultural streams of knowledge, published in Science Magazine but the adzes themselves are not questions. “Adze material has been firm such ancient seafaring round- including oral histories, as purely their research on 19 adzes col- carved in the Kaho‘olawe style, preserved in museums throughout trips, in the form of prehistoric romantic and instead has clung to lected by the Bishop Museum 70 “and thus may have been taken Polynesia,” he says. “With further woodworking tools, or adzes, from the notion that Polynesians simply years ago in the Tuamotus. Since as a gift or memento, as is done study, we will no doubt find even the Tuamotu Archipelago near washed up on islands by accident these coral atolls have no available today by modern traditional voy- more exciting discoveries about Tahiti made of stone traced to ori- after being blown to sea,” says supplies of stone, the research- agers…and fashioned into adzes the significance of trade and con- gins as far away as Kaho‘olawe. UH anthropology professor Ben ers set out to match the adze in the Tuamotus.” tact throughout the Pacific.”

Pikake Model, approx. 1,680 square feet, 3 bedroom 2 bath with separate bonus “Rec Room” and bath.

HAWAII’S #1 BUILDING MATERIALS DISTRIBUTOR • www.honsador .com

Ka Wai Ola Nov. 2007 edition Space deadline 10/10; Materials deadline 10/19 Wayne Lincoln Honsador Lumber [email protected] 10 | Ke¯Ke¯mapa2007 mO‘OlelO • STORIES Stories tell of protective nature of family shark ‘aumakua coastal areas of all islands. One shark grandchildren. Rudely, Papio By Claire Ku‘uleilani ‘aumakua, Ka‘ahupahau (cloak begged for a lei. Koihala refused Hughes, well cared for), lived in the dis- each request. Papio finally left to Remember your guardians, or Dr. PH., R.D. trict of Pu‘uloa. Ka‘ahupahau surf without a lei. Later, when Papio ‘aumakua. Photo: James Watt. had a brother, Kahi‘ukä (the returned from surfing, she snatched smiting tail) that was a stone in one of the lei from Koihala and n the rich oral traditions of the sand a small distance from scampered away laughing. Koihala Hawai‘i, mo‘olelo (stories) are Ka‘ahupahau’s underwater cave. was angry. Koihala took the other Itold about family ‘aumakua Ka‘ahupahau’s son, Kupïpï, lived lei to the beach to Ka‘ahupahau and (personal gods). These mo‘olelo in the water nearby. Ka‘ahupahau told Ka‘ahupahau what had hap- teach the youngest family mem- was the chiefess of all sharks in pened. Ka‘ahupahau became angry bers about the protective nature of Pearl Harbor. Ka‘ahupahau and with Papio. would protect their ‘aumakua. Family ‘aumakua her brother were born as human Meanwhile, Papio crossed the the people in perform at the most personal level beings. Then one day, a great shark channel to sun herself upon a large Pu‘uloa and in the lives of Kanaka Maoli. In god turned them into sharks. The rock. Papio stretched out on the not destroy the past, the head of the family led youthful sharks swam upstream to rock with her beautiful long hair them. Ka‘ahupahau all käne in daily prayers and offer- a place where their kahu fed them trailing in the water. Papio did also forbade flowers from shark disappear. The ings to their ‘aumakua, during ‘awa. As the sister and brother not expect Ka‘ahupahau to send being worn or carried on the waters trio returned to the cave to hear the mealtime in the hale mua (men’s sharks grew too large to swim in a shark to destroy her. Papio was of Pu‘uloa, because flowers had story of the ‘aumakua. house). Most often, the ‘aumakua the stream, food offerings were seized and killed by a young shark. caused the incident. Since then, An older brother lay on the take earthly forms of animals such brought to the lochs in the harbor. Papio’s blood spewed onto the the people of the district and the beach, he appeared lifeless. as the shark, owl, hawks, ‘ele- Papio, a pretty girl, used to surf at nearby shore, staining the soil red, sharks in the Pu‘uloa lochs have The brother’s eyes opened, and paio, rocks, eels, etc. Family kahu Keahi, a place between Pu‘uloa and as it remains today. Once her anger been the best of friends. he whispered, “Bring ‘awa and (keepers) are responsible for the Kalaeloa. One day she met an older had subsided, Ka‘ahupahau was Another story took place in bananas.” Confused, the uncle daily care as well as taking food relative of Ka‘ahupahau’s, Koihala, filled with remorse. Ka‘ahupahau Ka‘ü. It was pouring rain and little stood. The eyes opened again, the and gifts to the ‘aumakua. who was stringing lei of kou, ma‘o declared that from that day for- Kawena asked for nenue (fish) words were repeated. “Quickly,” Shark ‘aumakua live in the and ‘ilima blossoms for her beloved ward, all sharks in her domain to eat. Her mother said that was was added. The uncle ran off to get impossible, as heavy rains pre- the food. When he returned, his vented fishing. Soon, an aunt came brother had pulled himself up on Define your world to visit and found the child crying the rocks. The brother called out, quietly. The aunt had a solution. “Wait, O my guardian! The boy Path to Hand in hand and dressed in rain- has gone for food.” Uncle helped coats, the two made their way his brother take the food out on Nursing at down to an uncle’s shoreline cave. the rocks to deeper water. “Oh, When her uncle heard the little my guardian, come! Here is ‘awa WCC girl’s wish, he said her wish would to drink! Here are bananas! Come be granted. The uncle climbed up and eat.” CNAgLPNgRN on the rocks above his home and Suddenly a large shark appeared WCC’s Employment Training stood looking out over the bay. just below the rocks. ‘Awa was Center is teaming up with KCC He just stood there. Soon the rain carefully poured into the shark’s to offer students an academic stopped and sunlight fell upon the open mouth. Then, peeled bananas pathway from CNA to nursing man, who kept standing upon the were carefully fed, one by one, at the Windward Community rocks. Why didn’t he do some- to the shark. “Thank you, O my College campus. thing? Why didn’t he get her fish? guardian!” “Today you saved my Suddenly the man moved. Quick life. Come here to eat when you For more leaps took him down to the beach are hungry.” The older brother told information, and he waded out into the water. a tale of a squall at sea and an over- call 235-7384. The aunt and little girl arrived at turned canoe. Blinded by the rain, the water’s edge as the uncle drew he lost the canoe. Just as he thought Space is limited. Apply now his net up around some fish. The he was lost, he felt something firm for CNA session beginning uncle said, “The first one is for under him and hung on. He felt January 7, 2008. you,” as he threw the fish back himself moving and realized it Financial aid is available into the bay. A shark rose from was a shark. Uncle’s older brother for qualified students. the water and caught it. “These are always took care of the ‘aumakua. for the grandchild,” the old man Just before he died, he passed the added. He was speaking to the responsibility on to this uncle. The

1907 shark, then he turned and handed uncle said, “The ‘aumakua wanted Kawena four nenue. to eat nenue, today, so he put the University of Hawai‘i ® The little girl’s eyes were full of thought into your mind. Always Windward Supported by the Office wonder. “That is your guardian,” remember our guardian, Kawena.” Community College of Hawaiian Affairs said the uncle, as they watched the And, she did. - NU HOU • NEWS Ke¯ke¯mapa2007 | 11 ‘Aha Moku council moves forward with newly announced advisory committee

By KWO Staff Winifred “Winnie” Mano Basques, Läna‘i, is retired from ore than 100 Native Läna‘i Community Hospital and Hawaiian experts and serves on the County of Maui’s Mküpuna (elders) versed Council of Aging. She learned the in Native Hawaiian traditional fish- lawai‘a and mahi‘ai practices and ing and farming practices gathered knowledge of her ancestors from Oct. 31 and Nov. 1 in Honolulu her küpuna to discuss the nuts and bolts of Jean Ilei Beniamina, Kaua‘i, an creating a modern day ‘Aha Moku assistant professor in student ser- Council System. vices, Kaua‘i Community College. The eight members of the ‘Aha Moku advisory committee were sworn in Nov. 1. From left to right, Jean Ilei Beniamina (Ni‘ihau), Chairper- Based on pre-contact natural She is an award-winning singer/ son Vanda Wahinekuipua Hanakahi (Moloka‘i), Winifred “Winnie” Mano Basques (Läna‘i), Charles Kapua (O‘ahu), Leslie Aipalena Kuloloio resource governance in Hawai‘i, songwriter, leading organizer and (Kaho‘olawe), Timmy Paulokaleioku Bailey (Maui), Sharon Pomroy (Kaua‘i) and Hugh “Buttons” Lovell (Hawai‘i). - Photo: Courtesy of ‘Aha the ‘Aha Moku system recognizes community liaison for Hawai‘ian Moku advisory committee. the traditional geo-political divi- education and one of the founders sion of each island into ahupua‘a of ‘Aha Punana Leo, being named knowledge in planting native tress Nominees for the advisory Clubs and selected by Gov. Lingle. (akin to the present-day concept the Native Hawaiian Education to her neighbors and helps with committee, as mandated by Act The eight members of the newly of watershed areas) and moku (a Association’s 2007 Educator of plantings for the Kanuikapono 212, were nominated by the formed advisory committee were political district of two or more the Year. Charter School in Anahola. Association of Hawaiian Civic sworn in on Nov. 1. adjacent ahupua‘a). Charles William Kanaha The 24th Hawai‘i Legislature Kapua, O‘ahu, is retired from endorsed the ‘Aha Moku Council the Honolulu Police Department System with passage of Act 212, and the U.S. Army Reserve. He which Gov. Linda Lingle signed was taught the ways of mahi‘ai into law on June 27, 2007. The and lawai‘a from his grandparents, Act, among other things, creates Elizabeth and David Hoopi‘i, who A Victorian Hawaiian an eight-member advisory com- began teaching him from the age of 6. mittee to facilitate creation of the Leslie Aipalena Kuloloio, ‘Aha Moku Council System. Under Kaho‘olawe, is a cultural expert the Act, the various moku on each who believes in a simple Hawaiian Christmas Craft Fair island will select an ‘Aha Kiole, and lifestyle, which includes fish- the eight ‘Aha Kiole will form an ing and planting using natural Sunday, December 16, 2007 ‘Aha Moku Council Commission, resources found within one’s own A Victorian Hawaiian Christmas Craft Fair which will oversee the ‘Aha Moku moku boundaries. The island of Bishop Museum Great Lawn Council System and be its liaison Kaho‘olawe is part of his ancestral ������������������������� to the legislature. and cultural connections through 11:00������������������������ a.m. – 3:00 p.m. The eight members selected for both of his parents’ genealogies. ���������������������� the ‘Aha Moku advisory commit- Hugh “Buttons” Lovell, “Make & Take”ÓMake gifts & TakeÓ ★ giftsCountry * Country Store Store merchandise merchandise $5 & up$5 * & up tee are: Hawai‘i, agricultural research Handmade jewelry * Hawaiian wear * Hawaiian books * Hawaiian stuffed animals * NiØihau shells * Festival of Ornaments Vanda Wahinekuipua specialist, Research Corporation Handmade jewelry ★ Hawaiian wear ★ Hawaiian books ����������������������������������� Hanakahi, Moloka‘i, chair of the of the University of Hawai‘i, Hawaiian stuffed animals ★ Niÿihau shells ★ Festival of Ornaments committee, a community cultural Kamuela, Hawai‘i. He was raised A scholarship fundraiser of AliÔi Pauahi Hawaiian Civic Club specialist. In her childhood home, by his mother and grandparents, Mahalo to the �������������������������� Hawaiian was the spoken language John and Precious Puniwai in Free giftfor assistance wrapping in onputting all purchases on this event. and Hawaiian cultural practices Pu‘ue‘o, island of Hawai‘i (Moku were a way of life. ‘O Keawe), from whom he learned A scholarship fundraiser of Timmy Paulokaleioku Bailey, traditional planting, gathering and Ke Ali‘i Pauahi Hawaiian Civic Club Maui, a biological science techni- fishing practices. cian at Haleakalä National Park. Sharon Pomroy, Kaua‘i, Lehua He is recognized as an authority Mamo Flower Farm. One acre Mahalo to the Office of Hawaiian Affairs for assistance in putting on this event. on the relationship between Native of her six-acre farm is dedicated Hawaiian natural resources and to restoring the native forest that culture. once grew there. She offers her - 12 | Ke¯ke¯mapa2007 NU HOU • NEWS Conferences spotlight Native Education

KWO visited the National Indian Education Association Convention and asked Hawai‘i attendees:

What should be done to improve the education of Native Hawaiian children?

Edna Cathcart, Moloka‘i Teacher, DOE küpuna program All public school teachers should have some understanding of Hawai‘i’s indigenous culture. On Moloka‘i, many new teachers come here and experience a cultural shock. So the community takes it upon itself to get the teachers acclimated, but there should be more help from the DOE in training teachers about the native culture.

Wendell Ogata, Mililani, O‘ahu Social Worker, Queen Lili‘uokalani Children’s Center I would say culture-based hands-on opportu- nities in the classroom would help. Integrating Native Americans share dance and music in a powwow at the NIEA - Photo: Blaine Fergerstrom küpuna is part of this, because inter-generational activities are the key to passing on traditional knowledge to our children.

By KWO Staff “critical in restoring native cultur- Office of Hawaiian Affairs and Teddlynn Glackin, Wai‘anae, O‘ahu al identity, academic success and Kamehameha Schools, began with Office Assistant, Queen Lili‘uokalani ore than 3,000 Native healthy communities and nations.” Hawaiian and Navajo blessings Children’s Center American, Alaska Apoliona also added that many and oli. Representatives of dozens MNative and Native Native Hawaiian educators have of Indian tribes put on a powwow I think the opportunity to learn Hawaiian Hawaiian teachers and scholars made strides in raising the bar for – the first event of this type to be should be in all schools. We hear so many other gathered in October at the Hawai‘i Kanaka Maoli students. In prais- held inside the convention center. languages spoken in Hawai‘i, but why don’t schools help keep Convention Center to discuss ways ing the efforts of Hawaiian charter our language alive? The language will help us learn the culture. to increase educational opportuni- schools and the islandwide cultur- WINHEC Conference I would feel more connected to everything in my life and cul- ties for students from indigenous al enrichment programs of Nä Pua The NIEA was the second major ture, if I learn the language. backgrounds. No‘eau, she cited research show- indigenous education conference The participants in the 38th ing that children who are educated that OHA helped to stage within Dan Yahata, Käne‘ohe, O‘ahu annual convention of the National in these settings will likely be bet- a single week. A few days prior, Ho‘olako Like Program Specialist, Indian Education Association ter equipped to “contribute to the Chaminade University convened Kamehameha Schools (NIEA) tackled a range of issues, State of Hawai‘i and the Hawaiian more than 200 college tribal presi- The standardized testing that is part of “No including classroom revival of nation.” dents and Native Hawaiian educa- Child Left Behind” (federal policies) has a puni- indigenous language, reforming With an eye toward solving tion experts for an annual meeting tive nature in labeling our schools as being not successful and No Child Left Behind Federal inequities in native education, of the World Indigenous Nations this scares away those who want to go into teaching. The solu- policies and the need to train more Apoliona urged the audience to Higher Education Consortium tion is to do more to grow our own pool of Native Hawaiian teachers in cultural sensitivity. beware of ideological movements (WINHEC). OHA Education Hale teaching talent, so that those who want to contribute will be Attendees also addressed the com- that seek to dismantle native enti- Director Hau‘oli Akaka and OHA more motivated. plex factors in the relationship tlements under the guise of deliv- Education Hale Advocate Peter between indigenous cultural iden- ering homogenized or multi-racial Hanohano participated in planning Kim Timson, Makakilo, O‘ahu tity, economic poverty and poor education. “The time is now for the Chaminade conference. Teacher, Youth at-risk program in Kapolei educational outcomes. Several aboriginal, indigenous natives of Hanohano said there was “chicken We need to help young kids develop a love for workshops highlighted programs this land to unify for our collective skin” connectivity from the moment reading, which will help them over the lifespan. that aim to improve low test scores survival and for the reconciliation WINHEC opened with a gather- As for the issues with at-risk youth — when I ask and high drop-out rates, which of the needs of all native people,” ing at Mauna ‘Ala where Native my students what they want to talk about, the first thing they plague schools with mainly native Apoliona said. Hawaiian educators welcomed say is college. No one has talked to them about how they are populations. The commonalities of indig- their indigenous counterparts from going to pay for it. One thing that will cover both preschool and Speaking at the conference, enous people were openly cel- around the Pacific and the U.S. adolescents is teaching the old Hawaiian values. This means OHA Chairperson Haunani ebrated at the NIEA convention. continent with a special oli. you take responsibility for yourself and the things you learn on Apoliona underscored the need The weeklong event, which was a daily basis. for culture-based education as sponsored with funding from the See education on page 13 Dem?YWdijWo_djekY^X[YWki[?gkWb_\o$ M_j^CeX_F9IWdZ<[Z[hWbB_\[b_d[%B_daKffhe]hWci" >WmW__\Wc_b_[iWh[demWXb[jeijWoYedd[Yj[Z$ Kahu Kamuela Chun chants Oli Komo at the entrance to Mauna Ala, joined by WINHEC coordina- tor Dr. Claire Pruett, (left) of Chaimnade University, event coordinator Bob Worthington, (right) gkWb_Ó[ZYkijec[hih[Y[_l[0 and CUH Hawaiian Civic Club members bearing ho‘okupu. - Photo: Blaine Fergerstrom '+E<< .$(+E<< d[mWYj_lWj_ed cedj^bofbWdiijWhj_d]Wj*& Hanohano said, adding: “For one f^ed[i education week, Hawai‘i was enriched by ijWhj_d]Wj  Continued from page 12 the presence of so many indig- */ OekcWoX[[b_]_Xb[ C[Z_YW_Z enous educators and scholars com-

l Ikffb[c[djWbI[Ykh_jo?dYec[ _

WINHEC) shared the idea that a from one another.” i m_h[b[iii[hl_Y[_\ c

_ j e Bem?dYec[>ec[;d[h]o7ii_ijWdY[Fhe]hWc  Y deep sense of spirituality belongs For more information on either e $ k i oekfWhj_Y_fWj[_d in education, but is often missing of the conferences that came and h Y <[Z[hWbFkXb_Y>eki_d]7ii_ijWdY[ehI[Yj_ed.  !B_\[b_d[%B_daKf f i _ j in schools,” said Hanohano. went during October, go to the e X ed[e\j^[\ebbem_d] h e DWj_edWbIY^eebBkdY^Fhe]hWc [ c OHA’s Education Hale put in OHA website or check out the i j š i_ J[cfehWho7ii_ijWdY[\ehD[[Zo

Now Accepting Applications!

