OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG225037
CDV3 (NM_001134423) Human Tagged ORF Clone Product data:
Product Type: Expression Plasmids Product Name: CDV3 (NM_001134423) Human Tagged ORF Clone Tag: TurboGFP Symbol: CDV3 Synonyms: H41 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG225037 representing NM_001134423 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC
ATGCAAATAAGCAGTGAAAAGGAAGAAGACGATAATGAAAAGAGACAAGATCCAGGTGATAACTGGGAAG AAGGTGGAGGTGGTGGTGGAGGTATGGAAAAATCTTCAGGTCCCTGGAATAAAACAGCTCCAGTACAAGC ACCTCCTGCTCCAGTAATTGTTACAGAAACCCCAGAACCAGCGATGACTAGTGGTGTGTATAGGCCTCCT GGGGCCAGGTTAACCACAACAAGGAAAACACCACAAGGACCACCAGAAATCTACAGTGATACACAGTTCC CATCCCTGCAGTCAACTGCCAAGCATGTAGAAAGCCGGAAGTACTTAAAA
ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG225037 representing NM_001134423 Red=Cloning site Green=Tags(s)
MQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPP GARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKYLK
TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 CDV3 (NM_001134423) Human Tagged ORF Clone – RG225037
Cloning Scheme:
Plasmid Map:
ACCN: NM_001134423 ORF Size: 330 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 CDV3 (NM_001134423) Human Tagged ORF Clone – RG225037
OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001134423.2, NP_001127895.1 RefSeq Size: 3651 bp RefSeq ORF: 333 bp Locus ID: 55573 UniProt ID: Q9UKY7
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3