DUSP12 (Human) Recombinant Gene Alias: DUSP1, YVH1
Protein (P01) Gene Summary: The protein encoded by this gene is a member of the dual specificity protein phosphatase Catalog Number: H00011266-P01 subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the Regulation Status: For research use only (RUO) phosphoserine/threonine and phosphotyrosine residues. Product Description: Human DUSP12 full-length ORF ( They negatively regulate members of the AAH06286.1, 1 a.a. - 340 a.a.) recombinant protein with mitogen-activated protein (MAP) kinase superfamily GST-tag at N-terminal. (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different Sequence: members of the family of dual specificity phosphatases MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYF show distinct substrate specificities for various MAP GGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVE kinases, different tissue distribution and subcellular DLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRA localization, and different modes of inducibility of their VLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILK expression by extracellular stimuli. This gene product is PEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQ the human ortholog of the Saccharomyces cerevisiae KVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCR YVH1 protein tyrosine phosphatase. It is localized KCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTG predominantly in the nucleus, and is novel in that it RQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKL contains, and is regulated by a zinc finger domain. GSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLG [provided by RefSeq] SQTGKI
Host: Wheat Germ (in vitro)
Theoretical MW (kDa): 63.03
Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Preparation Method: in vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 11266
Gene Symbol: DUSP12
Page 1/1
Powered by TCPDF (www.tcpdf.org)