Imagine a New Career at Hawai‘i Technology Institute Full scholarships & tuition assistance available for qualifying Native Hawaiians who want to pursue new careers: Medical Assistant | Pharmacy Technician Office Technology Management Day & Evening Classes Internship & Job Placement Assistance

Accredited by ACCSCT | Grants, scholarships and tuition assistance provided by Kamehameha Schools, Office of Hawaiian Affairs, ALU LIKE Inc., and Native Hawaiian Education Act funds to qualifying applicants. T: 522-2700 www.hti.edu [email protected] 629 Pohukaina Street, Honolulu, HI 96813 Dr. Kalani Brady, an associate professor of Native Hawaiian health at the UH organization created in 1988 under a federal mandate to improve native health Some have formed Kalama Kukui, a new support organization at the UH medi- medical school. “Western medicine’s heavy emphasis on clinical measures can in Hawai‘i, says that the high costs of medical malpractice insurance and the cal school for indigenous students from Hawai‘i and throughout the Pacific. “reduce a person to his or her biology,” notes Brady, while traditional Hawaiian lack of affordability of high-tech medical specialties care are challenging both Natalie Kong organized Kalama Kukui after returning from an international medicine “took into consideration the spirit or na‘au‘au of the person.” Brady family doctors and small hospitals to stay in business. This is especially so in conference in New Zealand that highlighted health as an empowering and calls the extreme social isolation of Hansen’s Disease patients in Hawai‘i a rural and neighbor island communities, where the state’s Native Hawaiians politicizing factor in the lives of the world’s indigenous populations. “We want “blazing example of bad outcomes from a lopsidedly Western approach” and live in high concentration and are more likely to be underinsured or uninsured. to get the word out that just because you are from Nänäkuli, doesn’t mean you part of a long, sad history that has contributed to Native Hawaiian dis- “There has always been a direct correlation between the disparities in health won’t even go to med school,” says Kong. comfort with standard medical practice. status and social and economic struggles,” says Spoehr. “For Hawai‘i’s sake, As part of walking the talk, the Kalama Kukui will soon be supporting a Healing Natalie Kong recalls that sense of discomfort a young child, we need to make sure that the state’s economy can sustain Hawai‘i’s first mentoring project that pairs Native Hawaiian medical students with middle- when her family took her to see doctors at the only health people.” schoolers from several island schools. Some UH med students will be doing center that served the Waimänalo Hawaiian Homestead However, Spoehr is heartened by what he calls the “wellness awareness” all this, just as they prepare to take their first round of medical boards at the land, where she grew up. “It seemed like a dark, neglected, of a younger generation of Native Hawaiians. “Think back to marathon races end of their second year. scary place,” she says, adding that she often went there or health fairs 20 years ago. How many Hawaiians would participate in those Ironically, many are discovering that the time they put into medical studies with family members who were suffering from what she events back then? Today, the numbers are way up.” isolates them from the people they dream of serving someday. “When your terms “the typical Hawaiian diseases” including cancer. Spoehr adds that the entry of more Hawaiian youths into medicine has family and friends want you to go to dinner with them, you can’t just up and “Someone has got to change this, I thought. And one day coincided with policies to improve. Access to care, health advocacy and educa- leave,” says Kapua Medeiros, explaining that her focus for the time being is I just blurted out, ‘I’ll be a doctor.’ ” tion for Native Hawaiians during the last two decades. It is also ensuring that brain surgery. “We’re into the new unit on neuroscience. Cranium nerves are Kong’s parents supported her ambition, but they also told health-care institutions pay more attention to “cultural competency.” Cultural just so intricate,” she marvels. native her that she would have to look for scholarship help, because competency is the official policy term/buzzword for the effort to match cultural To make sure she doesn’t lose touch with her roots, Natalie Kong recently they wouldn’t be able to afford tuition. Then as an undergrad at values of medical practitioners and patients, now a requirement under govern- enrolled in a lä‘au lapa‘au course under the direction of a local kumu. “I was University of Hawai‘i at Mänoa, Kong split her major between ment regulations. feeling like I couldn’t give it the attention it deserved so I wanted to withdraw, pre-med and music — unwittingly putting herself at a disad- All of these developments correlate with noticeable trends toward reduced but (the kumu) talked me down. In the Hawaiian way of thinking, once you vantage in the tight competition to get into the UH medical rates of chronic disease in younger Native Hawaiians — even if the statistics start something, you must finish.” school, which accepts only 55 out of 1,900 applicants a year . This seem stubbornly stalled, “Because health problems often change over the lifes- Kong says she also draws strength from Hawaiian values in staying on By Liza Simon | Public Affairs Specialist lives is where ‘Imi Ho‘öla came to Kong’s rescue. pan of a generation, it can sometimes take 20 years for improvements in health course for the career of service that awaits her. “There is a sense of kuleana in The ‘Imi application process involves jumping through several hoops care to show up in the data,” Spoehr says. Hawaiian culture. If I believe that health matters most, then I will do what I — tests, interviews and essay writing, plus the lining up of financial aid pack- In the meantime, the Native Hawaiian alums of ‘Imi Ho‘öla are even going can to make sure I can care for others this way.” hen medical student Natalie Kong shadows physicians on hospital ages that are not provided directly by ‘Imi Ho‘öla. But all this work is nothing beyond the call of the usual eight hours a day of study time to make sure that rounds, more than a few patients do a double-take and tell her that she compared to the challenge of being in the program, which uses an innovative the medicine they practice will be better than what their par- ents might have known. Wresembles a favorite niece, or maybe a cousin or grand-daughter. This “problem-based learning” curriculum. This means students collaborate in ents might have known. is a good thing, says the soft-spoken 30-year-old. small groups to diagnose complex “paper cases.” “People are sometimes much more trusting, if they believe you are con- “You and your group have to figure out the best possible conclusion, nected to them. The more I can help patients open up, the more I can get given what everyone brings to the table. It’s hard, because no one tells you information that will help in making a good decision,” says Kong. that you have to accept a certain belief, but this is what it’s like in the real Kong’s experience underlines one of the main aims of ‘Imi Ho‘öla. The world of medicine.” post-baccalaureate program, which Kong attended, cherry-picks applicants “ ‘Imi nurtures you as a person but it is no joke when it comes to the rigor,” from disadvantaged backgrounds who demonstrate that they have excellent agrees Kapua Medeiros, 26, who also graduated from the 2005 ‘Imi program minds for the healing arts as well as heartfelt commitment to the medically and joins Kong as one of the banner number of Native Hawaiians now in the underserved Hawai‘i and Pacific communities that they call home. second year at the UH medical school, where she also is a teaching assistant Known to help less-than-impeccable academic performers live up to their for an ‘Imi anatomy class, helping newcomers brave their first lessons in the genuine potential, the program launches students into the University of dissection of a cadaver. Hawai‘i’s John A. Burns School of Medicine — where ‘Imi alums have acquit- “Coming here, I was ready for anything, even though I didn’t look good ted themselves well with a 77 percent graduation rate and career choices that on paper,” says Medeiros, who graduated at the top of her Kamehameha class have taken them back to their roots, as promised. but then struggled to maintain a decent G.P.A. as a biochemistry major at the “(Our ‘Imi students) are carefully screened for their personal qualities. The Ivy League’s Dartmouth College in Hanover, New ones who get in have altruistic motives for studying medicine. They aren’t Hampshire. training to do cosmetic surgery in Beverly Hills,” says Chessa DeCambra, an The fierce academic competition might have ‘Imi Ho‘öla Program Assistant. dampened the spirits of a less determined student, While the program doesn’t apply racial or ethnic criteria in selecting disad- but Medeiros, who also grew up on Hawaiian vantaged students, nearly half of its 417 graduates since 1975 have Hawaiian Homestead land, the daughter of a Kaua‘i fireman, ancestry. Kong was among four Native Hawaiians from the 2005 ‘Imi program in Anahola, had already demonstrated a remarkable who are in the UH medical school class of 2010, which has an overall enroll- aptitude for mixing the lä‘au lapa‘au of her ancestors ment of 16 students of Native Hawaiian ancestry — a number that is not with advanced lab science. While still in high school, only unprecedented in Hawai‘i’s only medical school but is also noteworthy she developed a way to extract an anti-cancerous because it may help to offset what has historically been an under-representa- compound from papaya seeds and won a national tion of Native Hawaiians in top-flight medical professions. science prize for the project. “I considered becoming The continuing success of ‘Imi Ho‘öla and related scholarship assistance a researcher in natural products, but this would have programs comes at a critical juncture. While the federally-mandated Native required being tied to a research institution some- Hawaiian Healthcare Systems are in place to improve wellness education and where far away from the Native Hawaiian popula- access to care, the state’s indigenous population continues to experience dis- tion, where I want to share my work,” she says. proportionately high rates of chronic diseases — notably cancer, diabetes and Notwithstanding their passion to serve their own cardiovascular disease. communities, ‘Imi Ho‘öla’s Native Hawaiian stu- The relationship between health and ethnicity is a complex matter, but it is dents may find in the future that they are up against clear that the disparities in native health status need to be addressed by physi- some greater ailments in the national healthcare cians who can balance Western medical practice with Hawaiian values, says system. Hardy Spoehr, Director of Papa Ola Lökahi, an Dr. Kalani Brady, an associate professor of Native Hawaiian health at the UH organization created in 1988 under a federal mandate to improve native health Some have formed Kalama Kukui, a new support organization at the UH medi- medical school. “Western medicine’s heavy emphasis on clinical measures can in Hawai‘i, says that the high costs of medical malpractice insurance and the cal school for indigenous students from Hawai‘i and throughout the Pacific. dr. benjamin b.c. Young “reduce a person to his or her biology,” notes Brady, while traditional Hawaiian lack of affordability of high-tech medical specialties care are challenging both Natalie Kong organized Kalama Kukui after returning from an international medicine “took into consideration the spirit or na‘au‘au of the person.” Brady family doctors and small hospitals to stay in business. This is especially so in conference in New Zealand that highlighted health as an empowering and r. Benjamin B.C. Young, who would calls the extreme social isolation of Hansen’s Disease patients in Hawai‘i a rural and neighbor island communities, where the state’s Native Hawaiians politicizing factor in the lives of the world’s indigenous populations. “We want eventually become the first psychiatrist “blazing example of bad outcomes from a lopsidedly Western approach” and live in high concentration and are more likely to be underinsured or uninsured. to get the word out that just because you are from Nänäkuli, doesn’t mean you Dof Native Hawaiian ancestry, was com- part of a long, sad history that has contributed to Native Hawaiian dis- “There has always been a direct correlation between the disparities in health won’t even go to med school,” says Kong. pleting his medical residency at the University comfort with standard medical practice. status and social and economic struggles,” says Spoehr. “For Hawai‘i’s sake, As part of walking the talk, the Kalama Kukui will soon be supporting a of Hawai‘i back in 1973, Natalie Kong recalls that sense of discomfort a young child, we need to make sure that the state’s economy can sustain Hawai‘i’s first mentoring project that pairs Native Hawaiian medical students with middle- when he received an inter- when her family took her to see doctors at the only health people.” schoolers from several island schools. Some UH med students will be doing esting request from then- center that served the Waimänalo Hawaiian Homestead However, Spoehr is heartened by what he calls the “wellness awareness” all this, just as they prepare to take their first round of medical boards at the UH medical school dean land, where she grew up. “It seemed like a dark, neglected, of a younger generation of Native Hawaiians. “Think back to marathon races end of their second year. Dr. Terrance Rogers: Train scary place,” she says, adding that she often went there or health fairs 20 years ago. How many Hawaiians would participate in those Ironically, many are discovering that the time they put into medical studies more Native Hawaiian phy- with family members who were suffering from what she events back then? Today, the numbers are way up.” isolates them from the people they dream of serving someday. “When your sicians; There were only terms “the typical Hawaiian diseases” including cancer. Spoehr adds that the entry of more Hawaiian youths into medicine has family and friends want you to go to dinner with them, you can’t just up and nine licensed to practice “Someone has got to change this, I thought. And one day coincided with policies to improve. Access to care, health advocacy and educa- leave,” says Kapua Medeiros, explaining that her focus for the time being is at the time. Young began I just blurted out, ‘I’ll be a doctor.’ ” tion for Native Hawaiians during the last two decades. It is also ensuring that brain surgery. “We’re into the new unit on neuroscience. Cranium nerves are to tailor special pre-med science classes for this Kong’s parents supported her ambition, but they also told health-care institutions pay more attention to “cultural competency.” Cultural just so intricate,” she marvels. purpose. He also needed to name the new pro- her that she would have to look for scholarship help, because competency is the official policy term/buzzword for the effort to match cultural To make sure she doesn’t lose touch with her roots, Natalie Kong recently gram. So he turned to his colleague and noted they wouldn’t be able to afford tuition. Then as an undergrad at values of medical practitioners and patients, now a requirement under govern- enrolled in a lä‘au lapa‘au course under the direction of a local kumu. “I was Hawaiian scholar Mary Kawena Pukui for help. University of Hawai‘i at Mänoa, Kong split her major between ment regulations. feeling like I couldn’t give it the attention it deserved so I wanted to withdraw, She reflected on the aims of the program and pre-med and music — unwittingly putting herself at a disad- All of these developments correlate with noticeable trends toward reduced but (the kumu) talked me down. In the Hawaiian way of thinking, once you came back to him with ‘Imi Ho‘öla: it means vantage in the tight competition to get into the UH medical rates of chronic disease in younger Native Hawaiians — even if the statistics start something, you must finish.” “those who seek to heal.” school, which accepts only 55 out of 1,900 applicants a year . This seem stubbornly stalled, “Because health problems often change over the lifes- Kong says she also draws strength from Hawaiian values in staying on An apt name it turned out to be, said Young, is where ‘Imi Ho‘öla came to Kong’s rescue. pan of a generation, it can sometimes take 20 years for improvements in health course for the career of service that awaits her. “There is a sense of kuleana in who nurtured Imi Ho‘ola’s growth at UH where The ‘Imi application process involves jumping through several hoops care to show up in the data,” Spoehr says. Hawaiian culture. If I believe that health matters most, then I will do what I he has been Vice President of Student Affairs — tests, interviews and essay writing, plus the lining up of financial aid pack- In the meantime, the Native Hawaiian alums of ‘Imi Ho‘öla are even going can to make sure I can care for others this way.” and Dean of Medical Students – in addition to practicing psychiatry in Honolulu. “You have hen medical student Natalie Kong shadows physicians on hospital ages that are not provided directly by ‘Imi Ho‘öla. But all this work is nothing beyond the call of the usual eight hours a day of study time to make sure that ‘Imi Moments: (Top) ‘Imi Ho‘¯ola Alumnae and second year UH med students Natalie Kong and Kapua Me- to know the culture of the people you treat in rounds, more than a few patients do a double-take and tell her that she compared to the challenge of being in the program, which uses an innovative the medicine they practice will be better than what their par- “problem-based learning” curriculum. This means students collaborate in ents might have known. deiros on a break from their busy study schedule. (Bottom) Dr. Ming Tim Sing (standing) leads a lively order to contribute to their well-being,” Young Wresembles a favorite niece, or maybe a cousin or grand-daughter. This discussion group of ‘Imi Ho‘¯ola students. (Seated from left) Kanoe-lehua de Silva, Leah Wang, Seabrook Mow, small groups to diagnose complex “paper cases.” explained, adding that culture, spirit and health is a good thing, says the soft-spoken 30-year-old. Nicole Baumhofer. - Photos: Blaine Fergerstrom are “all linked together.” “People are sometimes much more trusting, if they believe you are con- “You and your group have to figure out the best possible conclusion, Young reels off an “honor roll” of illustrious nected to them. The more I can help patients open up, the more I can get given what everyone brings to the table. It’s hard, because no one tells you local MDs who are ‘Imi Ho‘öla alumni. This leads information that will help in making a good decision,” says Kong. that you have to accept a certain belief, but this is what it’s like in the real SO yOu waNt tO Be a DOctOr… him to tell a story about a vacuum cleaner sales- Kong’s experience underlines one of the main aims of ‘Imi Ho‘öla. The world of medicine.” Resources for Native Hawaiians: man who came knocking at his door in 1973, just post-baccalaureate program, which Kong attended, cherry-picks applicants “ ‘Imi nurtures you as a person but it is no joke when it comes to the rigor,” For more information on as ‘Imi Ho‘öla was getting off the ground: “When from disadvantaged backgrounds who demonstrate that they have excellent agrees Kapua Medeiros, 26, who also graduated from the 2005 ‘Imi program I told him what I did for a living, he said, ‘I think minds for the healing arts as well as heartfelt commitment to the medically and joins Kong as one of the banner number of Native Hawaiians now in the ‘Imi Ho‘öla: (808) 692-1030 my daughter would like to study medicine.’ ” underserved Hawai‘i and Pacific communities that they call home. second year at the UH medical school, where she also is a teaching assistant Next application deadline: Young offered to help. The salesman’s daughter Known to help less-than-impeccable academic performers live up to their for an ‘Imi anatomy class, helping newcomers brave their first lessons in the Jan. 11, 2008 turned out to be Chiyome Leina‘ala Fukino. genuine potential, the program launches students into the University of dissection of a cadaver. The Kamehameha grad attended the ‘Imi Ho‘öla Hawai‘i’s John A. Burns School of Medicine — where ‘Imi alums have acquit- “Coming here, I was ready for anything, even though I didn’t look good program, graduated from UH medical school ted themselves well with a 77 percent graduation rate and career choices that on paper,” says Medeiros, who graduated at the top of her Kamehameha class ON the weB and established a busy practice as a Honolulu have taken them back to their roots, as promised. but then struggled to maintain a decent G.P.A. as a biochemistry major at the Pre-med advising pediatrician before taking up her current post as “(Our ‘Imi students) are carefully screened for their personal qualities. The Ivy League’s Dartmouth College in Hanover, New Professions Advising Center (PAC) the Director for the Hawai‘i State Department of ones who get in have altruistic motives for studying medicine. They aren’t Hampshire. www.advising.hawaii.edu/artsci/pac Health – the first woman and Native Hawaiian to training to do cosmetic surgery in Beverly Hills,” says Chessa DeCambra, an The fierce academic competition might have be appointed to the position. ‘Imi Ho‘öla Program Assistant. dampened the spirits of a less determined student, UH John A. Burns School Young recently decided to search for the While the program doesn’t apply racial or ethnic criteria in selecting disad- but Medeiros, who also grew up on Hawaiian of Medicine (JABSOM) identity of the first-ever Native Hawaiian physi- vantaged students, nearly half of its 417 graduates since 1975 have Hawaiian Homestead land, the daughter of a Kaua‘i fireman, cian. This led him to Hastings, England, and ancestry. Kong was among four Native Hawaiians from the 2005 ‘Imi program in Anahola, had already demonstrated a remarkable http://jabsom.hawaii.edu the records of Dr. Matthew Manuia Makalua, who are in the UH medical school class of 2010, which has an overall enroll- aptitude for mixing the lä‘au lapa‘au of her ancestors who obtained a medical degree from Hastings ment of 16 students of Native Hawaiian ancestry — a number that is not with advanced lab science. While still in high school, For financial aid to JABSOM College in 1882 at the behest of King David only unprecedented in Hawai‘i’s only medical school but is also noteworthy she developed a way to extract an anti-cancerous www.hawaii.edu/fas Kaläkaua. Young says Makalua was never able because it may help to offset what has historically been an under-representa- compound from papaya seeds and won a national science prize for the project. “I considered becoming to return home because of the overthrow of the tion of Native Hawaiians in top-flight medical professions. For more information on the Native Hawaiian Kingdom, but he distinguished him- The continuing success of ‘Imi Ho‘öla and related scholarship assistance a researcher in natural products, but this would have Hawaiian Health Scholarship Program self in England where he assisted the founder programs comes at a critical juncture. While the federally-mandated Native required being tied to a research institution some- www.nhhsp.org of some modern surgical methods – Sir Joseph Hawaiian Healthcare Systems are in place to improve wellness education and where far away from the Native Hawaiian popula- Lister. This is a story that Young will share in access to care, the state’s indigenous population continues to experience dis- tion, where I want to share my work,” she says. Association of Native a book he is currently writing on the history of proportionately high rates of chronic diseases — notably cancer, diabetes and Notwithstanding their passion to serve their own Hawaiian Physicians Native Hawaiians in medicine. Of course, he will cardiovascular disease. communities, ‘Imi Ho‘öla’s Native Hawaiian stu- www.kauka.org devote a chapter to ‘Imi Ho‘öla. “This program The relationship between health and ethnicity is a complex matter, but it is dents may find in the future that they are up against has made a significant change in health care for clear that the disparities in native health status need to be addressed by physi- some greater ailments in the national healthcare Native Hawaiians,” he said. cians who can balance Western medical practice with Hawaiian values, says system. Hardy Spoehr, Director of Papa Ola Lökahi, an 1 | Ke¯Ke¯mapa2007 NA¯ PUke • BOOKS

