University of Massachusetts Medical School eScholarship@UMMS
GSBS Dissertations and Theses Graduate School of Biomedical Sciences
2014-10-21
Regulation of CDK1 Activity during the G1/S Transition in S. cerevisiae through Specific Cyclin-Substrate Docking: A Dissertation
Samyabrata Bhaduri University of Massachusetts Medical School
Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/gsbs_diss
Part of the Biochemistry Commons, Cell Biology Commons, and the Molecular Biology Commons
Repository Citation Bhaduri S. (2014). Regulation of CDK1 Activity during the G1/S Transition in S. cerevisiae through Specific Cyclin-Substrate Docking: A Dissertation. GSBS Dissertations and Theses. https://doi.org/10.13028/ M2130G. Retrieved from https://escholarship.umassmed.edu/gsbs_diss/871
This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in GSBS Dissertations and Theses by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. REGULATION OF CDK1 ACTIVITY DURING THE G1/S TRANSITION IN
S. cerevisiae THROUGH SPECIFIC CYCLIN-SUBSTRATE DOCKING
A Dissertation Presented
By
Samyabrata Bhaduri
Submitted to the Faculty of the University of Massachusetts Graduate School of Biomedical Sciences, Worcester In partial fulfillment of the requirements for the degree of
DOCTOR OF PHILOSOPHY
October 21, 2014
Interdisciplinary Graduate Program
iii
REGULATION OF CDK1 ACTIVITY DURING THE G1/S TRANSITION IN S. cerevisiae THROUGH SPECIFIC CYCLIN-SUBSTRATE DOCKING
A Dissertation Presented By
Samyabrata Bhaduri
The signatures of the Dissertation Committee signify completion and approval as to style and content of the Dissertation
______Peter Pryciak, Ph.D., Thesis Advisor
______Jennifer Benanti, Ph.D., Member of Committee
______Amy Gladfelter, Ph.D., Member of Committee
______Dannel McCollum, Ph.D., Member of Committee
______Eduardo Torres, Ph.D., Member of Committee
The signature of the Chair of the Committee signifies that the written dissertation meets the requirements of the Dissertation Committee
______Nicholas Rhind, Ph.D., Chair of Committee
The signature of the Dean of the Graduate School of Biomedical Sciences signifies that the student has met all graduation requirements of the school
______Anthony Carruthers, Ph.D., Dean of the Graduate School of Biomedical Sciences
Interdisciplinary Graduate Program October 21, 2014
iv
Acknowledgements
I am deeply grateful to my parents who have always encouraged me to choose for myself and take risks. Everyday of my life, I try to imbibe their great values and use that in decision-making. I want to sincerely thank Peter for being an excellent mentor to me over so many years and for constantly helping me develop analytical and presentation skills. I will continue to learn from him for years to come. These last seven years would have been stale and lackluster, had it not been for the constant companionship of my beautiful wife, Seemin, who always knows how to make it right, aptly demonstrated by her latest creation,
Zoya – our five month old daughter. I cannot even begin to describe how much more fun life has become after Zoya took over, so a big “thank you” to her. I want to specially thank Matt, my lab-mate, for not only helping me with countless experiments and writing, but also for being a patient friend and a source of
American political history, religious guidance, cultural sensitivity, etc. My sincere thanks goes out to my other lab-mates over the years, Patty, Rachel and Brian for helping with experiments while carrying on lighthearted banter. I also thank the members of my TRAC and DEC Committees for their constant guidance over the years and Dr. Gladfelter for kindly agreeing to be my external examiner. A special thanks goes out to Param, Shubham and Sebastian from Dan’s lab for a variety of scientific and non-scientific help and discussions. I would also like to thank my extended family back home in India for a lot of things and the large
Indian diaspora here that makes us feel at home away from home in the USA. v
Abstract
Several cell cycle events require specific forms of the cyclin-CDK complexes. It has been known for some time that cyclins not only contribute by activating the
