DUSP12 () Recombinant Alias: DUSP1, YVH1

Protein (P01) Gene Summary: The encoded by this gene is a member of the dual specificity protein Catalog Number: H00011266-P01 subfamily. These inactivate their target by dephosphorylating both the Regulation Status: For research use only (RUO) phosphoserine/ and phosphotyrosine residues. Product Description: Human DUSP12 full-length ORF ( They negatively regulate members of the AAH06286.1, 1 a.a. - 340 a.a.) recombinant protein with -activated protein (MAP) superfamily GST-tag at N-terminal. (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different Sequence: members of the family of dual specificity phosphatases MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYF show distinct substrate specificities for various MAP GGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVE kinases, different tissue distribution and subcellular DLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRA localization, and different modes of inducibility of their VLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILK expression by extracellular stimuli. This gene product is PEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQ the human ortholog of the KVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCR YVH1 protein phosphatase. It is localized KCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTG predominantly in the nucleus, and is novel in that it RQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKL contains, and is regulated by a domain. GSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLG [provided by RefSeq] SQTGKI

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 63.03

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 11266

Gene Symbol: DUSP12

Page 1/1

Powered by TCPDF (www.tcpdf.org)