OR7D2 (Human) Recombinant Protein

Catalog # : H00162998-G01 規格 : [ 2 ug ] List All

Specification Application Image

Product Human OR7D2 full-length ORF (NP_787079.1) recombinant protein Antibody Production Description: without tag.

Sequence: MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSD SHLHTPMYFFLSNLSWVDICFSTCIVPKMLVNIQTENKAISYMDCLTQVYF SMFFPILDTLLLTVMAYDRFVAVCHPLHYMIIMNPHLCGLLVFVTWLIGVM TSLLHISLMMHLIFCKDFEIPHFFCELTYILQLACSDTFLNSTLIYFMTGVLG VFPLLGIIFSYSRIASSIRKMSSSGGKQKALSTCGSHLSVVSLFYGTGIGVH FTSAVTHSSQKISVASVMYTVVTPMLNPFIYSLRNKDVKGALGSLLSRAA SCL

Host: Wheat Germ (in vitro)

Theoretical MW 34.7 (kDa):

Form: Liquid

Preparation in vitro wheat germ expression system with proprietary liposome Method: technology

Purification: None

Recommend Heating may cause protein aggregation. Please do not heat this product Usage: before electrophoresis.

Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction:

Note: Best use within three months from the date of receipt of this protein.

Datasheet: Download

Publication Reference 1. Production and partial purification of membrane proteins using a liposome- supplemented wheat cell-free translation system. Nozawa A, Ogasawara T, Matsunaga S, Iwasaki T, Sawasaki T, Endo Y. BMC Biotechnol. 2011 Apr 11;11:35.

Applications Antibody Production

Gene Information

Entrez GeneID: 162998

GeneBank NM_175883.1 Accession#: Page 1 of 2 2020/8/11 Protein NP_787079.1 Accession#:

Gene Name: OR7D2

Gene Alias: FLJ38149,HTPCRH03,OR19-10,OR19-4

Gene olfactory receptor, family 7, subfamily D, member 2 Description:

Gene Ontology: Hyperlink

Gene Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein- coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq

Other olfactory receptor OR19-10 Designations:

Gene Pathway Olfactory transduction

Page 2 of 2 2020/8/11