CDK but also by choosing substrates and/or specifying the location of the CDK holoenzyme. There are several examples of B-type cyclins identifying certain peptide motifs in their specific substrates through a conserved region in their structure. Such interactions were not known for the G1 class of cyclins, which are instrumental in helping the cell decide whether or not to commit to a new cell cycle, a function that is non-redundant with B-type cylins in budding yeast. In this dissertation, I have presented evidence that some G1 cyclins in budding yeast,
Cln1/2, specifically identify substrates by interacting with a leucine-proline rich sequence different from the ones used by B-type cyclins. These “LP” type docking motifs determine cyclin specificity, promote phosphorylation of suboptimal CDK sites and multi-site phosphorylation of substrates both in vivo and in vitro. Subsequently, we have discovered the substrate-binding region in
Cln2 and further showed that this region is highly conserved amongst a variety of fungal G1 cyclins from budding yeasts to molds and mushrooms, thus suggesting a conserved function across fungal evolution. Interestingly, this region is close to but not same as the one implicated in B-type cyclins to binding substrates. We discovered that the main effect of obliterating this interaction is to delay cell cycle entry in budding yeast, such that cells begin DNA replication and budding only at vi
a larger than normal cell size, possibly resulting from incomplete multi-site phosphorylation of several key substrates. The docking-deficient Cln2 was also defective in promoting polarized bud morphogenesis. Quite interestingly, we found that a CDK inhibitor, Far1, could regulate the Cln2-CDK1 activity partly by inhibiting the Cln2-substrate interaction, thus demonstrating that docking interactions can be targets of regulation. Finally, by studying many fungal cyclins exogenously expressed in budding yeast, we discovered that some have the ability to make the CDK hyper-potent, which suggests that these cyclins confer special properties to the CDK. My work provides mechanistic clues for cyclin- specific events during the cell cycle, demonstrates the usefulness of synthetic strategies in problem solving and also possibly resolves long-standing uncertainties regarding functions of some cell cycle proteins.
vii
Table of Contents
Title Page……………………………………………………………………………ii
Signature Page……………………………………………………………………..iii
Acknowledgements………………………………………………………………...iv
Abstract………………………………………………………………………………v
List of Tables………………………………………………………………………...ix
List of Figures………………………………………………………………………..x
Preface………………………………………………………………………………xiii
CHAPTER I: Introduction…………………………………………………………...1
CHAPTER II: Cyclin-specific docking motifs promote phosphorylation of yeast signaling proteins by G1/S Cdk complexes………………………………………37
Abstract……………………………………………………………………………...38
Introduction…………………………………………………………………………40
Results……………………………………………………………………………….43
Discussions…………………………………………………………………………81
Materials and Methods……………………………………………………………85
CHAPTER III: A conserved docking interface in the cyclin Cln2 controls multi-site substrate phosphorylation and ensures timely entry into the cell cycle………..93
Abstract………………………………………………………………………………94 viii
Introduction…………………………………………………………………………95
Results……………………………………………………………………………….98
Discussions………………………………………………………………………..136
Materials and Methods…………………………………………………………...145
CHAPTER IV: Regulation of cyclin-substrate docking by a G1 arrest signaling pathway and the Cdk inhibitor Far1………………………………………………153
Abstract……………………………………………………………………………..154
Background and Results………………………………………………………...155
Discussions………………………………………………………………………...183
Materials and Methods……………………………………………………………188
CHAPTER V: Conservation of LP recognition in fungal G1 cyclins and unusual hyper-potency in some cyclins…………………………………………………….196
Introduction…………………………………………………………………………197
Results and Discussions…………………………………………………………201
Materials and Methods……………………………………………………………220
CHAPTER VI: Concluding remarks……………………………………………..223