me ka ‘ike leÿa i ka pöÿino o ke au kuÿuna i loko o ka ‘ike o këia wä ua höÿike ‘ia kekahi hula hou, “Ka Moÿolelo o hulihuli a me ke emi o ka heluna i mea e maopopo ai i nä känaka a ÿo Pili o Ke Ao, na Nogelmeier kanaka mäoli, a käkau pinepine puni ka honua ka waiwai o ua ‘ike ma ka päÿina hoÿopuka puke. Hiÿiakaikapoliopele” läkou, “i ‘ike läkou, nä hanauna e kuÿuna lä. ‘O nä känaka unuhi i Hoÿopuka ‘ia ‘o hiki mai ana.” këia moÿolelo, ÿo Hiÿiaka, ‘o ia Hiÿiakaikapoliopele ma ‘ekolu Hoÿomaka ‘o Hiÿiakaika- ‘o Sahoa Fukushima me Kamaoli ‘ano pukana. ‘O ka pukana hiehie By Education Hale poliopele me ka hikina ÿana mai Kuwada, a ke hana pü nei ÿo Beau loa, ua hoÿopaÿa ‘ia me ka ‘ilikao o Pele mä i Hawaiÿi a me ka Bassett, a me ‘Emalani Case i nä lahilahi a hoÿokomo ‘ia nä puke äkaukau ka moÿolelo huakaÿi moeÿuhane a Pele e ‘imi i papahana hou. Aia me läkou nä ÿelua i ka pahu liÿulä ‘ömaÿomaÿo. o Hiÿiakaikapoliopele kahi ipo. Helupapa ‘ia nä mähele käkoÿo, ‘o Aloha Knaefler, Mälie Hana ÿia ‘ekolu haneli o ia külana, Mno ka lehulehu a no nä like ÿole o ka huakaÿi a Hiÿiaka Goodhue, a me Dee Dee Doi. a ua manaÿolana ‘ia e waiho ‘ia ana känaka puni i ka moÿokalaleo, ma ke kiÿi ‘ana i ua ipo lä, ‘o Ma ka päÿina hoÿolaha o ka ua mau puke ma nä hale waihona ka möÿaukala, a i ka moÿomeheu Lohiÿau kona inoa, a hoÿäkäka ‘ia Hui Paÿi Puke ‘o Awaiaulu ma puke a me nä kula nui hanohano o Hawaiÿi. ‘Akahi a hoÿopuka ‘ia e nä hakakä me nä moÿo a me nä Awaiaulu, ka home o Näkila läua ke ao nei i mea e höÿike i ka maiau ka Hui Paÿi Puke ‘o Awaiaulu a weliweli like ‘ole, a me ka hopena ‘o Marti Steele kahi i kapa ÿia a me ka maikaÿi o ka ‘ike Hawaiÿi, ua unuhi ‘ia këia mau ‘aoÿao mai pöÿino o ua ipo ala. Ma awaiulu. ai ka inoa o ka hui paÿi puke, ka moÿokalaleo Hawaiÿi, a me ka ka ‘ölelo kanaka ma nä nüpepa org këia hulikoÿa: “He moÿolelo ua höÿike ‘ia ka poÿomanaÿo o hoÿoilina manomano o nä Hawaiÿi kahiko mai a i ka ‘ölelo Pelekania pili kanaka ia o ke aloha a me ke ka hanana, “Ma o ke kuilima o i ke ao nei. Aia kekahi külana aÿe e Kauka Puakea Nogelmeier me kuko, ka lili a me ka pono kaulike, kekahi i kekahi, kükulu käkou i ma ka wahï liÿulä ‘ömaÿomaÿo no käna püÿulu hui unuhi a loaÿa a ua piha i nä akua, nä kupua, uapo ikaika.” He wahi küpono nö ke kumu küÿai $300. Liÿiliÿi iho ke këia momi linohau he ‘elima nä aliÿi a me nä makaÿainana.” ia, no ka mea, na Näkila i hana pü külana maÿamau no nä hale küÿai The Epic Tale Of haneli mau ‘aoÿao ka löÿihi. Ua pena kupaianaha ‘ia nä kiÿi me Puakea e hoÿomaka i ua papa- puke, he ÿili paÿa ma ke kumu Hi‘iakaikapoliopele He höÿike ua hoÿokö ‘ana lä i no ia puke e ke kanaka päheona hana nei a e kükulu i ua “ ‘uapo” i küÿai küpono no ka lehulehu, he Text & Translations by ka ‘iÿini a me ka manaÿolana o ‘öpio ‘öiwi, ‘o Solomon Enos no pani no ke köä ma waena o ka ‘ike $40 no nä puke päkahi. Loaÿa ma Puakea Nogelmeier nä känaka Hawaiÿi o ke au i hala Waiÿanae mai. möÿaukala a me ka ‘ike o ka poÿe nä pukana ‘ekolu nä kiÿi miomio e mälama i nä moÿolelo a me nä ‘O ka pahuhopu o ka papa- o këia wä. a ua paÿi ÿia läkou a pau ma ka Illustrations by kaÿao kupuna i hoÿoilina no nä hana, wahi a ka luna kuhi- Waiwai a piha nä moÿolelo o ‘ölelo Hawaiÿi a me ka Pelekania. Solomon Enos hanauna e hiki mai ana. E like me kuhi ‘o Nogelmeier, ‘aÿole ka Hiÿiaka i nä mele a me nä hula. ‘O këia puke hoÿokahi o nä mana Awaiaulu Press kä Kauka Nogelmeier i ÿölelo ai, hoÿohanohano o ka moÿokalaleo E hiki ana i nä kumu hula a he ‘umi a ÿoi o ka moÿolelo no www.awaiaulu.org “ ‘O Hawaiÿi wale nö ke aupuni Hawaiÿi wale nö, akä, ‘o ke ‘ailolo me nä känaka ‘ë aÿe ke huli a Hiÿiaka a he mähele nö ia o ka Päkïpika näna i noho küÿokoÿa a ‘ana i känaka e hiki ai ke lilo ‘o loaÿa ua mau mele a höÿike i hula hoÿokahi päkëneka wale nö o nä ÿaneÿane i ka hopena o ke keneku- läkou nä poÿe hoÿokumuwaiwai no ka lehulehu ma nä wahi like mea i ‘unuhi ‘ia no ka lehulehu. Ua lia ‘umikümäiwa a i hiÿipaka i näna e “Kükulu i uapo e ‘auamo i ‘ole e like me ka Meli Manaka hoÿopuka ‘ia këia mana ‘o Hiÿiaka känaka puni moÿokalaleo me ka ka ‘ike Hawaiÿi mai ka wä kahiko a me ka Hoÿokükü Hula a Oli na Hoÿomähiehie mai ka makahiki hiki ke heluhelu puke a ke käkau a i këia wä a i nä hanauna o mua ‘o Kamehameha. Eia hou kekahi, 1905 a i ka makahiki 1906 ma ka hoÿi. No këlä me këia hanauna, ua aÿe nei,” i ‘ölelo ai ‘o Nogelmeier. ‘oiai ua paÿakikï ka huli ‘ana i ua nüpepa ‘o Ka Na‘i Aupuni. Mahalo hoÿopalapala läkou i ko läkou ‘ike ‘Aÿole läkou e paÿi ana i puke wale ‘ike ma mua, e hoÿoulu ana nö ua iä Awaiaulu no këia hana poÿokela kuÿuna a me ka möÿaukala. Ua nö mai nä nüpepa kahiko mai, akä, mau ‘ike i ka haku mele hou ‘ana a ma ka hoÿopuka pukemoÿokalaleo hana läkou pëlä me ka noÿonoÿo a aia läkou ke hoÿohui nei i ka ‘ike me ka haku hula hou ‘ana I laÿana, Hawaiÿi.

spirit’s search for a lover. The trainees, it is hoped, will become party held at Awaiaulu, the home “The Epic Tale of saga recounts Hiÿiaka’s errand to the resource people who can of Näkila and Marti Steele and fetch Pele’s match in Lohiÿau and “bridge that Hawaiian knowledge source of the project’s name, the graphically depicts the encoun- from the past to the present and theme was “Connecting with one Hiÿiakaikapoliopele” ters with moÿo and other inhospi- the future.” Because it will take a another, we build strong bridg- table forces, the quest to retrieve long time, “our bridge has to span es.” It was an appropriate site he epic saga of Nogelmeier states, “Hawaiÿi, the Lohiÿau from death, and the inevi- generations,” says Nogelmeier. for the occasion since Näkila was Hiÿiakaikapoliopele is now only nation in the Pacific to remain table tragedy befalling him. In the They are not just making new the primary force in encouraging Tavailable for all aficionados independent through most of the awaiaulu.org website description, books out of old material but also Nogelmeier to produce this proj- of Hawaiian literature, history and 19th century, fostered a complete- “It is a very human account of love reintegrating older knowledge into ect and to build that “bridge” to culture. Produced by Awaiaulu ly literate population who loved to and lust, jealousy and justice, peo- what we know today and to let close the gap between historical Press, these pages of text from old read and write. For generations, pled with deities, demons, chiefs people here and around the world knowledge and the knowledge of newspapers have been translated they carefully documented their and commoners.” It is wonderfully know what that knowledge por- people today. from Hawaiian into English by Dr. cultural knowledge and history. illustrated in color by the young trays. The translators who worked The Hiÿiaka stories are rich Puakea Nogelmeier and a team of They did so with intention, fully but accomplished Hawaiian artist on Hiÿiaka are Sahoa Fukushima sources for chants and dances. translators to create the 500-page aware of the sweep of change Solomon Enos of Waiÿanae. and Kamaoli Kuwada, and they’ve The knowledge found within them masterpiece. and their diminishing popula- The goal of the project, says now been joined by Beau Bassett, will enable kumu hula and others This literary accomplishment tion, often stating that “those in director Nogelmeier, was not only and ‘Emalani Case on new proj- to give voice and form to these reflects the aspiration and fore- the future will need to know.” to present the best in Hawaiian ects. Support staff include Aloha chants and stories for public appre- sight 19th century Hawaiians had Hiÿiakaikapoliopele begins literature but also to train fluent Knaefler, Mälie Goodhue and Dee ciation through venues like Merrie to preserve the oral traditions of with the arrival of goddess Pele speakers in Hawaiian to become Dee Doi. old for future generations. As Dr. in Hawaiÿi and moves to her translators and researchers. These At the Awaiaulu Press launch See epic tale on page 19 NA¯ PUke • BOOKS Ke¯Ke¯mapa2007 | 17

HAWAIIAN HOLIDAY HOT PICKS By Liza Simon | Public Affairs Specialist s a way of saying “Mele Kalikimaka”, consider the old truism that a book is authored material for keiki of all ages (including your “inner keiki”). As one local a gift that can be opened again and again. For those in the book biz, this is the publisher put it, these are “comfort books”; they have a purpose that outlasts the Areality that turns December into primetime. Asked which Hawaiian-themed tinsel season. It also looks like local authors are obliging these tastes with a flurry of books are hot in this season of gift-giving, several local booksellers noted three main books released in the later half of this year. Ka Wai Ola highlights some of these with categories: Hawaiian history, home-based Hawaiian cultural activities and locally- an eye to helping you select the right read for Hawaiian-style booklovers on your list:

1928. He was also an avid natu- “Kamehameha played hard, every page contains a door, which ers, who showcase the versatility ralist and historian, as evidenced smiled wide and spent much the child opens in order to find that of kalo, suitable for any meal. Also in the thoughtful observations he of the day rushing about out of special Hawai‘i person, place or nourishing for the mind, the book recorded about everyday life on breath.”…. So begins an adven- thing that the letter stands for: So offers lovely imagery and cooking the island. Munro’s memories are ture in Lumpy Poi and Twisting it goes: “U” is for uncle; “L” is for tips plus the spice of historical accompanied by remarkable pho- Eels, that tells the story of the Longs; “C” is for…(ready for the perspectives on kalo cultivation tographs and genealogies of Läna‘i boy who would grow up to be the squeal of surprise)….cockroach! and ‘ölelo no‘eau. families plus a map complete with Conqueror of the Islands. This is Clever in a kid-friendly way, even long-forgotten Hawaiian place actually the second in what will be the illustrations seem to project The Hawaiian Quilt: The names. Perhaps the book serves an entire 12-volume Kana‘iaupuni personalities that will resonate Tradition Continues notice that “Pineapple Isle” — the Series — still a work-in-progress. with young ones and set the stage By Poakalani Serrao, John Serrao, island’s 20th century nickname — Kids will like the heroic action. for making reading as fun as this Cissy Serrao, Raelene Correia is a misnomer that belies a vibrant Teachers and parents will also fun approach to learning the ABCs Mutual Publishing Hawaiian past. Munro’s descen- enjoy these books because they — Hawai‘i style. Family members who authored dants — grandson Richard Towill offer a treasury of insights, based this book have long made quilting cultural hiStOry and great-grandson Rick Towill — on authentic Hawaiian chants, lul- Tütü Hamana: The a family affair: for more than a put the book together, intending it labies and proverbs. Shaka Sign Story decade they have sewn, sold and Kepelino’s Traditions to be a gift to the Läna‘i community. By Robert Lono ‘Ikuwä taught the art. This is their sixth of Hawai‘i Self-published volume depicting the uniqueness Edited by Martha Vaka Moana Voyages www.napuke.com of Native Hawaiian quilt-making. Warren Beckwith of the Ancestors: It would be hard to find a Hawai‘i While not a “how-to” book for the Bishop Museum Press The Discovery and youngster who doesn’t know the neophyte, it is a “must-have” for This compendium of cultural Settlement of the Pacific shaka sign. But how many know those talented types who stitch up information, authored by Kepelino, Edited by K.R. Howe the story of the shaka? It turns their patterns with passion. In giv- a descendant of the priestly line University of Hawai‘i Press out that it is a story of ‘ohana and ing the story behind each of the 68 of Pa‘ao, trains a rarifed lens The settlement of the islands of inspiration. It’s all wrapped up featured designs, the book reminds on many little known aspects of the Pacific involved the greatest with vintage photos of old Lä‘ie us that there really are no short- mid-19th century life in Hawai‘i. human migration of history. Now Kai the ‘Opihi town and delivered to keiki in a cuts to the thousands of hours it Educated by the Catholic church, the story can be told — and cer- Gets the Point slim little volume that comes with takes to reconstruct ti, ‘ulu, ipu Kepelino seemed to have an ever- tainly it is in Vaka Moana, a richly By Gail Omoto, Jan and Judy Dill a retail twist for Kanaka Maoli: or other favorite Hawaiian images curious journalist’s eye for daily woven tapestry of articles and art Self-Published The Shaka Sign story comes in with needle, thread — and spools events in recording intricacies of that testifies to the ingenuity and Here’s the plot in a nutshell… Japanese, English and Hawaiian. and spools of patience. government, cosmology, religion bravery of the world’s top naviga- er…make that a seashell: Kai is a Pickup the Hawaiian version at and social structure. (Sample his tors. Legends passed down through sad ‘opihi who struggles with his Na Mea Bookstore in Honolulu Hawaiian Massage: description of elaborate proto- generations have described the fear of the ocean. His sea creature and you will receive a 10 percent Lomilomi col involved in bringing of gifts firm intent of those who ventured friends try to help him, but it is his discount. By R. Makana Risser Chai or his savvy explanations of the into unknown seas. Now there is grandmother’s wisdom that truly Self-published Hawaiian calendar.) Originally even new scientific evidence of makes a difference. Penned by the hOMe-BaSeD activitieS Traditional Hawaiian massage published in 1932, this new reprint systemic commerce and contact director of Tütü and Me Traveling is more than skin-deep; it’s an of Kepelino’s Traditions of Hawai‘i between the people of far-flung Preschool, Kai the ‘Opihi imagi- Hawai‘i Cooks with Taro art, a spiritual practice, a prayer is highly accessible with side-by- islands in the Pacific. This volumi- natively mixes a cute character’s By Marcia Zina Mager, Muriel — according to the 35 traditional side Hawaiian-English translation nous account offers these perspec- mishaps with the comforting res- Miura, Alvin S. Huang, Ph.D. lomilomi practitioners whose heal- along with notes by Mary Kawena tives and many more, contributed cue of a kupuna. The end result Mutual Publishing ing touches are described as well as Pukui and a new introduction by by modern navigational authori- is an enjoyable read, especially if This cookbook is devoted solely artfully photographed in this book. contemporary Native Hawaiian ties including UH Anthropology you are in the habit — and a good to kalo — the life-force food of Topics covered go beyond body- scholar Noelani Arista. Professor Ben Finney and Maori habit it is — of reading to keiki. Kanaka Maoli. Sticklers for kalo work to include concepts such as Professor of Indigenous Studies eaten as two-finger poi may not lomilomi’s place in everyday fam- The Story of Läna‘i Rawiri Taonui. From Aloha to Zippy’s want to jump on board with some- ily life and in mediation (that’s By George C. Munro By Carol Cobath thing like “Poi Boats with Vanilla right, not meditation) as a way to Privately Published fOr the KeiKi Bess Press Cream Filling.” But there is bound ho‘oponopono — or settle disputes. The Story of Läna‘i offers the This gem of a little book teach- to be something to please every Rounding out the philosophy, there recollections of George C. Munro, Kana‘iaupuni Series es the ABCs by using images of palate in the more than 100 reci- is also a list of lomilomi practitio- who served as manager of the By David Kawika Eyre daily details unique to island life. pes contributed by island chefs, ners and techniques, plus historical Läna‘i Ranch from 1911 until Illustrated by Imaikalani Kalahele Making the details extra delightful, cooks, nutritionists and homemak- information. - 18 | Ke¯ke¯mapa2007 NU HOU • NEWSBRIEFS

Stender receives lineage back several generations and still The Army, which found the bomb David Malo Award practice traditional fishing and farming Nov. 1 under an internal access road, Auë, ua hala activities. Under its proposed develop- said access would not be allowed at It is with heavy hearts that we mourn the passing of Office of Hawaiian Affairs Trustee ment plan, the ranch would also provide least through Dec. 10 while it sweeps Brother Franklin Pao who died Oct. 12 and Marguerite Oswald Stender has become the 51st 26,700 acres of land for a community the area for more munitions. Kealanahele who died on Nov. 6. recipient of the West Honolulu Rotary trust and allow for the reopening of the The cancellation came a week before Brother Franklin Pao worked tirelessly to advance Club’s David Malo Award present- Kaluako‘i Hotel. In the vigorous debate the start of makahiki, traditionally a Native Hawaiian culture during a career in which he ed annually to honor the prestigious in front of the Land Use Commissioners, season for peace, sport and honoring served Saint Louis School as a mentor and registrar accomplishments by a person of some argued that the project will help the fertility god Lono. for 21 years. Pao, 72, died Oct. 12 at his Chaminade Hawaiian ancestry. boost Moloka‘i’s depressed economy, Hui Mälama o Mäkua had been residence, where he had lived in retirement for the At the awards banquet in October, while others countered that the project planning a makahiki festival at Mäkua last five years. A member of the Society of Mary, a Rotarians praised Stender for his out- would limit Moloka‘i residents’ access for Nov. 16 and 17, but instead spent Catholic religious order that founded Saint Louis School standing contributions to Hawai‘i in to water and other natural and cultural both days holding a vigil outside the and Chaminade University, he was business and for his unflagging dedica- resources that make up the island’s rural reservation’s gates with another com- noted for incorporating chant and hula tion to Native Hawaiian values. The landscape. munity group, Mälama Mäkua, and the in public and private ceremonies. He occasion was used to hail his lifetime of groups’ supporters. encouraged students and educators to accomplishments. Royal treatment EarthJustice said the groups pro- combine Native Hawaiian values with Orphaned at an early age, Stender tested the Army’s failure to remove the the spiritual teachings of the Catholic was brought up by a grandmother in More than two dozen youth from a bomb, which the Army says threatens Photo: Courtesy Church. In May, four Hawaiian royal Windward O‘ahu, where he helped Wai‘anae homeless shelter – the only public safety on Farrington Highway Chaminade societies presented Pao with a Kalani his family by fishing and making poi shelter believed to have its own hula and Mäkua Beach Park. EarthJustice University Ali‘i award, recognizing his devotion for daily sustenance. He attended hälau – were invited to ‘Iolani Palace negotiated a 2001 agreement between to Hawaiian culture. Pao held a degree Kamehameha Schools on scholarship recently for a tour, buffet and to perform the Army and Mälama Mäkua that in Hawaiian studies from the University of Hawai‘i at and graduated from the University of hula for members of the Royal Order of allows for cultural access and calls for Mänoa. He also graduated as a kumu hula under the Hawai‘i. He launched a prosperous real Kamehameha I. cleanup of unexploded ordnance pos- tutelage of John Keola Lake and was instrumental in estate career in 1958 by taking a job The Nov. 16 visit by the youth and ing a danger to the public beyond the promoting the Hawaiian studies program at Saint Louis with James Campbell Estate, where their families from Pai‘olu Kaiäulu military reservation’s boundaries. School. he worked his way to becoming Chief Transitional Homeless Shelter honored The Army said it is bound by pro- Executive Officer and a Senior Adviser the 171st anniversary of the birth of cedure and regulations before it can The sands of our birth from Hawai‘i of Keawe to to the trustees. King Kaläkaua, who built the palace detonate the bomb and it is working to Ni‘ihau of Kahelelani groan at the He also served as a Bishop Estate in 1882. restore cultural access as soon as possible, passing of Marguerite Kealanahele trustee, where he combined advocacy Friends of ‘Iolani Palace execu- within the guidelines imposed upon it. (née Ka‘onohilani) on Nov. 6 in Hilo. for broader and better Native Hawaiian tive director Kippen de Alba Chu She was the first person to place education with leadership in a move- said the majority of the families were OHA salary commission her name on the Kau Inoa registry on ment to reform the administration of of Hawaiian ancestry and most had Jan. 17, 2004, at a ceremony fronting Kamehameha Schools. never been inside the palace before. Seven members have been appointed Photo: Hailama Ali‘iolani Hale in Honolulu commem- In acknowledging Stender’s rise from “Educating our children about Hawai‘i’s to serve on the Salary Commission for Farden orating the 111th anniversary of the humble roots, Rotarians cited Stender’s monarchy is central to the mission of the trustees of the Office of Hawaiian overthrow of the Hawaiian kingdom. passion for helping others follow in his The Friends of ‘Iolani Palace and this Affairs (OHA). Mrs. Kealanahele was the wife of the late Rev. Edward successful path. The award is named kind of outreach is in keeping with By state law, a salary commission is Kealanahele. She graduated from the Kamehameha for David Malo, who in 1840 became making the palace more accessible,” he formed every four years to study and Schools in 1949 and often shared a story of how she one of the first Native Hawaiians to said. “We cannot think of a more appro- make recommendations on the salary raised her tuition by diving for coins in Honolulu produce a written history of Hawai‘i. priate way to celebrate King Kaläkaua’s for the trustees. The commission is Harbor. After graduating from high school, she went on 171st birthday than by sharing his noble comprised of seven members nominat- to the University of Hawai‘i, where she obtained a bach- La‘au Point EIS vision with his own people.” ed by Native Hawaiian organizations elor’s degree. Aunty Marge retired as a vice president The afternoon started with a and appointed by the Governor. The of Goodwill Industries and became a volunteer docent Two days of emotional testimony ho‘okupu ceremony fronting the pal- last commission was formed in 2004. at ‘Iolani Palace. before the State Land Use Commission ace and included a buffet reception at Gov. Linda Lingle appointed: She was a past president of Hale o Nä Ali‘i Hälau ‘o on Moloka‘i last month wrapped up ‘Iolani Barracks provided by the Royal • Lulani Arquette, executive director, Keli‘iahonui in Waimea, Hawai‘i, for many years. Aunty with Moloka‘i Ranch withdrawing its Order of Kamehameha I. Roundtrip Native Hawaiian Hospitality Association Marge was appointed to the rank of ‘Ikü Nahalani in the environmental impact statement for the transportation for the Wai‘anae group • Dale Bachman, third vice regent, Hale o Nä Ali‘i o Hawai‘i, the highest rank attainable planned development of 200 luxury was funded by The Friends of Iolani Daughters of Hawai‘i by a member outside the Kawänanakoa family. She was house lots at La‘au Point. A ranch attor- Palace and a donation from Abigail • Kippen de Alba Chu, executive appointed by the society’s regent, ‘Ikülani Hö‘ano Quentin ney said a revised impact statement Kawänanakoa, great-grandniece to director, Friends of ‘Iolani Palace Kawänanakoa, after the passing of Gladys Brandt. Aunty’s would be submitted at a later date. Kaläkaua. • Ray Kala Enos, policy adviser for leadership, aloha and commitment to serving Hawaiians Moloka‘i residents split over whether government affairs, Kaho‘olawe Island were beyond reproach. Aloha paumäkö. the plan adequately addresses the use Mäkua makahiki Reserve Commission Aunty Marge is survived by children Edward I. of resources in order to preserve the • Dennis Fern, fiscal manager, Kealanahele Jr., Francene Palama (Stanley), Edleen isle’s Native Hawaiian character. At A makahiki festival at Mäkua Queen Lili‘uokalani Children’s Center “Tootsie” Peleiholani, and Mekela “Miki” Asejo. Her issue is the ranch’s request to reclassify Military Reservation was canceled after • Ben Henderson, deputy director, grandchildren and great-grandchildren, according to 1,113 acres of land that would allow for a 250-pound World War II era bomb Department of Hawaiian Home Lands Aunty were her riches in life, as she often said, “All I’ve luxury development in a community was unearthed about 500 yards from asked of God was to see my mo‘opuna grow up.” where many trace their Native Hawaiian the gate to the live-fire training ground. See briefs on page 19 mai ka luna hoHAw‘okeleaiian • •from Eng lishthe adminstrator KeKe¯ke¯mapa2007 | 19

Trust and transparency; the best in interest of the beneficiaries

proposed By-laws amendment. lic. These rules are set forth in the a tyranny of the majority to the to incorrectly characterize the This was an initiative advanced State Sunshine Law. Under the detriment of the OHA Trust. If a dissemination of small grants By Clyde Namu‘o, by our Board Attorney Robert existing By-laws, until such time single Trustee chooses to make a (amount less than $25,000) as Adminstrator Klein, after discussion with the as the information or decision is confidential matter public with- “…Unfortunately, the current Trustees in executive session. no longer confidential, no Trustee out the approval of his or her OHA Chair and Administration n November 1, 2007 the Attorney Klein felt that a rule is permitted to publicly release colleagues, that Trustee may be use the trust to buy political and OHA Trustees considered was necessary to address the confidential information received found to be in breach of his or her community favors.” I challenge a proposed amendment possibly disastrous results that in executive session. fiduciary duties and be subject to the author of the email to iden- O might occur if a Trustee took it The By-law amendment pro- personal liability. Again, I had tify exactly what “favors” have to their By-laws which would require that all nine Trustees upon himself or herself to release posed by Board Counsel has little interest in this amendment been granted. All grant awards agree to release a decision or confidential information without nothing to do with “transpar- but I am glad that eight out of (large and small) are published in information that was discussed in the prior approval of their col- ency” and everything to do with nine Trustees voted in favor of OHA’s annual grant report. The executive session. This proposed leagues. His concern was based protecting the OHA Trust from passing it, because our job is to 2006-2007 report was published amendment was recommended on the fact that a similar situation exposure to third party lawsuits protect the OHA Trust in the best last week. Certainly, if I were by Board Attorney, Justice Robert occurred involving the Honolulu based upon one single Trustee’s interests of its beneficiaries even trying to hide something, there Klein. On or around November 9, City Council, which addressed personal decision to make pub- if it means standing against a would be no report published. 2007, I received a very troubling the situation with a similar rule. lic confidential information. single Trustee who would violate I have spent 37 years of my email which stated in part, “On Matters are discussed and Confidential communications the bonds of confidentiality to the career in government service and Thursday, November 1, 2007 dur- decided upon in executive ses- received in Executive Session are Trust’s detriment. this message with all of its inac- ing the OHA Board of Trustee sion because they are confiden- not by definition “transparent”, I think it is reckless to distrib- curacies and innuendos is the meeting OHA Chair Apoliona tial and must remain confidential that is, “available to the public”. ute information which is blatantly most offensive that I have had and Administrator Namu‘o as opposed to being recklessly According to the Board false. According to the individual to review. I would encourage the pushed an amendment pertain- released to the detriment of the Attorney, a waiver rule requiring responsible for posting the mes- author to please step forward. ing to the OHA Bylaws Article OHA Trust. A common reason unanimous consent at least gives sage, he received a request to If he or she has serious con- VI forward that will ‘gag, sup- for taking matters into execu- each Trustee a responsible role post the message “from someone cerns, then raise them publicly, press, and restrict’ OHA Trustees tive session is for the purpose of in deciding whether to release to who wanted to remain anony- or “transparently”. If the goal is from being transparent and held receiving privileged legal advice the public otherwise privileged mous”. This is certainly not the simply to impugn individuals and accountable to respond to benefi- from counsel. When the reason and confidential information. It courageous thing to do and casts OHA, then I doubt there will be a ciary inquiries. for discussing a matter in execu- protects the rights of a minor- serious doubt on the bona fides response and the instigator of this First, I need to be clear that I tive session no longer exists the ity Trustee to keep his or her and veracity of the unnamed unseemly message can continue had no particular interest in this matter can be released to the pub- discussions private and prevents individual. The email goes on to hide in the weeds.

