Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic ZP3 (Human) Recombinant Alias: ZP3A, ZP3B, ZPC

(P01) Gene Summary: The is an extracellular matrix that surrounds the oocyte and early embryo. It is Catalog Number: H00007784-P01 composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation Regulation Status: For research use only (RUO) development. The protein encoded by this gene is a Product Description: Human ZP3 full-length ORF ( structural component of the zona pellucida and functions AAI46483.1, 1 a.a. - 373 a.a.) recombinant protein with in primary binding and induction of the sperm acrosome GST-tag at N-terminal. reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a Sequence: C-terminal consensus furin cleavage site, and a MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTED transmembrane domain. It is hypothesized that furin VVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGN cleavage results in release of the mature protein from LSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTV the plasma membrane for subsequent incorporation into FSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEI the zona pellucida matrix. However, the requirement for HTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGC furin cleavage in this process remains controversial LVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRN based on mouse studies. A variation in the last exon of MIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG this gene has previously served as the basis for an SADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASR additional ZP3 locus; however, sequence and literature NRRHVTEEADVTVGPLIFLDRRGDHEVEQWALPSDTS review reveals that there is only one full-length ZP3 VVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPVSASE locus in the . Another locus encoding a bipartite transcript designated POMZP3 contains a Host: Wheat Germ (in vitro) duplication of the last four exons of ZP3, including the above described variation, and maps closely to this Theoretical MW (kDa): 67.98 gene. [provided by RefSeq]

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 7784

Gene Symbol: ZP3

Page 1/1

Powered by TCPDF (www.tcpdf.org)