CHAPTER VII: APPENDIX………………………………………………………...232
References…………………………………………………………………………..239 ix
List of Tables
Table 2.1. Yeast strains used in Chapter II
Table 2.2. Plasmids used in Chapter II
Table 3.1. Yeast strains used in Chapter III
Table 3.2. Plasmids used in Chapter III
Table 3.3 Oligonucleotide primers used for RT-qPCR analysis in Chapter III
Table 4.1. Yeast strains used in Chapter IV
Table 4.2. Plasmids used in Chapter IV
Table 5.1. Cyclin gene deletion and their phenotypes
Table 5.2. Yeast strains used in Chapter V
Table 5.3. Plasmids used in Chapter V
x
List of Figures
Figure 1.1. CDKs and their role in cell-cycle progression (Reproduced from
Bardin and Amon, 2001)
Figure 1.2. Positive feedback loops operating at G1/S transition
Figure 2.1. Cyclin-specific phosphorylation of Ste5 and Ste20 regulatory domains
Figure 2.2. A distal docking motif promotes Cln2-Cdc28 phosphorylation of Ste5
Figure 2.3. The Cln2 docking region in Ste5, and requirements for Cdk phosphorylation and regulation
Figure 2.4. Cyclin-specific binding by docking motifs in Ste20 and Ste5
Figure 2.5. Ste20-Cln2 binding and conservation of the Cln2 docking site
Figure 2.6. Re-wiring a Cdk regulatory circuit with a Ste20Ste5PM chimera
Figure 2.7. Ste20Ste5PM chimeras: cyclin specificity, protein levels, and minimal motif
Figure 2.8. Identification of additional candidate Cln2 docking sites
Figure 2.9. Sources of candidate Cln2 docking sites from other Cdk substrates
Figure 2.10. Docking sites drive cyclin-specific phosphorylation
Figure 3.1. Sequence constraints and evolutionary conservation of docking function.
Figure 3.2. Leucine zippers, hydrophobic patch, and cyclin domains
Figure 3.3. Identification of a docking-defective Cln2 mutant
Figure 3.4. Site-directed mutations in Cln2 xi
Figure 3.5. Docking-defective Cln2 and Ccn1 mutants shows reduced binding to multiple partners
Figure 3.6. Docking promotes multi-site phosphorylation of substrates in vitro
Figure 3.7. Effect of the Cln2-m4 mutation on viability and cell size
Figure 3.8. Cln2-m4 alters the critical cell size for cell cycle entry
Figure 3.9. Whi5 phosphorylation and bud polarization depend on Cln2 docking
Figure 3.10. Analysis of synchronous cultures and cell polarization
Figure 3.11. Docking interfaces and models
Figure 4.1. Pheromone signaling disrupts Cln2-substrate interactions
Figure 4.2. Effects of Cln2 and Far1 on pheromone response
Figure 4.3. Far1 inhibition of docking correlates with G1 arrest ability
Figure 4.4. Effects of Far1 on Cln2-substrate binding interactions
Figure 4.5. Far1 outcompetes substrates for binding to Cln2
Figure 4.6. Far1 vs. Cln2 levels in synchronous cultures
Figure 4.7. Effects of Far1 and pheromone on Cdk phosphorylation in vivo using substrates with native and artificial docking interactions
Figure 4.8. Pheromone/Far1 effects on Cdk phosphorylation in vivo
Figure 5.1. G1 cyclins from related yeasts have similar docking preferences
Figure 5.2. G1 cyclins from distant fungi recognize LP-type docking motifs
Figure 5.3. CLNs and CCN1s have subtly different sequence requirements for docking
Figure 5.4. Hyper-potent cyclins – S. pombe Cdc13 & S. kluyveri Ccn1 xii
Figure A1. Phosphorylation of Ste5 N-terminal by Cln2 is reversed by phosphatase treatment
Figure A2. Cyclin specific phosphorylation of Ste20 regulatory domains in the absence of B-type cyclin-CDK inhibitor Sic1
Figure A3. The Cln2 docking site in Ste20 enhances phosphorylation of a Ste20
80-333 N-terminal fragment xiii
Preface
Portions of this dissertation appear in separate publications:
Bhaduri, S. & Pryciak, P. M. (2011). Cyclin-specific docking motifs promote phosphorylation of yeast signaling proteins by G1/S Cdk complexes. Current
Biology, 21(19), 1615-1623 (selected amongst the top 25 Hottest Articles in
Current Biology between October to December 2011) [PMID: 23817205]
Pope, P. A.,* Bhaduri, S.,* Pryciak, P. M. (2014). Regulation of cyclin-substrate docking by a G1 arrest signaling pathway and the Cdk inhibitor Far1 (* Co-first authors). Current Biology, 24(12), 1390-1396 [PMID 24909323]
Bhaduri, S., Valk, E., Winters, M.J., Gruessner B., Loog, M., Pryciak, P.M.