in the lobby of the Hawai‘i State Art say that the delay keeps many symbol of the quality of Hawaiian briefs Museum on the corner of Hotel and people from returning to clinics Epic tale knowledge, Hawaiian literature and Richards streets. In the spirit of the for test results. This has added to the legacy contained in massive Continued from page 18 season, the window space will be concern that one-fourth of HIV- Continued from page 16 Hawaiian language archive. Orders for the Centennial Edition can be turned into a Santa-like workshop. positive individuals in the United Monarch or the Kamehameha made online at www.awaiaulu.org. Mike Loo, vice president Those scheduled to demonstrate States are unaware of their status. Hula and Chant Competition. The two-volume slipcase set is for finance and administration, their art-in-the-making include The new and faster testing Moreover, this store of previ- available in green moiré for $300. Kamehameha Schools Solomon Enos, Jodi Endicott and method is expected to increase the ously hard to access chants is A smaller bookstore edition has The commission is required to Peggy Chun. The showcase for Life Foundation’s HIV prevention sure to provide inspiration for the also been released, in hardback for submit its recommendations before local talent was organized by vol- efforts, some of which are targeted creation and the composition of $40 per volume. All editions have the 20th legislative day of the 2008 unteers from the Friends of Hawai‘i to Native Hawaiians. According to new songs and dance choreogra- the high-quality color illustrations legislative session. The recommend- State Art Museum and the operators the latest research, reported cases phies. A new song by Nogelmeier and available in both Hawaiian ed salary will take effect unless the of Na Mea Hawai‘i. Whimsically of HIV and other sexually trans- premiered at the launch, Pili O and English. This book represents Legislature disapproves of the rec- named HI-HOHOHO, the space mitted diseases are on the rise Ke Ao, is an example of that. only one of 10 versions and makes ommendation by adopting a concur- will also sell artists’ products. in Native Hawaiians in Hawai‘i. Hiÿiakaikapoliopele is available up a fraction of the only 1 percent rent resolution prior to the end of the The Life Foundation has made in three issues. The Centennial of the Hawaiian written material legislative session. The commission the new testing free and confiden- Edition, designed by the award- HIV test that is available today in transla- will be dissolved upon completion tial and also offers counseling for winning Barbara Pope, is a green tion. The Hoÿoulumähiehie ver- of its recommendations. HIV Rapid Testing is now those who believe they may be at moiré boxed two-volume collec- sion ran from 1905 to 1906 in available at Life Foundation risk for HIV. The FDA approved tor’s set bound by hand in fine the Hawaiian language newspa- of Hawai‘i and delivers results the test in 2002. Formerly avail- goatskin and moiré. Three hundred Window wonderland per, Ka Na’i Aupuni. Many kudos within 20 minutes, a big change able only at medical clinics, the of these sets were made, which will and mahalo to Awaiaulu on this Hawaiian-made gifts, goodies from the one- to two-week wait testing can now be done in other hopefully end up in libraries and milestone in Hawaiian literature and artists-in-action will be on dis- associated with other testing settings, under new health regula- universities around the globe as a play during December and January methods. Public health officials tions that took effect this year. production. - 20 | Ke¯ke¯mapa2007 ka leo kaiaulu • LETTERS TO THE EDITOR

OHA reserves the right to edit all letters for length, defamatory and libelous material, and other objectionable content, and reserves the right not to print any submission. All letters must be typed, signed and not exceed 200 words. Letters cannot be published unless they include a telephone contact for verification. Send letters to Ka Wai Ola, 711 Kapi‘olani Blvd., Ste. 500, Honolulu, HI 96813, or email [email protected].

Akaka Bill not ‘racial’ daughter Maile. How wonderful homes for Native Hawaiians is University of British Columbia may be “good for the economy,” but that even the very young keiki are also race-based and unconstitu- recently to research the Hawaiians as is often the case, what is “good When the U.S. House passed being brought along to help and to tional. working for Hudson’s Bay Co. for the economy” is bad for people. the Akaka Bill in October, I “absorb” culture and community Permit me to put their ill- Dr. Jean Barman of the watched the debate on C-Span. cooperation. As a retired teacher I designed machinations against University of British Columbia did Bill Brundage (Ka Wai Ola November issue). am so glad to read that students are the Native Hawaiians to rest by an outstanding and excellent job of Kurtistown, Hawai‘i Island I listened to Rep. Mazie Hirono an important part of the project. defining two words that go to researching this topic in the book explain the histories and culture of Claire Ku‘ulelani Hughes’ col- the heart and core of the status she co-authored entitled “Leaving End-run around courts the Hawaiian people, ending with umn “Get your money’s worth: use of Native Hawaiians: indigenous Paradise: Indigenous Hawaiians in the motto of the state of Hawai‘i. food labels” taught me a lot, thank and sovereign. Merriam-Webster the Pacific Northwest 1787-1898,” We are witnessing the break Rep. Neil Abercrombie, with a you. My experience with nutri- defines it thusly: Indigenous – pro- published by the University of down of American law in Hawaii smile, also needed to answer ques- tion is wide and varied because duced growing, or living naturally Hawai‘i Press in 2006. brought about by the Superferry. tions and repeat himself so other of physical disabilities, which are in a particular region. Sovereign I met Dr. Barman at the The U.S. constitution states that it representatives could understand. improving. – supreme in power and authority; Whatcom County Museum in is illegal for the legislative branch Many of them have set their minds Hippocrates, the so-called father having independent authority. Bellingham, Washington, in 2006, of government to overturn any against this bill using the word of modern medicine, called good All this means is that the Native where I lectured on Hawaiian his- final Supreme Court decision. “racial.” Civil rights! food the best medicine and poor Hawaiians are the “ORIGINAL” tory. Here we exchanged books: The Supreme Court has ruled The word democracy means: food the cause of disease. I cer- occupants of this land called my book “Untold Fragments of that the Superferry must do an (1) government by the people, tainly have found this to be true, Hawai‘i. And like the Alaskan Hawaiian History,” for her book EA/EIS, and environmental law majority rule; (2) government in which is why I now eat unadulter- Natives of Alaska, the Native “Leaving Paradise.” is very clear that this must be which the highest power is held by ated foods that are whole and often Indian Tribes of America; the James G.Y. Ho done BEFORE they sail. Once the people; (3) a political unit (as a organic. (Enriching is no substi- Chinese of China; the Japanese of Honolulu the Supreme Court ruled HRS nation) governed by the people. tute for 100 percent whole grain Japan; and all the indigenous, sov- 343-5 applies, it became a done Does the president of America breads, cereals, grains, etc.) ereign, ethnic races of the world Superferry, tourism deal. The state Legislature can have the power to veto any bills Fruits and veggies grown in who have their origin in their bad for Hawai‘i go and change the environmental that come out of Congress? Abuse Hawai‘i are abundant, delicious, respective “HOMELANDS,” the laws we have fought so hard to of powers is being used by many very healthful and reasonably rights and benefits accruing to them To Superferry or not to establish, but it will not apply to who have attitude problems and priced – especially at farmers’ mar- are unequivocal and undeniable Superferry? That isn’t the question. the Superferry because that case who need to check on their mental kets. I’ve become a vegetarian so I where no Man may put asunder. I was on the phone the other day has already been decided. To allow health and well-being. depend on our wonderful farmers And in the case of the Native with a friend just back from doing this private enterprise to do an The word “racial” is an adjec- in Hawai‘i to supply me with a Hawaiians, all of the foregoing errands in town. “Man, I’m getting end-run around the Supreme Court tive describing how to separate or healthful, delicious healing diet. treatise applies to them as a people to be just like you,” he said. ruling signifies the executive segregate. Aloha is the Hawaiian in their “homeland called Hawai‘i.” “What do you mean?” branch of government (Gov. Linda way of working together. We all Rev. Julie Love-Lewis So the next time you come upon “It’s so crowded and crazy out Lingle) illegally interfered in the need to respect other cultures and Honolulu the ranting and ravings of the nay- there I never want to go to town judicial branch — an impeachable work to make this world a place sayers mentioned at the beginning again!” offense. Government in essence where we all can live in peace. ‘Misguided ramblings’ of this writing remember what you One story tells it all. How many will be acting outside the law, and Thank you, Hirono and read here is the truth totally reject- “visitors” to Hawai‘i this year? by involving other agencies such Abercrombie, faithful servants Have you noticed that every ing the misguided ramblings of the Last time I heard it was well over as the Coast Guard, etc., the situ- serving the people of Hawai‘i. time Burgess, Conklin, and Twigg- trio under scrutiny. 5 million, and that was a month ation escalates into an illegal con- Smith speak on their favorite sub- or more ago. There is only one spiracy. In 1893, the Committee Lucy M. Akau ject – namely the dismantling of the Hank McKeague invasive species that we really of Safety illegally seized power Waima¯nalo Native Hawaiian rights and ben- Honolulu have to worry about, and we all of Hawai‘i and now the Lingle efits in their “homeland” derived know what it is. The Superferry administration seems to be repeat- Kudos on a great issue from their status as the “original Leaving paradise will only help it spread. ing our infamous history. If we are indigenous sovereign people” of The question is when are the not ALL going to be held to follow I am engrossed in the November the islands called Hawai‘i – they I read with interest your arti- people of Hawai‘i going to say, American law, then why not give 2007 issue of Ka Wai Ola. There always make solicitous overtures cle on the book “Kanaka,” about “We’ve got plenty of people on Hawaii back its independence and are so many fine articles in this to the non-Hawaiian people of Native Hawaiian migration to these fragile little islands already, allow home rule to establish a fair issue – informative, interesting Hawai‘i with commentaries such the Pacific Northwest in the ser- thank you. Please don’t come!” and consistent form of government and some are heartwarming, too. as: Aloha should be shared with vice of Hudson’s Bay Co. in the I’ll vote for any office-seeker to prevent outside influences from The article “Living Laulima” all the people of Hawai‘i; or, hav- 1800s. (Ka Wai Ola November who is serious about doing some- continuing to plunder/destroy our is especially inspiring. I love the ing a school serving only Native issue) Another book on the subject thing to limit toursim and develop- precious natural resources? photos, too, especially the one Hawaiians is race-based and is also available. The University ment and to keep the population Tamara Paltin of Calvin Hoe with his grand- unconstitutional; or, land to build of Hawai‘i gave a grant to the down. Tourism and “development” Lahaina

Notice to Readers Ka Wai Ola o OHA will accept for consideration news releases and letters to the editor on topics of relevance and interest to OHA and Hawaiians, as well as special events and reunion notices. Ka Wai Ola o OHA reserves the right to edit all material for length and content, or not to publish as available space or other considerations may require. Ka Wai Ola o OHA does not accept unsolicited manuscripts. Deadline for submissions is the 15th day of every month. Late submissions are considered only on a space-available basis. Published monthly by the Office of Hawaiian Affairs, 711 Kapi‘olani Boulevard, Ste. 500, Honolulu, Hawai‘i 96813. Telephone: 594-1980 or 1-800-468-4644 ext. 41888. Fax: 594-1865. Email: kwo@OHA. org. World Wide Web location: www.oha.org. Circulation: 64,000 copies, 58,000 of which are distributed by mail, and 6,000 through island offices, state and county offices, private and community agencies and target groups and individuals. Ka Wai Ola is printed by The Honolulu Advertiser. Hawaiian fonts are provided by Coconut Info. Advertising in Ka Wai Ola does not constitute an endorsement of products or individuals by the Office of Hawaiian Affairs. Ka Wai Ola is published by the Office of Hawaiian Affairs to help inform its Hawaiian beneficiaries and other interested parties about Hawaiian issues and activities and OHA programs and efforts. ©2007 Office of Hawaiian Affairs. All rights reserved. ku¯ka¯ku¯ka¯ • community forum Ke¯ke¯mapa2007 | 21

nect and triangulate with the piko that took place at Mauna Lahilahi Tyranny and Iwi of O‘ahu (Kükaniloko). When the is not only cultural desecration sun first appears in the East from for all Hawaiians but heartbreak- Exposed at Mauna the top of the Ko‘olau Mountains ingly personal to the lineal descen- at Ka‘aumakua, the ceremony of dants whose iwi were disinterred. Käne begins again. The golden The Office of Hawaiian Affairs Lahilahi flower of Käne makes its journey needs to hold the SHPD and the State Historic Preservation Officer. and religion is one more of a over Kükaniloko and then Ka‘ala SHPO accountable for its failures Mauna Lahilahi is a site that is seemingly endless assault not only and the Sun-teeth digs in deeply whether by negligence or intent, sacred to Käne. In addition to ances- on the sites of the Hawaiian peo- at Lahilahi. The Kaiäulu winds of and it needs to provide legal rem- tral burials, Mauna Lahilahi has ple, but also on the Käne religion Wai‘anae stir and rise to action and edies for the wrongs permitted. rare petroglyphs and astronomical and traditions. The Käne religion the Kumaomao winds of Kamaile Also, OHA needs to insure that Mauna Lahilahi viewed from Kaneikapualena significance. It is an important site and its traditions have survived for awaken to relieve the pain to the there are meaningful consequenc- heiau. - Photo: Courtesy of Alika Silva. in the Käne religion’s recognition of thousands of years in the middle land. The golden flower reaches es for the result of their violations. By Alika Silva the June solstice, and it represents of the pond, yet it has been over- over Mauna Lahilahi in to the Stay tuned for Part 2. both Papa as the earth, and Wäkea looked and misunderstood. shoals of the sea to a place called Finally, some wisdom from Tütü ur ancestors’ iwi was because Lahilahi is the name of Much has been written and Pö (Spirit place) located in the Lili‘uokalani: “A hiki mai ke aloha uncovered on Oct. 10 by his home. This is what our küpuna talked about of the Kü-Lono tradi- west, where the sun sets. That is (come with love), a e pono mai Othe City and County of knew, practiced and taught us. tions and the Pele traditions and one of the reasons that the terres- ana (come with righteousness), Ke Honolulu at Mauna Lahilahi when Mauna Lahilahi is also known practices, but much less is known trial location of Kane-huna-moku kahekakai kapu a Käne (sacred is heavy construction equipment was as the eyes of Wai‘anae. The about the Käne religion and tradi- continues to be huna today. Käne).” A me, “ ‘Onipa‘a Käkou used to clear the site. The City saying is, if you have not been tions, especially as it continues In September 2001, we made an (seek justice, my people).” Mahalo and County knew or should have to Lahilahi you have not seen to be practiced in Wai‘anae. Our oral contract for a memorandum nö, Käne lako ‘ohana, ua mau ke known that ancestral Hawaiian Wai‘anae. Our Wai‘anae küpuna ‘ohana deliberately built Käne‘ïlio, of agreement with the SPHD to ea o ka ‘äina i ka pono. remains were in the area because of also say that Lahilahi is the ku‘ula Käne‘aki, Kaneikapualena and consult with the Wai‘anae lineal Alika Poe Silva, Kahu Kuläiwi, previous communication with the for Käne and for the land called other Käne sites to physically and descendants regarding protection Koa Mana, Kupuka‘äina o City and County, the State Historic Käne-huna-moku. spiritually illustrate that life is and preservation of Wai‘anae’s fam- Wai‘anae, Moku, O‘ahu, Hawaiian Preservation Division and the This violation of our traditions sacred to Käne. These sites con- ily and Käne sites. The desecration National

1*#%1//70+6;)4#065241)4#/ 6JG1H¾EGQH*CYCKKCP#HHCKTU 1*# %QOOWPKV[)TCPVU2TQITCO CUUKUVUQTICPK\CVKQPUVQCFFTGUUVJGPGGFUQHVJG*CYCKKCP EQOOWPKV[)TCPVCYCTFUQHWRVQYKNNDGOCFGVQUWRRQTV RTQITCOUYJKEJCFFTGUUCTGCUQH'FWECVKQP*GCNVJ*WOCP5GTXKEGU 0CVKXG4KIJVU.CPF%WNVWTG*QWUKPI'EQPQOKE&GXGNQROGPV )QXGTPCPEG%QOOWPKV[&GXGNQROGPVCPF%CRCEKV[$WKNFKPI 6QDGGNKIKDNGHQTHWPFKPI †*CXG+45VCZGZGORVPQPRTQ¾VUVCVWU QRGTCVKPIKPVJG 5VCVGQH*CYCKµK QTDGCIQXGTPOGPVCIGPE[ †2TQRQUGCRTQLGEVQTRTQITCOYJKEJDGPG¾VU 0CVKXG*CYCKKCPUKPFKXKFWCNN[QTCUCITQWRCPF †2TQXKFGCRGTEGPVCIGQHVQVCNRTQLGEVEQUV 5VCVGYKFGYQTMUJQRUYKNNDGJGNFHTQO,CPWCT[VJTQWIJ#RTKN #NNCRRNKECPVUOWUVCVVGPFCP1*#)TCPVU9QTMUJQRQTOGGVYKVJ )TCPVU2TQITCOUVCHHYKVJKPOQPVJURTKQTVQCRRNKECVKQPFGCFNKPG (QTIGPGTCNKPHQTOCVKQPQTVQTGIKUVGTHQTCYQTMUJQRRNGCUGECNN $QPPKG-GQRWJKYCCV   #RRNKECVKQPUCEEGRVGFHTQO#RTKNVJTQWIJ,WPG )TCPVIWKFGNKPGUCPFCRRNKECVKQPUYKNNDGCXCKNCDNGCVYYYQJCQTI

F]ÓZ\f]?XnX``Xe8]]X`ij -CRK´QNCPK$QWNGXCTF5WKVG *QPQNWNW*CYCK´K YYYQJCQTI 22 | Ke¯ke¯mapa2007 Leo ‘Elele • Trustee Messages