(2014). A conserved docking interface in the cyclin Cln2 controls multi-site substrate phosphorylation and ensures timely entry into the cell cycle [Manuscript awaiting publication in Current Biology]
1
CHAPTER I
Introduction
Eukaryotic cell cycle progression – drivers and regulators
The eukaryotic cell cycle is a highly complex set of sequential events by which living cells duplicate their genomic content and divide it equally between two daughter cells. Most eukaryotes display four distinct cell cycle stages with varying lengths depending on the cell type. The main stages, namely S phase
(DNA replication) and M phase (chromosome segregation), are interspersed with two growth phases (G1 before S and G2 before M). The main components that drive the periodic fluctuation of events in all eukaryotic cell cycles are (a) Cyclin- dependent kinases, or CDKs; (b) two sequential waves of transcriptional upregulation and (c) two large-scale protein degradation events (Breeden, 2003;
Morgan, 2007; Vodermaier, 2004).
CDKs are the master regulators of the cell cycle with hundreds of potential substrates even in a single cell eukaryote like budding yeast (Holt et al., 2009).
As the name suggests, they bind to partner proteins called cyclins for their activity. There are many specialized forms of CDK and activities of different forms rise and fall in a sequential process thereby pushing cells through the cell
2
cycle (Morgan, 2007). The CDKs help to generate two transcriptional bursts during two distinct stages of the cell cycle. The first and the more pronounced one is at the G1 to S boundary when cells need to massively and robustly upregulate hundreds of transcripts for an irreversible commitment to the cell cycle and successful, error-free DNA replication (Charvin et al., 2010; Morgan,
2007; Novak et al., 2007). This task is carried out by the E2F family of transcription factors in higher eukaryotes and by SBF and MBF transcription complexes in budding yeast (Morgan, 2007). CDKs help this process in the G1 phase by inhibiting the repressors of these transcription factor complexes
(retinoblastoma in higher eukaryotes and its analog Whi5 in budding yeast)
(Hasan et al., 2013; Morgan, 2007). The second transcriptional wave happens at the G2/M transition and include, in budding yeast the mitotic cyclin Clb2 transcript (Morgan, 2007). There are many other periodically expressed genes in budding yeast cell cycle, but their transcription is not thought to be under CDK control (Orlando et al., 2008).
One key aspect of the cell cycle is irreversibility which is ensured through a series of biochemical switches resulting from factors such as robust positive feedback loops, stoichiometric CDK-inhibitors and proteolytic degradation. In budding yeast, the upstream G1 cyclin-CDK complex turns on the expression of downstream G1/S cyclins. These later G1/S cyclin-CDK complexes drive their own expression (positive-feedback loop) (Skotheim et al., 2008) and promote the
3
degradation of inhibitors of the S-phase cyclin-CDKs, in addition to turning on the massive SBF/MBF transcriptional program. This sequence of events lets the now-unchallenged S-phase cyclin-CDKs ensure irreversible entry into the cell cycle (Morgan, 2007; Schwob and Nasmyth, 1993; Yang et al., 2013). This irreversible commitment step is aided by proteolytic degradation through the SCF family of ubiquitin ligases, which target, among other things, the S-phase CDK- inhibitor (CKI) and also the G1 cyclins (Morgan, 2007). A Positive feedback loop of a different kind operates at the G2 to M transition. During Xenopus oocyte maturation, the mitotic CDK1-cyclinB complex promotes its own activation by inhibiting Wee1 kinase and activating Cdc25 phosphatase, which control an inhibitory tyrosine phosphorylation site on CDK1. These opposing regulations set up another positive feedback loop and CDK1 remains active even when stimulus is removed (Ferrell; Ferrell and Machleder, 1998; Gould and Nurse, 1989;
Morgan, 2007; Potapova et al., 2011; Trunnell et al., 2011). This irreversible process continues until an external factor is introduced. This external factor is the degradation of the mitotic cyclins by another large multi-subunit ubiquitin ligase complex known as the APC (Morgan, 1999; Wasch and Cross, 2002). The APC is involved in promoting chromosome segregation and mitotic exit. From APC activation until the end of G1, mitotic CDK activity will remain low because of the activated status of the APC. The G1 cyclins are refractory to the APC and promote the inhibition of a key APC component (Morgan, 2007), thus allowing the mitotic CDK to get activated again. Interestingly, the mitotic CDK complex
4
activates the APC, thus promoting its own destruction – a negative feedback loop that generates robust oscillations of mitotic CDK activity (Morgan, 2007). It is worth noting that this Wee1-Cdc25 regulation is not required in budding yeast
(Amon et al., 1992), thus bringing out subtle differences between different model systems.
CDKs and cyclins – mechanisms and controls – general principles
CDKs are proline-directed serine/threonine kinases, which require binding to cyclin proteins (Morgan, 1997) and the resulting conformational change to become active (De Bondt et al., 1993). In higher eukaryotes, there are multiple
CDKs involved in cell cycle control (CDK 1,2,4,6) and multiple cyclins (Cyclin D,
E, A, B and their subtypes like Cyclin D1, D2, D3). But in some single-celled eukaryotes like fission yeast and budding yeast, one main CDK, CDK1, controls all of cell cycle in partnership with several periodic cyclins (Figure 1.1) (Morgan,
1997; Morgan, 2007). Once activated, cyclin-CDK complexes phosphorylate proteins at specific serine/threonine residues that are a part of either a full consensus sequence (S/T-P-x-K/R) or a minimal consensus sequence (S/T-P)
(Langan et al., 1989; Songyang et al., 1994). Interestingly, a large-scale proteomic screen done in budding yeast showed that about two-thirds of all phosphorylated CDK sites belonged to the minimal consensus category (Holt et al., 2009). Also, one study using human cell lysates show that only 43% of all
5
Figure 1.1. CDKs and their role in cell-cycle progression
(Reproduced from Bardin and Amon, 2001)
During G1, the levels of G1 cyclins rise, and these cyclins associate with cyclin- dependent kinases (CDKs). Activity of G1 CDKs promotes the passage of cells through START (budding yeast), also known as the restriction point (R) in fission yeast and higher eukaryotes. After passing through this point, a cell is committed to continue through the cell cycle. In budding yeast, the G1 cyclins are Cln1, Cln2 and Cln3. Cln3 is present throughout the cell cycle at low levels, and this cyclin promotes the accumulation of Cln1 and Cln2 (Nasmyth, 1993). In fission yeast, puc1 seems to be important — although not essential — for entry into the cell cycle (Forsburg and Nurse, 1991). In higher eukaryotes, cyclin D-associated kinases are thought to have a function similar to that of Cln3–CDKs in budding yeast, and they are important for promoting the accumulation of the other G1
CDKs, cyclin E–CDK (Morgan, 1997; Nigg, 1995), .
S-phase CDKs begin to increase towards the end of G1, and are inactivated during G2 and mitosis. On reaching a critical level, they promote DNA replication.
In budding yeast, Clb5 and Clb6-associated kinases are important for promoting
DNA synthesis, but in their absence, mitotic CDKs (Clb1, Clb2, Clb3 and Clb4- associated kinases) can support DNA replication. In S. pombe, cig1 and cig2- associated kinases promote DNA replication, but as in S. cerevisiae, the mitotic cyclin cdc13 can function in their absence. In higher eukaryotes, cyclin E–CDKs
6
— directly or indirectly — and cyclin A–CDKs promote DNA replication (Morgan,
1997).
Mitotic CDKs are activated at the onset of mitosis and, among other processes, promote chromosome condensation, formation of the mitotic spindle and breakdown of the nuclear envelope. These functions are performed by CDKs associated with Clb1, Clb2, Clb3, Clb4 and Clb5 (perhaps also Clb6) in budding yeast, cdc13–cdc2 in fission yeast, and cyclin A and cyclin B-associated kinases in higher eukaryotes. For cells to exit from mitosis, undergo cytokinesis and enter the following G1, mitotic CDKs must be inactivated (Koepp et al., 1999; Morgan,
1997),.