Ho‘onani I Ka Makua Mau; OHA resources on Läna‘i Künou Ha‘aha‘a Ko Ka Honua Haunani Apoliona, MSW ten by Rev. Hiram Bingham for Praise Colette Y. Machado works with other providers in a Life Skills Chairperson, Trustee, At-large God From Whom All Blessings Flow. On Trustee, Moloka‘i and La¯na‘i Program for Läna‘i Middle School. The October 13, 2005, a second verse was program teaches students about needs, added. At a rehearsal of the UH Hilo wants, opportunity cost, budgeting and choral group, Kealohaonälani, one of banking. Field trips to local financial the members, Liko Puha, recorded the institutions and retail operations help stu- singing of Ho‘onani I Ka Makua Mau dents learn about how these establish- and later forwarded it to me via email. ments function. ö e nä ‘öiwi ‘ölino, nä pulapula After listening to the recording, I felt loha käkou! This year the OHA Many of the direct services OHA offers, a Häloa, mai Hawai‘i a Ni‘ihau, somewhat sad that the hymn was oh too Board of Trustees ended its annual like our Community Grants Program, Epuni ke ao mälamalama. Last short! So I decided to compose another Aisland-to-island community meet- haven’t received much publicity on Läna‘i. month our chant for the nation, Nä ‘Öiwi verse. My hope was to write four lines ing series with a visit to Läna‘i. This com- But thanks to OHA’s new office on Frasier ‘Ölino, was our focus. that were worthy of the magnificence munity meeting was originally scheduled Street, beneficiaries have direct access to My column this month focuses on one and grandness of the first verse, while for October 15th, but was rescheduled due programs, which should result in greater of our ‘öiwi ‘ölino Haunani Bernardino also reflecting a Hawaiian point of view. to weather conditions stemming from the participation from Läna‘i next year. This who now sleeps from season to season. Therefore, I looked to the natural world approach of Hurricane Flossie. Weather year, Läna‘i High & Elementary School Those who knew Haunani B. recognized and the things that grace our universe: notwithstanding, the community meeting received a grant award of $10,000 to fund in her first and foremost her pride in the earth, ocean, sky, the stars and the was a success, despite being one of three its College Fair and Career Day events. and love for Hawai‘i and for all things heavens. Thus, Künou Ha‘aha‘a Ko Ka community meetings occurring that same Martha Evans, Läna‘i High & Elementary Hawaiian; they also experienced her con- Honua was created and gratefully dedi- night. School’s vice principal, was on hand to tinual outpouring of “expression” wheth- cated to those voices of Kealohaonälani. Being one of the smaller Hawaiian give Trustees a report of the successful er through her teaching, her classroom The melody for Praise God From Whom communities in Hawai‘i, it can be difficult event. instruction, her choral directing, her All Blessings Flow and Ho‘onani I Ka to see how OHA’s resources help benefi- Läna‘i Culture & Heritage Center’s music performance, or her poetic com- Makua Mau is at least 450 years old, dat- ciaries in Läna‘i’s community of less than executive director, Këpä Maly, gave position. Her zest for life and her spirit ing back to 1551 and its composer, Louis 2,000. Most of OHA’s resources to Läna‘i Trustees an update on the center’s cultural to enjoy it as a Native Hawaiian never Bourgeois, in Geneva, Switzerland; its beneficiaries come by way of joint proj- programs and initiatives and he requested constrained her exploration into other name then – Old Hundredth. The text for ects and indirect services. support for projects in the future. Mr. cultures or genres. The Hawaiian touch Praise God From Whom All Blessings Every year students from Nä Pua Maly highlighted three specific areas by this Hawaiian wahine brought just a Flow is also historic, having been written No‘eau come to the community meeting to where OHA’s support was needed. First, bit more glow and style to the occasion. in the year 1674 in Winchester, England express their mahalo for OHA’s financial funding to initiate a curatorial program of Po‘okela was her work standard, always by Rev. Thomas Ken, as part of a rather support of their program. Students shared archival storage and conservation of old striving to do her best and striving to long hymn — Awake My Soul, And With experiences from enrichment activities in records, photos and items in the LCHC improve in each task or project. And, she The Sun. At some point the Bourgeois the Classics program and Papa Alaka‘i collection. Second, funding to support the expected no less from those around her melody and the Ken text were paired, but or Middle School Leadership program. development of preservation/interpretive in their own endeavors. Just prior to her when or how the pairing occurred is not This year’s lively group of 10 ‘öpio were plans for significant cultural resources at passing, she explains in a written mes- known at this printing.” excited about a trip they were going on Kapiha‘a (an ancient village) and Luahiwa sage dated July 2006 her thoughts about Here is H.B.’s second verse. Künou the next day – attending a college fair on (a petroglyph complex). Finally, support bringing the Hawaiian touch to a compo- ha‘aha‘a ko ka honua (all the earth bows O‘ahu. Students also mentioned that a Nä to develop programs to build capacity in sition of the 16th and 17th century. You in tribute) Nä uliuli o ke kai (as do the Pua No‘eau college counselor met with the community to promote cultural-histor- will recognize it as Ho‘onani I Ka Makua riches of the sea) Nä ‘ano lani kau hökü them beforehand to prepare them for their ical awareness and resource stewardship. Mau. Haunani’s mana‘o follows: “After (the celestials among the stars) Nä nani o visit. The Pathways Program, another of Trustees were also encouraged to stop by the New England missionaries arrived ka ‘önaeao (and the splendors of the uni- the Nä Pua No‘eau projects, is a hands- the center to view firsthand how the proj- in Hawai‘i many became proficient in verse). From this season forward let our on program that allows students to learn ect has progressed over the past year. Hawaiian and some eventually composed voices add these Hawaiian thoughts in about environmental issues that affect Trustees invited all in attendance to hymns in Hawaiian. There were brand song to praise God from whom all bless- them in their daily lives. stop by our OHA office to visit Pearl Ah new compositions and there were render- ings flow in tribute to the Hawaiian point Another direct service provider receiv- Ho for information on OHA’s programs. ings from English to Hawaiian of already of view and in celebration of the life, and ing funds from OHA is Alu Like Inc. Office hours are weekdays from 1 – 4 existing hymns. Ho‘onani I Ka Makua the spirit, the po‘okela of Haunani B. Joelle Aoki, a Program Specialist with its p.m. Beneficiaries can also call the office Mau is an example of the latter, writ- 37/48 Külia Like Multi Services Department, at 808-565-7930.

Subscribe Today! 594–1888 • www.oha.org Leo ‘Elele • Trustee Messages Ke¯ke¯mapa2007 | 23

Myriad of issues tackled Fight cultural reasons as to why recognition for her tribe was not a good thing. She claims that the tribe continued to live in pov- by OHA Board annihilation erty and ignorance and could not govern Boyd P. Mossman Oz Stender themselves. She concluded that recogni- Trustee, Maui years approaching its dissolution Trustee, At-large tion for Hawaiians would offer them the and removal as the organization same fate. I did not hear compassion for designated to help and represent her people nor did I hear any solutions Hawaiians. This will be ultimately on what she was going to do to help them good for Hawaii only if the Akaka survive this malaise. Bill passes and a new entity elected Also in attendance were a couple of by the Hawaiian people is born “token” Hawaiians who made certain s I sit here on a beauti- and begins another cycle of life ne recent morning, I watched a that everyone heard their objection to the ful Sabbath morning with and the continuation of our people, rerun of the movie “Bury Me at Akaka Bill. Aclassical music in the back- our culture, our traditions, and our OWounded Knee.” The opening One young Hawaiian woman com- ground and a view of Central Maui identity. scene shows an Indian chief, who led his plained about the administration of the through the trees and green grass tribe in battle, realizing that there was much Hawaiian Homes Act; someone needs to below me, I surely must count my In the meantime, we need to blood shed among his people; and because tell her that this act was the creation of the blessings and the fact that I have once and for all commit to keeping they were outnumbered and outgunned by United States Congress. Akin to Indian been given the privilege of life our people in Hawai‘i by provid- the United States Army, he surrendered his Reservations, the lands designated for itself. Indeed, I appreciate my birth ing affordable housing. The reasons tribe. Upon surrender, his only request was Hawaiians were the most remote and poor- as an American citizen and a Native for not securing housing are tired that his tribe be allowed to live according to est lands in all of Hawai’i. Congress allo- Hawaiian but mostly as a child of and worn out already and OHA their customs and the ways of their people; cated no funds (they still don’t) to make God. America has given me the must dive into this serious problem. the ways of their ancestors. Not surpris- these lands habitable. It was Congress freedom to choose; Hawai‘i my Drugs continue to destroy fami- ingly, the Army’s response was “assimilate who contrived the 50 percent blood quan- identification and heritage; and God lies and hurt our community and or be annihilated.” tum required so that in two generations, the promise of life eternal. It seems OHA has an opportunity to finally I don’t need to tell you the rest of there would be no more Hawaiians that that sometimes we tend to isolate address this issue head on but will the story. The story of the slaughter of met the requirement. When that happens, our frames of reference and narrow need action now and not more stud- Native American tribes across the North these lands will be reverted back to the our minds to the seemingly impor- ies. Our new revolving business American continent can be told over and United States. Her quarrel about quan- tant but actually insignificant and loan program has been launched and over again. This same story can be told tum and inheritance lies at the foot of immaterial matters of our times. needs to achieve success so that we about indigenous people throughout the the United States government – the very can adjust its requirements to bet- world. Settlers came from foreign coun- same government that will not recognize The Board has considered many ter meet the needs of our entrepre- tries, took what they wanted, and let it be Hawaiians as indigenous to our islands. issues recently, some significant neurs and others who qualify. Our known that the indigenous people were to Another woman said, in effect, that and some not. We have given mil- land policy is being completed and assimilate or be annihilated. annexation and statehood was good for lions in grants in the past month to will help us to preserve and man- This same analogy belongs to the Hawaiians because it let them own their non-profits, have seen the House age areas for the future. We con- Hawaiian people – the indigenous people own lands. The Great Mahele of 1848 of Representatives pass the Akaka tinue to seek resolution of past due of this place known as Hawai‘i. Although (which was not “great” for Hawaiians), Bill, and have continued to organize ceded lands revenues from the state, the Hawaiian people are not tribe mem- created by non-Hawaiian advisors to the ourselves internally to meet coming which will help us to provide more bers or Indians and did not suffer the Kingdom, literally allowed the steal- challenges with our lands, invest- benefits to our beneficiaries. And slaughter and bloodshed by settlers or ing of lands from Hawaiians. Today, ments and housing. Unfortunately, finally, our investment strategies armies, the message our ancestors got most Hawaiians do not own their lands. we still face criticism for actions always need updating and improve- was the same – “assimilate or be anni- The Ali‘i, ancestors of Princess Bernice which people latch onto that in the ments and OHA involvement in hilated.” Pauahi Bishop, were astute enough to grand scheme of things are simply businesses, leases, etc. is something I attended a Small Business Association keep much of their lands and conveyed manini or perhaps unjustly moti- we need to consider now. meeting in October where many in atten- them to the princess. As we know, her vated and waste much energy and dance, when introducing themselves, legacy is the Kamehameha Schools. resources; nevertheless, we seek the They say much too often that the expressed their stand against the Akaka Today, there are those who want to take betterment of our people through squeaky wheel gets the grease and Bill. Over and over again it was expressed that away too. actions that we believe will benefit some seem to adopt that as their that Hawaiians need to assimilate and The message we are receiving from as many as possible with the inter- national anthem; however, it is the move on. Over and over again the under- opponents of the Akaka Bill is to assimi- ests of all in mind. quiet but effective wheels that keep lying feeling was that Hawaiians cannot late or be annihilated. History continues us going and they need upkeep be allowed to live according to their cul- to repeat itself. I have sought to exercise patience and maintenance. These are they ture and the ways of their ancestors. Our future is uncertain as we continue and offer prayer in my dealings with who are the peacemakers and faith- When I introduced myself, I comment- to face challenges by those who do not the Board and others and have been ful who are willing to be patient, ed that it appeared that the Hawaiians in want to see the indigenous people of this pleasantly surprised at the results thankful, and prayerful rather than the room were of a minority group again. land get what is rightfully theirs. As a over the past five years. I feel as loud, rude and egotistic. Truly they We are a minority in our own land and are people we must come together and fight though the Board has progressed seek the light of Christ and may being told what is best for us. for justice. Personally, I am not ready for from its birth in 1980 through we do so also during this special The keynote speaker, Elain Willman my story to end the way the movie did. I its trials and challenges into its season. Merry Christmas and let us of Citizens for Equal Rights Alliance, will not surrender without a fight and be maturity and now into the autumn anticipate the best for 2008. claims to be of Indian descent and gave annihilated. 24 | Ke¯ke¯mapa2007 Leo ‘Elele • Tteerusstee Messages

It’s a matter of trust… has used the HRS 92-5(a)(4) executive Cindi Punihaole: session law to keep an action secret. No materials regarding the action are “I have the best through the administrator first. This causes provided to trustees ahead of time and Rowena Akana trustees to wait for up to 3-4 months to get they are instead presented on a chalk- job on the island” Trustee, At-large any requested fiscal information. All of the board or in a slide show. Then the vote trustees are also beneficiaries who should is called. This way, there is no paper never be denied access to OHA personnel trail of the action and the executive ses- Robert K. Lindsey, Jr. or be forced to wait so long for an answer. sion minutes are not released to anyone. Trustee, Hawai‘i About Trust: The board leadership has While I recognize that certain parts passed a new policy that forces a trustee of our records must remain confidential to get the permission of all nine trustees to because of privacy issues, etc., there is no‘ai kakou… It is no secret release or discuss any information shared in no need to keep our entire discussion that OHA has had a staff reten- executive session. Our old policy allowed confidential. We should consider ideas ‘Ation crisis for the past several a majority (5) of trustees to release any like blackening out the confidential infor- years – 36 position vacancies this year confidential information if it is appropri- mation and releasing the non-confidential he usually has a smile and usually alone. It seems like all of our most experi- ate. This bylaw has served OHA without portion of our documents to the public, focuses totally on the bright side of enced and capable staff have left and gone incident for the past 27 years. The sudden just like the federal government does. Slife and living. If she had to choose to DHHL, Kamehameha Schools, and change makes me wonder, “What is the Building a nation will require elected between light and darkness, yellow and other greener pastures. This has to stop. current Chairperson doing that she fears leaders to be forthright and strong, fair black, positive and negative, I believe light, OHA’s mission is too important and far is not pono?” The new bylaw goes against and transparent. Who will have faith in yellow and positive would without doubt be reaching to constantly have to start over basic trust law. For example, a trustee a nation being built by people hiding her choices. If she had a garden it would be with new staff. OHA needs to change at would not be able to say anything if other behind the law and afraid to tell the people filled with sunflowers, pïkake, puakenikeni a fundamental level, and I say we should trustees are making bad decisions behind the truth about what they are doing? and johnny jumps. If she had to paint a hun- start by restoring the most basic ingredient the closed doors of executive session. I would like to stress that I am not dred human portraits, there would definitely of any relationship - trust. How do we do Hawaii Revised Statutes (HRS) 554A-6 against spending our funds to lobby for be a smile on every face. that? It’s really simple actually. requires a dissenting trustee to express the passage of federal recognition. At She will be my recommendation for The leadership needs to rethink its cur- their opposition or they would be liable present, being federally recognized is Ambassador of Aloha to planet Earth when rent security procedures. Each OHA staff for any damages caused by the co-trust- the best way to protect our assets and a Lähui Aloha is established. I have known person will soon be given individual ID ees’ decisions. How can a trustee do that future entitlements from lawsuits. What Cindi Punihaole for 20 years now. I first cards that could potentially track them as if he or she is gagged by the new policy? I do object to is the secretive process that got to know Cindi when I was Director of they enter and leave any OHA workspace. Case in point, at our last Board meeting the leadership is using, which is neither the Land Assets Division-Hawai‘i Island, Heaven help you if you enter a trustee’s on Lanai, the Chair’s agenda listed two upfront nor forthright. As a trustee for Kamehameha Schools. Her dad, Uncle office without permission! All OHA staff items to be discussed in executive ses- OHA, it is my fiduciary responsibility Robert Punihaole, who was born and raised have also been fingerprinted to authen- sion using HRS 92-5(a)(4): “Agenda Item to know exactly how much of the trust is at Makalawena, Kona ‘Akau, had a concern ticate that they are indeed the person VI., B. Legal Advisory by Board Counsel being spent and for what purpose. It is a for the iwi of his ‘ohana and for the future signing into and out of work. Everyone and Deputy Administrator regarding the responsibility I take seriously and I will of Makalawena. We had a memorable “face knows it is their managers’ responsibility board’s responsibilities and obligations continue my inquires until I can finally get to face” kükäkükä. Memorable because a to make sure that their staff are report- under OHA Contract #1820 with Zell and straight answers. special spirit surrounded that meeting as the ing to work on time. The finger printing Cox, Law, P.C. to ensure the provision of In my opinion, the responsibility for this Punihaole ‘ohana possess a kind, warm and system only proves that there has been continued legal services to OHA.” and huge mess rests squarely on the current gentle spirit which just permeates the space a failure at OHA’s management level. “Agenda Item VI., C. Legal Advisory by Chairman’s shoulders. There is absolutely around you. The message that the current leadership Board Counsel and Deputy Administrator no way for a dissenting trustee to have From Makalawena, our paths continued is sending our staff is this - “We don’t regarding the board’s responsibilities and any impact at board meetings. It all started to connect across time on Hawaiian mat- trust any of you, just like we don’t trust obligations under OHA Contract #1612 five years ago when she combined the five ters from Kona to Ka‘ü. Two examples are some of the trustees.” My question con- with Patton Boggs, LLC to ensure the subject matter committees into only two, educational opportunities at Waiauhukini tinues to be, “What could they possibly provision of continued legal services to thus eliminating three committee chair- serving the youth and mäkua of Ka‘ü and a be doing to make themselves so paranoid OHA.” There was a discussion on these men and leaving the remaining two com- regional planning initiative for Kona Hema that they don’t even trust their own staff confidential matters, but then a motion to mittees under the control of her two most from Kealakekua Bay to the Pu‘uhonua ‘O or fellow trustees (other than 2 or 3 “inner renew the two contracts with “x” amount trusted trustees, thereby consolidating her Hönaunau. An effort to protect the marine circle” trustees).” OHA can now be lik- of dollars, etc. was suddenly proposed. power. After gaining total control over the life at Kahalu‘u Beach Park and Kahalu‘u ened to a “lockdown” security compound. Trustees were not given a copy of the board committees, she started using legal Bay is the topic which NOW brings us If you want people to be trustworthy, motion in advance and an action item for opinions to help her enforce her will at the together. Cindi now serves as a Public you should first give them your trust. As this matter should have been included in board table to justify her actions and give Outreach and Volunteer Coordinator for the administrator himself has said in the the Trustees’ folders. This should have her almost absolute control over all board Kahalu‘u Bay for the Kohala Center. I serve past, “we are all family.” I agree with that been taken up in open session because con- discussions and stifling any dissenting on the Kohala Center’s Board. “Saving whole heartedly and I truly wish that this tracts are not confidential. But if that were views of other trustees and even certain Kahalu‘u Bay” is the “tie that binds” us and will eventually occur. Unfortunately, the done in an open session, then beneficiaries beneficiaries. is the inspiration for this article. lack of trust reveals that, at present, we are would know how much is being spent on Some, may consider these actions clev- Let’s go back in time for a brief moment. a very dysfunctional family. our lobbying efforts. This should not be er. But is it? Cindi was born and raised in Kona in a time Currently, all OHA staff are discour- a secret. Everyone knows the board is Mathew 10:26 “For there is nothing that has been snuffed out by modernization aged from speaking with a trustee directly supporting federal recognition legislation. covered, that shall not be revealed; and and globalization. It was a time when Kona and all written communications must go This is the 4th time that this board hid, that shall not be known.” had no domestic water system and HELCO Leo ‘Elele • Tteerusstee Messages Ke¯ke¯mapa2007 | 25