7
Figure 1.1. CDKs and their role in cell-cycle progression
(Reproduced from (Bardin and Amon, 2001)
8
sites phosphorylated by cyclinA-CDK2 were full consensus sites (Chi et al.,
2008). The expression of CDK1 in yeast is not regulated, such that it remains constant during the entire cell cycle and always in excess of its cyclin partners
(Mendenhall et al., 1987).
Apart from cyclin binding, the activation state of CDKs is controlled by post- translational modifications (Mendenhall and Hodge, 1998). Full activation of
CDKs requires the phosphorylation of a highly conserved threonine residue in the
T-loop region near the catalytic cleft by CDK-activating kinase or CAK (Espinoza et al., 1996; Morgan, 1995, 1997). The result of this phosphorylation in the mammalian cyclin A-CDK2 pair, is that the T-loop, which otherwise blocks the catalytic cleft, changes position upon phosphorylation, thereby freeing the active site for substrate binding. Also, the residues responsible for ATP binding change position after this phosphorylation event (Jeffrey et al., 1995; Russo et al., 1996).
Other cyclin-CDK pairs are expected to behave in the same manner although differences in activity has been noted between them which probably points to different abilities of different cyclins to activate their CDK partner (Koivomagi et al., 2011b). Budding yeast differs from higher eukaryotes in having the activating phosphorylation event precede the cyclin binding event (Ross et al., 2000).
CDK’s activity is negatively regulated by phosphorylation at a conserved Tyr19 residue (and another threonine residue for mammalian CDKs). These phosphorylation sites regulate the orientation of the ATP phosphates and the
9
affinity for substrate peptides (Welburn et al., 2007). This inhibitory phosphorylation forms the basis of a positive feedback loop that strongly activates the M-phase CDK (mentioned above) at the beginning of mitosis in metazoans but not in budding yeast.
It is interesting to note that not all cyclin-CDK pairs are equally susceptible to this inhibitory phosphorylation. For example, in budding yeast, even though the same
CDK1 partners with both G1 phase and M phase cyclins, only the M phase cyclin-CDK complex is inhibited strongly by the inhibitory phosphorylation carried out by Swe1 kinase (Hu and Aparicio, 2005; Keaton et al., 2007). This difference demonstrates that not all CDK complexes are similarly regulated. Also, only the
M phase cyclin-CDK complex can phosphorylate and inactivate Swe1, not other
CDK complexes (Asano et al., 2005; Bhaduri and Pryciak, 2011; Harvey et al.,
2005), thus showing differences in the substrate specificity of different cyclin-
CDK complexes (to be discussed in detail later).
Unlike the CDK, cyclin levels are tightly controlled by transcription and proteolysis (Bloom and Cross, 2007; Murray, 2004). Nearly all cyclins are expressed in specific phases during the cell cycle and each cell cycle stage has its associated cyclins (Evans et al., 1983; Murray, 1995; Murray and Kirschner,
1989). Cyclins are rapidly degraded by the proteasome (Glotzer et al., 1991;
Murray, 1995) and thus allow the CDK to rapidly exchange their cyclins even
10
though dissociation rates are low (Kobayashi et al., 1994). All cyclins have a well- conserved domain called the cyclin box fold or CBF (Kobayashi et al., 1992), which binds the CDK and changes the conformation of the active site of the CDK
(Jeffrey et al., 1995).
Budding yeast cyclin-CDK complexes – functions and regulations
In budding yeast, the major CDK is Cdc28 (also called CDK1), originally discovered by Lee Hartwell in the early seventies (Hartwell, 1974; Hartwell et al.,
1974; Hartwell et al., 1973). Cdc28 associates with nine cyclins to carry out different jobs during distinct cell cycle stages (Bloom and Cross, 2007; Cross,
1995a; Enserink and Kolodner, 2010; Koivomagi et al., 2011b; Nasmyth, 1996).
Among these cyclins, there are two distinct groups, namely the G1 cyclins (Cln1-
Cln3) that control the decision whether or not to begin a new cell cycle, and the
B-type cyclins (Clb1-Clb6) that control DNA replication and mitosis. These cyclins are expressed sequentially. Cln3 triggers expression of Cln1/2, which then induce the expression of Clb5 and Clb6, which drive DNA replication but also terminate the expression of Cln1/2 during S phase. The next wave of cyclin expression produces Clb3 and Clb4 at the G2/M stage and finally, Clb1 and
Clb2, which take the cell through mitosis (Mendenhall and Hodge, 1998; Morgan,
1997; Pines, 1995). Apart from the G1 cyclin Cln3, all others are expressed in
11
paralogous pairs (i.e., Cln1/2, Clb1/2, Clb3/4, and Clb5/6) as a result of a whole genome duplication event in the evolution of Saccharomyces cerevisiae.
Although having any one of the three G1 cyclins is enough to begin a new cell cycle, there are specific differences in their mechanism of action and not all of their functions are redundant (Dirick et al., 1995; Skotheim et al., 2008).
Expression of Cln3 is low and more or less constant through out the cell cycle, peaking slightly in late mitosis and early G1 (MacKay et al., 2001; McInerny et al., 1997; Tyers et al., 1993) where it orchestrates the first step towards cell cycle entry, whereas Cln1 and Cln2 are expressed periodically with a peak in late G1
(Wittenberg et al., 1990). Although originally (in above studies) Cln3 expression was shown to be less periodic than other cyclins, a recent study has shown that
Cln3 protein cycles quite a bit with a peak in M phase (Landry et al., 2012). Cln3 and Cln1/2 are thought to promote Start through different mechanisms. Start
(restriction point in metazoan cell cycle) is a small window before DNA replication when the cell irreversibly commits to a new cell cycle (Johnson and Skotheim,
2013). Cln3 largely contributes to this event by turning on the expression of some key genes required for cell cycle entry including Cln1/2. Whereas, Cln1/2 can not only drive their own expression (positive feedback loop) (Skotheim et al., 2008) but also control other Start related events such as a) polarized growth for bud emergence; b) spindle pole body duplication and c) promoting degradation of S phase cyclin-CDK inhibitor, Sic1 (Bloom and Cross, 2007; Nasmyth, 1996).
Another distinct feature of Cln1/2 is that they can restrict pheromone signaling to
12
the G1 phase (Oehlen and Cross, 1994; Strickfaden et al., 2007; Wassmann and
Ammerer, 1997), a task not fulfilled by Cln3.
Cln3 controls the first step towards cell cycle entry (Stuart and Wittenberg, 1995;
Tyers et al., 1993). Many genes (about 200) are transcribed at this stage including key G1/S regulators. These genes are transcriptionally controlled by hetero-dimeric transcription factors SBF (Swi4/Swi6) and MBF (Mbp1/Swi6). SBF and MBF (analogs of E2F in higher eukaryotes) are kept inhibited by a protein called Whi5 (analog of Rb in higher eukaryotes) in the nucleus. The main job of
Cln3-CDK1 is to phosphorylate Whi5 and initiate its exit from the nucleus, thus relieving SBF and MBF of repression (Costanzo et al., 2004; de Bruin et al.,
2004). Once de-repressed, SBF and MBF start a massive program of transcribing about 200 genes including the G1/S cyclins Cln1 and Cln2 and the S phase cyclins Clb5 and Clb6, in a temporally separated manner. Cln1 and Cln2 are among the earliest transcripts (Eser et al., 2011; Skotheim et al., 2008) and in partnership with the CDK1, they can further phosphorylate Whi5 to completion
(Costanzo et al., 2004; Skotheim et al., 2008) and restrict its re-entry to the nucleus (Charvin et al., 2010). Cln1/2-CDK1 can promote their own transcription, thereby setting off a robust positive feedback loop (Figure 1.2A) (Cross and
Tinkelenberg, 1991; Dirick and Nasmyth, 1991; Skotheim et al., 2008) resulting in the quick accumulation of strong CDK activity needed to pass through Start,
13
Figure 1.2. Positive feedback loops operating at G1/S transition.