was not providing electricity to certain She attended school from the first through engages our island’s unique natural assets pen at Hanauma Bay. Too many people at parts of Kona. Her parents were Robert the sixth grade in a two-room school house as scientific and intellectual assets. With too small a place. And, they keep on com- and Edna. She has two older brothers, in Kalaoa and graduated from Konawaena mana‘o from Cindi and a very caring cadre ing. Kahalu‘u Bay is being over used in its Robert Jr. and Clayton, and no sisters. She High School. Kona needed only one high of staffers, The Center “…builds teaching current condition. speaks fondly of her tütü käne, Kalolo Eto school at the time. Kona was still waiting and research programs that enhance island You can be sure Cindi and a host of vol- Punihaole and her parents. “I grew up on to be discovered by the “huddled masses.” environments and serve Island communi- unteers (girl scouts, public agencies (county, the slopes of Hualälai. My grandpa…was College followed. Cindi started on the West ties.” She said in a recently documented state, federal), private foundations, school a cowboy and coffee farmer (and an herbal Coast at Eastern Washington University interview about her work with the Center, groups) through an educational outreach practitioner). We grew up picking coffee, and shifted to the Atlantic Coast graduat- “I have the best job on the island…I get program called Reef Teach, complimented hunting, fishing, farming…My dad was a ing from Stockton State College in New to create programs — especially designed by signage, special events, water quality master of trades. He taught me how to hunt, Jersey. When she looks back in time, it is for our friends — that explore Hawai‘i monitoring, baseline environmental studies, throw net, farm, cook, lay cement, raise Mr. Richard Maeda her fifth-grade teacher, Island’s cultural and natural landscape. In sprucing up the bay’s pavilion with several pigs and cattle. I believe that my dad taught whom she says was her favorite teacher the past, we’ve spent a full day with Nä coats of fresh paint and wrapping every- me survival skills because he knew if he because he “constantly instilled in me a Maka Häloa, working and learning in the thing up with aloha, are doing what they can was not here to take care of us, we would feeling of confidence and encouraged me to lo‘i…in Waipi‘o Valley. On another day, to mälama Kahalu‘u for many other genera- be able to take care of the family. Both my aim for my dreams.” Jack Jeffrey, the National Sierra Club’s tions to enjoy. If you can touch the intellect, mom and dad made major sacrifices in their Now we shall fast forward to the present. Ansel Adams Nature Photography Winner, the head, perhaps you can reach the heart. lives to provide a better life for us. When I Cindi has much to be proud of. She has lived helped us (at all skill levels) learn how to One must not be faulted for trying. was young I felt my life was very difficult. a fulfilled life. She has given more to others appreciate nature’s beauty through photog- Cindi has spent a life time honoring her We did not have running water, electricity than she will ever receive in return through raphy.” Now, Kahalu‘u Bay is her focus. kuleana. “My family has had its roots on or inside facilities…I learned compassion stewardship, environmental outreach and Kahalu‘u Bay and Beach Park, in 2007, Hawai‘i Island for many generations and and humbleness from my mom and com- service to Kona. She now serves as Public suffers from excess carrying capacity. Put our kuleana, our obligation to care for the mon sense and assertiveness from my dad.” Outreach and Volunteer Coordinator for simply, overuse. The facilities built in the land, runs from the Kona coastal areas (the When she was 5 she contracted polio. It The Kohala Center. The Center, which for 1960s were sized to handle 200 patrons at kaha lands) of Mahai‘ula to Küki‘o and on was inner strength, a strong desire to get out now is based in Waimea, is an indepen- a maximum. Now they serve 1,000 patrons to the uplands (the wao kanaka lands) of of a hospital bed and go home to be with dent, not-for-profit academic institute for daily (recent data puts annual usage at Kalaoa Mauka.” Next Mission for Cindi, her family, divine intervention and perhaps research and education in the environmen- 400,000). The beach as well as coral reef is Ambassador of Aloha for our nation yet a dose of mind over matter that helped tal sciences. It works at the intersection at “great risk.” It’s “human versus nature” to be formed. The year 2008 is just around her beat this demon called poliomyelitis. of culture, science and community and and human is winning. We’ve seen it hap- the bend. Mele Kalikimaka.

It all starts with pride...... be proud to be Hawaiian

BJ Penn, Mixed Martial Artist

œÜʈÃÊÌ iÊ̈“iÊvœÀÊ>Êˆ˜`ˆ}i˜œÕÃÊ>Ü>ˆˆ>˜ÃÊ̜ÊÃÌi«ÊvœÀÜ>À`Ê>˜`ʺŽ>Õʈ˜œ>»ÊqÊ«>ViÊޜÕÀʘ>“iÊ qÊÌœÊ >ÛiÊ>ÊÃ>Þʈ˜ÊÌ iÊ«ÀœViÃÃʜvÊÃiv‡`iÌiÀ“ˆ˜>̈œ˜°

/œ`>Þ]ÊÌ iÊiÃÌ>LˆÃ “i˜ÌʜvÊ>ʘiÜʘ>̈Ûiʘ>̈œ˜ÊˆÃʜ˜ÊÌ iÊ œÀˆâœ˜]Ê>˜`ÊÌ iÊwÊÀÃÌÊÃÌi«ÊˆÃÊvœÀÊ>Ê >Ü>ˆˆ>˜ÃÊÜ œÊ܈à Ê̜ʫ>À̈Vˆ«>Ìiʈ˜ÊÌ iÊÀ>ˆÃˆ˜}ʜvʜÕÀʘ>̈œ˜Ê̜ʜvwÊVˆ>ÞÊÀi}ˆÃÌiÀÊÌ iˆÀʘ>“iÃÊ Ì ÀœÕ} ÊÌ iÊ>Õʘœ>Êi˜Àœ“i˜ÌÊivvœÀÌ°Ê/ ˆÃÊ«ÀœViÃÃʈÃÊ>Ài>`ÞÊ՘`iÀÜ>ÞÊ>˜`ʈÃʜ«i˜Ê̜Ê>Ê ˆ˜`ˆ}i˜œÕÃÊ>Ü>ˆˆ>˜Ã]ʘœÊ“>ÌÌiÀÊÜ >ÌÊޜÕÀÊ>}iʜÀÊÜ iÀiÊޜÕʏˆÛi°

>ŽiÊޜÕÀÊۜˆViÊ i>À`°Ê º*>ViÊޜÕÀʘ>“i»Ê̜ÊLՈ`Ê>ÊÃÌÀœ˜}Ê>Ü>ˆˆ>˜Ê˜>̈œ˜° Hawai‘i Maoli (808) 394-0050 hawaiimaoli.org 26 | Ke¯ke¯mapa2007 ho‘ohui ‘ohana • family reunions

E na- ‘ohana Hawai‘i: If you are planning a reunion or looking for genealogical information, Ka Wai Ola will print your listing at no charge on a space-available basis. Listings should not exceed 200 words. OHA reserves the right to edit all submissions for length. Clyde W. Na-mu‘o Send your information by mail, or e-mail [email protected]. E ola na- mamo a Ha-loa! Administrator Crystal Kua Aki/Kaiahua — The descendants of William Maui, to Mary Pi‘imoku Jones in 1896. Her next O‘ahu meeting in April 2008. These quarterly information on my grandfather’s siblings and Joseph Aki and Annie Wahinealii Kaiahua Communications Director grandparents were L.B. Jones and Pi‘imoku meetings will allow Kauli‘a descendants to attend his parents’ siblings. Our family names are: will hold a reunion Dec. 21, 2007, in Mäkua, Jones. She also had a sister named Mae. She local gatherings and provide the committee suffi- Mamala, Maliikapu, Kai‘o, Kuwehie, Kaehuaea, Lisa Asato Wai‘anae. In addition, a memorial service also had two uncles named William Jones and cient time for planning and gathering all necessary Louis and Makaalu. If you have any information, Publications Editor for Wilfred Kaanohi Aki will take place at Paul Jones of Lahaina. She married Eassie Miller copies of documents to organize the genealogical contact me, Poni Wolfe, at P.O. Box 19031, Punchbowl Memorial Cemetery of the Pacific Honolulu, HI 96817, email poniwolfe@yahoo. John Matsuzaki in Honolulu in 1911. All contact with this fam- chart and family book. The next meeting will be on the same day. For information, call Matilda ily has been lost, and we are very interested in on Maui, Jan. 18-20, 2008, in Waiÿöhuli, followed com or call 375-5278. Two separate reunions are Publications Specialist/Art Director Aki at 625-0155 or Lu Ann Mahiki Lankford learning more about our beloved grandmother’s by the April 19 O‘ahu meeting. For updates, in the planning stage for next year. at 668-9006. family. If anyone could kökua us with any information, or if you have any information to Nelson Gaspar Nahooikaika — Descendants of Obed information, it would greatly be appreciated. contribute to our ÿohana or are related to any of Production Specialist/Graphic Designer Beyer/Coconut Island — I am searching for Nahooikaika please call Olinda (Reyes) Shefte Please email Ann Hewett at [email protected] these lines, please contact Kuÿualohanui or Sera information about the people who lived on at 808-572-1873 or Warren (Black) Nahooikaika or call 554-5232. Kauli‘a by email at kauliaohanareunion@hawaii. Liza Simon Coconut Island, Käne‘ohe, in the year 1900. I at 808-242-4450. We would like to find family rr.com or by phone at 358-4853. Public Affairs Specialist have a birth certificate of my aunty who was Kalaau — I am seeking information for all the chil- members in hopes of having a reunion sometime born on the island. I’m not sure if my grandfa- in the near future. Blaine Fergerstrom dren of James Kalaau (1868-1932) and Keohonui Love-Hoopii — A reunion is being planned ther leased or owned the island; his name was Kawika (1871-1991). James Kalaau is also known for July 20, 2008, in honor of the past and Nakoa — The descendants of Kalawaianui Nakoa Media Production Specialist/Webmaster Paul Beyer and his wife was Amelia Ernestberg. as Keoahunui Kawika. Some of their children are: present ‘ohana of James Robert Love and will host its very first family reunion Aug. 1-3, Please call 585-5968, or write to Amy Hookano, Jennie (married Henry Paleka) and Helen (married Hoopii. Descendants include their children Francine Murray 2008, at Hale Nanea Hall in Kahului, Maui. The 315 Akaka Lane, Honolulu, HI 96813. Herman Holstein). Was there a Julie? Were there Annie Kaniniu, James R. K., William Kaliko; PIO Support Assistant children are: Samuel Paakaula, Joseph Kahiki, any other children? Contact Herman Paleka at P.O. Annie Love and Edmund Hart (children: Green — Seeking information on our ancestor James Kaula, Rebecca Peke, David Kalawaianui, Box 510112, Keälia, HI 96751. Louise Keohiokalani, Edwin K. Henry, James Charles Ogata we know only as Lepeka Kahalaunani. She had Susan Kumaia and Joseph Napuunoa Nakoa. For Kawohikukahi, Llewellyn Leialoha, Mary Volunteer children from Barrass, Green and Cleghorn, and Kalohi — I am seeking all available genealogy more information, contact co-chairs Winifred Kaniniu, Gladys Ululani, Edmund Jr., St. Elmo, later married someone by the name of Larush, but information for the Kalohi ‘ohana who lived in (Nakoa) Cockett at 808-244-5678 or Mary Ann Henrietta Hoopii, Annie Kaniniu, Robert Bruce, had no children with him. With Barrass, she had a Häna/Honolua, Maui, between 1850 and 1899 (Nakoa) Barros at 808-573-9339 HONOLULU Helen Adwina, Henry Haleola); Louise K. Hart daughter, Grace, who married Rose and had three or earlier. My great-grandfather, James Kauakahi 711 Kapi‘olani Blvd., Ste. 500 and George William Weight (children: Ethlinda Namau‘u/Nihoa — I am seeking any family children, Gustave, Helen (married Hedeman) and Kalohi Kalama (1880-1929), applied for his mar- Honolulu, HI 96813 Ululani, Llewelyne Blaisedell); Louise K. Hart connections to John Henry Nihoa, Keluhaleole Alexander. With Wm L Green, she had a daugh- riage license in July 1899 so he could marry my Weight and George Noa Weight. Kaihupelelani (w), Mahua Namau‘u (k), Naioma Phone: 808.594.1888 ter, Elizabeth (married Freeth), and a son, Wm L great-grandmother, Mary Ann Kahalewai Searle Also invited are the descendants of William Luukia Opio (w), Lin Chung Akuna/ Lum-Ten Fax: 808.594.1865 Green Jr. With Archibald Cleghorn, she had three (1876-1952), who was from Honolua Ranch. Weight and Isabella Askew (children: Benjamin Chong (k), Paao-ao (w) (Mrs. Ihu-nui), and Maka daughters, Rosie (married Roberts), Helen (mar- Original marriage records in the Honolulu EAST HAWAI‘I (HILO) John, Marry Ann [Molly], William Jr., George, Ihu-nui (k). Please write to Joyce Kainoa, P.O. ried Boyd) and Annie (married Woodenberg). We Archives showed his last name to be Kalohi Elizabeth Jane, Edward Joseph, Isabella Mae, Box 664, Kaunakakai, HI 96748-0664. 162-A Baker Avenue don’t think Kahalaunani is a last name. If anyone (James Kauakahi Kalama Kalohi). Somehow, Charles Schmidt Walker). Hilo, HI 96720 could kökua us with information, it would greatly somewhere, his middle and last names were Pulaa – I am looking for anyone who knows of The celebration will be at the Wai‘anae Army Phone: 808.920.6418 be appreciated. Please email Judi Weatherwax at altered. He went by Kalama after his marriage Charles H. Pulaa, born in 1853 in Honomauka, Beach Club from 10 a.m - 4 p.m. Cost of $15.00 [email protected]. because their son and my grandfather, Richard Hawai‘i; died May 25, 1907, in North Kohala. His Fax: 808.920.6421 (adults) $10.00 (keiki 5-12) will be collected for Kauakahi Kalohi Kalama (1900-1954), used wife was Anne Kailianu, sister of Mahi‘aili‘ili‘i, Jarrett/Bruhn/Reeves — I am looking for the buffet lunch. RSVP by July 1, 2008, is appreci- WEST HAWAI‘I (KONA) Kalama. All of his children had that last name, born in 1866. Please call 585-5968, or write to Amy Hawaiian side of my family, whom I have never ated. Payment also accepted upon arrival to 75-5706 Hanama Pl., Ste. 107 including my mother, Stella Ululani (Kalama) Hookano, 315 Akaka Lane, Honolulu, HI 96813. known. My grandfather’s name was Alexander event. Genealogy information will be available Loughmiller. The Hawai‘i census showed grand- Kailua-Kona, HI 96740 Dowsett Jarrett, and my great-grandfather’s name for viewing. All participants are encouraged to Schubert — I am trying to find any informa- father James and the Kalohi ‘ohana lived next Phone: 808.327.9525 was William Paul Jarrett. I have a family tree that bring any family charts, pictures, stories and info tion on Wenzel (Paul) Schubert, whose brother door to the Kawananahopu Kalama ‘ohana in Fax: 808.327.9528 has the last names Jarrett, Bruhn and Reeves, to be shared. If anyone is interested in working was my grandfather Jules Schubert. Wenzel Häna. Furthermore, my grandfather James was most extensively. I would really appreciate any with us on research, planning our gathering or for came to Hawai‘i, the island of Kaua‘i in the a witness to his sister Emaline Kalohi’s marriage MOLOKA‘I help in this matter, as I would like to meet my more info, please contact Uilani Tacgere at 808- 1890s from the former country of Bohemia - - in 1901 to a Kanohi and signed the license as Kulana ‘Oiwi family. I never knew my grandfather and really 696-6843, [email protected]; or Kaipo and Reatha (Austria/Germany) as a shoemaker and became James K. Kalohi. When he died in January 1929, P.O. Box 1717 want to meet anyone who knew him. If you have Awana at 661-942-5794, [email protected]. a saddle maker. Any knowledge of his marriage, his sister Emaline verified his death certificate any information, please call Lani at 510-220- death or family would be greatly appreciated. Kaunakakai, HI 96748 as James Kauakahi Kalohi Kalama. However, Lovell/Holokahiki — Plans are underway for 1916 or email [email protected]. Contact J.W. “Kimo” Wilson at P.O. Box 1971, Phone: 808.560.3611 his obituary and his burial records at the O‘ahu the Lovell a me Holokahiki family reunion. The Kealakekua, HI 96750 or at 808-323-2305. Fax: 808.560.3968 Johnson/La‘amaikahikiwahine — The Cemetery in Nu‘uanu showed his name as James ‘ohana of Joseph Lovell and Mary Holokahiki descendants of Ambrose Peter Johnson and Kauakahi Kalama Kalohi. I would appreciate will gather on Kaua‘i for a week during July 9- Tau‘a-Kaheluna — A reunion is being planned ¯ LANA‘I La‘amaikahikiwahine are planning a family any kökua from the Ho‘ohui ‘Ohana readers who 16, 2008. The children of Joseph and Mary were for July 19, 2008, in honor of the past and P.O. Box 631413 reunion July 3-6, 2008, at Mälaekahana Beach can set me straight on my dilemma. Contact me, Loika, John, William, Daniel and Jennie Lovell. present ‘ohana of Tau‘a (k) and Kaheluna Lana’i City, HI 96763 Park, North Shore, O‘ahu. We have secured a Danny Kalama, by email at drkalama@comcast. A meeting on Kaua‘i is scheduled for Dec. 2, (w). Descendants include: their children Falo, Phone: 808.565.7930 camping area and also lodging nearby. Ambrose net or by phone at 801-825-5436. 2007, at 2 p.m. location TBA, and an islandwide Benjamin, Steven, Paliilii and Josia; Falo Tau‘a and La‘amaikahikiwahine had eight children, six O‘ahu meeting is scheduled for January. Please and Benjamin Hubbell (children: David Kaua, Fax: 808.565.7931 Kauli‘a/Kapinao — The descendants of Sam of whom produced descendants. They were Enoch visit our website at www.lovellameholokahiki. Thomas, Hannah, Caroline, Julia Kapihenui, Kauli‘a and Kaiahua Kapinao (aka Mary Pinao) of KAUA‘I / NI‘IHAU Johnson, Anna Kahiku Johnson Kealoha, Lilia org. For more information, contact Kellie Pleas Susan Kawahinekuliauole); Hannah Hubbell and Kaÿü, Hawaiÿi, recently had its quarterly reunion Johnson Foster, Mele Johnson Peaha Kawainui, on Kaua‘i at 808-337-9953, skpleas@hawaiian Tong Kan Akana (children: Elizabeth Bessie 3-3100 Ku¯hio¯ Hwy., Ste. C4 meeting in Kona on Oct. 6. One of our main Antone Johnson and Pedro “Manini” Johnson. tel.net; or Louise (Kaiona) Killebrew on O‘ahu Nohoanu, Emma Rose, Con Lee, Mahealani Lihu‘e, HI 96766-1153 goals is to have a large reunion sometime during Their children were: Enoch Enoka Johnson, at 808-262-1884, [email protected]; or Julia, Akana; Hannah Hubbell and Theadore Phone: 808.241.3390 summer 2009 in or near to Kaÿü (exact dates and Peter Eokewe Kealoha, Lily Kipola Kealoha Kalani at 808-538-3046. Awana (children: Harriet Wainuhea, Josephine location still pending). The children of Sam and Fax: 808.241.3508 Blanchard, Sarah Ho‘ohuli Kealoha Ferreira, Keala, Lucinda, Mikahala, Rosie, Grace Kaiahua include sons: I (married Lepeka Kekuÿia Mamala-Mali‘ikapu and Louis-Makaalu — I Mary La‘a Kealoha Kaolelopono/Calvert, Anna Keahunani, Hannah Irene, Fook Tin [Theadore], MAUI also of Kaÿü), Puni (married Lepeka Kekuia after am looking for the Mamala-Maliikapu ‘ohana Kealoha Apio, Frank Kealoha, Frank Foster, Fook Chee, Fook Ned [Fred]); Theadore Awana 140 Ho‘ohana St., Ste. 206 the passing of his brother, I) and Sam V. (married and the Louis-Makaalu ‘ohana. My paternal Elizabeth Kapeka Foster Bartholomew, John and Jennie Kamanoulu (children: Theadore S. Mahelona of Kaÿü). Daughters included Abigail grandfather, Charles Kaena Mamala, was born Kahului, HI 96732 Foster, Orio Pakalau Foster, Joseph Foster, Kalei, Harriet Hannah Makia, William John, (married I. Ka‘auwai from Kauaÿi), Keahi (mar- in Waimea, Kaua‘i, and his parents were Paoa Phone: 808.873.3361 Nicholas Foster, Peter Foster, Raymond Foster, Benjamin Kauanoe); Jennie Kamanoulu Awana ried E. Macomber of Kaÿü), Pukai (married E. and Akalaina. We are looking for the siblings Fax: 808.873.3364 Annie Peaha Char, Emily Peaha Kim, Manuel and Daniel Ezera (child: Daniel Onaona Jr.). Delos Santos from Kaÿü), Pakanaka (married T. of Akalaina Mamala. My paternal grandmother, Johnson, Sarah Ka‘ahanui Johnson, John Peter The celebration will be at the Wai‘anae Army Martinsen of Kaÿü), and Nawai. We recently dis- Lily Wahinekapu Maliikapu Mamala, was born WASHINGTON, D.C. Johnson, Maria Johnson Christiansen, Elizabeth Beach Club from 10 a.m. - 4 p.m. Cost of $15 covered there were also one hänai, Agnes Kauliÿa. in Waihe‘e, Maui, to Charley Maliikapu and Lily 50 F St. NW, Suite 3300 Kahiku Johnson Young, and Mary Pa‘ahana (adults), $10 (keiki 5-12) will be collected for Descendant-representatives from the lines of I, Wahinekapu Kai‘o. Washington, D.C. 20001 Moniz/Stanton/Larinaga. For more informa- buffet lunch. RSVP by July 1, 2008, is appreci- Abigail, Keahi, Pukai and Sam Jr. were present We are looking for her siblings and the sib- tion and registration forms, please contact Roz ated. Genealogy information will be available Phone: 202.454.0920 at the meeting. However, we are still in search lings of both parents. My maternal grandfa- Solomon Kaplan at 808-575-5065, by mail at for viewing. All participants are encouraged to Fax: 202.789.1758 of descendants from Pakanaka Martinsen, Agnes ther was Antone Kaonohiokala Louis Jr. His P.O. Box 1291, Ha‘ikü, HI 96708, or by email, bring any family charts, pictures, stories and info Kauliÿa and others as well. father was Antone K. Louis Sr., also known as [email protected]. Please write “Johnson to be shared. If anyone is interested in working Since there are ‘ohana residing on all four major “Akoniliilii,” who was born in Honolulu and EMAIL: [email protected] Reunion” in the subject line. with us on research, planning our gathering or for islands, the steering committee has elected to have resided in the Liliha area. His mother was Sarah WEBSITES: more info, please contact Uilani Tacgere at 808- Jones — The family of Eva Kapilialoha Jones quarterly rotational meetings hosted by ‘ohana Agnes Makaalu, also known as Aunty Mokulani, www.OHA.org 696-6843, [email protected]; or Kaipo and Reatha Miller is currently researching our genealogy. Eva living on these islands over the course of the first who was born in Waipi‘o Valley, Hawai‘i Island, Awana at 661-942-5794, [email protected]. www.NativeHawaiians.com Kapilialoha Jones Miller was born in Lahaina, year, then evaluate our accomplishments after the where her family was from. I am looking for - makeke • the marketplace Ke¯ke¯mapa2007 | 27

Type or clearly write your 24-word-or-less ad and mail to: Classifieds only $12.50 OHA at 711 Kapi‘olani Blvd., Honolulu, HI 96813. Make check payable to OHA.

ALOHA! For all your real estate needs with aloha, call $900,000/ offer; Pu‘ukapu 1 ac. Res. $200,000; Pu‘ukapu HARP THERAPY: Kï hö‘alu me ka hapa, with all PONCHO’S SOLAR SERVICE: Solar water heating LeiAloha S. Kawaguchi (RA), GRI, ABR, 808-392-9453 10 ac. Pasture $75,000/ offer; Pana‘ewa 10 ac. Ag types of music, live on a gold concert harp for your contractor, utility rebates, tax credits, save money. HECO or email: [email protected] Century $175,000; Kamuela 4 bd/ 2.5 ba 10,001 sf. lot $300,000. next event. Customized programs. Lowest price in town. & MECO approved independent contractor, new systems, 21 All Islands. Charmaine I. Quilit Poki (R) 808-295-4474/ toll free 1- 944-0077. pool heating systems, repairs. Free estimates. O‘ahu: 800-210-0221, [email protected]. 422-4266; Maui: 808-760-2345. Located in Waiohuli BIG ISLAND: BUYING? SELLING? NEED RESULTS! HOME FOR SALE! Malu‘ohai, Kapolei 3bd/ 2ba 1 Homestead. DHHL properties or fee simple call Kimberly A. Parks, FOR SALE: Ho‘olehua 2bd/ 2ba 10,041sf. lot $155,000; story, 1,888sf. Land 5,875sf. Firm: $325,000. Principles R(S) Prudential Orchid Isle Properties toll free 800-789- Ho‘olehua 1 ac. res $100,000; Waiohuli undivided inter- only! Wilhelm JK Bailey (R) West Oahu Reality, Inc. Ph. SEEKING DHHL LEASE TRADE: Have 3 bdrm lease 4753 or C#808-987-0285. Email:[email protected]. est $80,000; Nanakuli 4bd/ 2ba 11,395 sf. lot $399,000; 228-9236. Email: [email protected]. at Kaupea, seeking 4 bdrm lease. Call 216-1818. Waianae 5bd/ 6ba w/lap pool $495,000. Charmaine CASH BUYER: I am interested in purchasing Ag lot in INDIVIDUAL AND FAMILY DISCOUNT DENTAL SERIOUS about building a business to care for your fam- I. Quilit Poki (R) 295-4474 toll free 1-800-210-0221 Pana‘ewa, Big Island. Call 808-756-1523 or 808-896- PLANS As low as $99.00 individual and $159.95 family ily? Initial start up less than $800. Unique, highly sought [email protected]. 0140. Looking into selling my home, serious inquiries per year (15 mos.) Visit www.DentalPlans.com or call after product. Call 808-268-2709. only! FOR SALE OR TRADE: 4 acres in Waianae. All 866-876-6859 use code HOME390 to save 10%. WANT TO BUY: Hawaiian Homes lease in Wai‘ehu Kou utilities are in 2-story house. Best offer. Call Richard at DIABETIC OR OVERWEIGHT? I can help! Lost INTEGRITY AND HONESTY! Purchase your 3 or 4 subdivision. Will pay cash. Call 800-871-6560 or 371-5018 or 620-9303. 35 lbs. in 5 wks. Off insulin, diabetic, cholesterol & BP Hawaiian homes property today! Let me represent you 808-281-9783. meds. Fast, safe, easy & physician recommended. www. FOR SALE: two homes, DHHL, in Waianae area 3 the buyer. Listing agent does not. Wilhelm JK Bailey WANT TO BUY: Homestead Papakolea. Will pay for ohanawellness.tsfl.com. Call Johnny Kai; 971-533-6881 bd/ 2 ba w/double carport, excellent condition. Bobbie (R) West Oahu Reality, Inc. Ph. 228-9236. Email: real- offers within reason. Call 689-5594. or email: [email protected]. Kennedy (RA) Graham Realty, Inc. 808-545-5099. Email: [email protected]. [email protected]. WHEN BUYING OR SELLING A HOME CHOOSE DIVORCE, CUSTODY, adoption, guardianship, INTERESTED IN TRADING – beautiful, residential, A PROFESSIONAL that speaks your language. Fee power of attorney, name change, simple will, paternity. FOR SALE: Waiohuli undivided lease, Possible 1st phase 21,560 sq. ft. lot in Keaukaha, for home, or vacation simple or homestead properties. Call Charmaine I. Quilit Uncontested legal documents done by an experienced selection, $65,000 very negotiable. Call 808-344-3870. lot on O‘ahu, DHHL lease willing to negotiate. Bobbie Poki (R), Your Hawaiian homes specialist 808-295-4474 paralegal will save you money. 781-2554. Kennedy (RA) Graham Realty, Inc. 808-545-5099. FOSTER/ RESOURCE FAMILIES NEEDED toll free 1-800-210-0221, [email protected]. Email: [email protected]. EXPERIENCED IN DHHL properties, and general real STATEWIDE: Hawai‘i’s keiki need safe and loving WILL BUILD ON YOUR LOT in Kona, Island of estate needs – all islands. Bobbie Kennedy (RA), Graham homes. For more information, call 808-441-1117, toll LOVE TO TRAVEL? Want to get $$ for it? Own an on- Hawai‘i - 3 bed/ 2 ba/ 2 car garage - 1,500 sf under roof. Reality, Inc. 545-5099. Email: [email protected] free 888-879-8970 or email: [email protected]. line Travel Agency under $500. www.kaimanaztravel. $150,000 - $160,000. Call 808-895-2919. com or 723-5118. FOR SALE: 4 funeral plots at Maui Memorial Park in GET YOUR POLI PILLOW! Hawaiian Made! Proudly XANGO: The original mangosteen health supplement. Wailuku. Nice location. $5,000 each. Call 800-871-6560 featured at these fine retailers: Nä Mea Hawai‘i, Island MAUI – Lot clearing, grubbing, excavation of your Finally, something natural, an anti-oxidant & anti-inflam- or 808-281-9783. Keepsakes, and ‘Iolani Palace Shops. Contact: 384-2215 homestead lot. Examples available, quality work and matory. Visit www.dsn.ltd.discovermangosteen.com or or [email protected] Enter subject: Poli. reasonable rates. Call 808-760-8278. FOR SALE: Big Island Pu‘ukapu 305 ac. Pasture call Dexter; 808-753-4041.

The Voice of Experience Charmaine I. Quilit Poki REALTOR®,CRS, GRI

Direct line: 295-4474 Toll Free: 1-800-210-0221 Fax: 943-1668 [email protected]

Realty Specialists 1585 Kapiolani Blvd., Ste. 1530 Honolulu, HI 96814 Learningcan bechild’s play

Applications will be available: O c t o b e r 1 5

Kamehameha preschools are accepting applications for the 2008– APPLICATION DEADLINE: 2009 school year. Kamehameha offers programs for three-year-olds at selected sites, and programs for four-year-olds in all areas. January 31, 2008 For applications call 842-8800 on O‘ahu or O‘AHU 1-800-842-4682 x8800 from the neighbor islands. Honolulu (Hawai‘i Kai to Pearl City) ...... 3 & 4-year-olds Ko‘olau (Waima-nalo to Waimea Bay) ...... 3 & 4-year-olds For preschool information call 534-8305 on O‘ahu or Hale‘iwa (Waimea Bay to Ka‘ena Pt., Mililani & Wahiawa-) . . .3 & 4-year-olds 1-800-842-4682, press 9 then ext. 48305. - Wai‘anae Coast (Waipahu to Makaha) ...... 3 & 4-year-olds Financial Aid is available. HAWAI‘I Kamehameha is a non-denominational Protestant Christian school. East Hawai‘i (all of East Hawai‘i) ...... 3 & 4-year-olds West Hawai‘i (Kohala/Waimea to Ho-naunau) ...... 3 & 4-year-olds

MAUI - - Paukukalo (all Maui except for Hana) ...... 3 & 4-year-olds KAMEHAMEHA SCHOOLS Pukalani (all Maui except for Ha-na) ...... 4-year-olds Ha-na (Ke‘anae to Kahikinui) ...... 3 & 4-year-olds KS’ policy on admissions is to give preference to applicants of Hawaiian ancestry to the extent permitted by law.

KAUA‘I ...... 3 & 4-year-olds Applicants who wish to be considered under that policy must have their Hawaiian ancestry verified by KS’ Ho‘oulu Hawaiian Data Center. For information call (808) 523-6228 MOLOKA‘I ...... 4-year-olds or 1-800-842-4682, press 9, then 36228. Or visit www.ksbe.edu/datacenter.