(A) Model for G1/S transcriptional regulon activation and bud emergence; red
lines indicate pathways generating positive feedback in Start transition
(reproduced from Skotheim et al., 2008).
(B) Model of Sic1 degradation; red line indicates positive feedback in Sic1
degradation at Start transition (reproduced from (Yang et al., 2013).
14
Figure 1.2. Positive feedback loops operating at G1/S transition
A
B
15
defined molecularly as the point where roughly 50% of Whi5 has left the nucleus
(Doncic et al., 2011). Another very important job that Cln1/2-CDK1 does is to start the multisite phosphorylation of CKI Sic1, which specifically inhibits the S phase Clb5/6-CDK1 complexes. Later, as Clb5/6 gets transcribed in small amounts, Clb5/6-CDK1 completes the phosphorylation of Sic1 and promotes its degradation by the proteasome – another positive feedback loop (Figure 1.2B)
(Koivomagi et al., 2011a; Yang et al., 2013). This event contributes to the mechanism of switch-like transition from G1 to S phase (Venta et al., 2012).
Clb5/6 transcription at G1/S is controlled by SBF/MBF (Nasmyth and Dirick,
1991; Schwob and Nasmyth, 1993) but the other four Clbs are controlled through a different group of transcription factors known as the Mcm1-Fkh1/2-Ndd1 complex which turn on the expression of about 35 genes at G2/M including the mitotic cyclins (Futcher, 2002; Spellman et al., 1998; Wittenberg and Reed,
2005). Moreover, SBF/MBF are inactivated by mitotic Clb2-CDK1 (Amon et al.,
1993) and Clb2-CDK1 can drive its own transcription by phosphorylating its transcription factors Fkh2 and Ndd1 (Reynolds et al., 2003).
Cyclin abundance is controlled by proteolysis throughout the cell cycle and this negative regulation is very important for generating sharp peaks of specific kinds of CDK activity during distinct cell cycle stages (Bloom and Cross, 2007). Yeast
G1/S cyclins have very short half-lives (~ 5-10 minutes) (Barral et al., 1995;
Lanker et al., 1996; Salama et al., 1994) and are targeted for degradation by a
16
ubiquitin ligase complex known as SCF (Skp1/Cdc53-F-box) (Deshaies et al.,
1995; Willems et al., 1996). The F-box protein is the substrate-specificity determining factor, which is Grr1 in the case of Cln1/2 (Skowyra et al., 1997;
Skowyra et al., 1999). Degradation of Cln2 is preceded by the autophosphorylation of its C-terminus by Cln2-CDK1 at multiple phosphorylation sites encompassing a PEST degradation domain, which is then recognized by
Grr1(Lanker et al., 1996; Salama et al., 1994; Schneider et al., 1998). Cln3 is degraded by not only SCF-Grr1 but also SCF-Cdc4 and its degradation also requires CDK1 dependent phosphorylation of its C-terminus (Landry et al., 2012).
SCF also controls the abundance of the B-type cyclin Clb6 through the F-box protein Cdc4 after phosphorylation by CDK1 and another cyclin-dependent kinase Pho85 (Jackson et al., 2006). Other B-type cyclins in budding yeast are degraded by the Anaphase Promoting Complex or APC. At early M phase, APC partners with substrate specific adaptor protein, Cdc20 and targets mitotic cyclins and Clb5 (Shirayama et al., 1999; Visintin et al., 1997; Wasch and Cross, 2002).
The mitotic Clb2-CDK1 complex can phosphorylate and activate APC-Cdc20 components, thereby promoting its own degradation (negative feedback loop)
(Rudner et al., 2000). During late M phase, APC partners with another adaptor protein Cdh1 with different substrate specificities. APC-Cdh1 can target mitotic cyclins but not Clb5 or Cln1-3. This insensitivity to APC lets G1/S and Clb5 cyclin-CDKs phosphorylate and inactivate Cdh1 at G1/S, thereby allowing the
17
mitotic Clb2-CDK activity to accumulate at the onset of M phase (Jaspersen et al., 1999; Kramer et al., 2000; Zachariae et al., 1998).
Specific roles of G1/S CDK at Start transition – substrates of the early CDK
Over the past two decades, considerable effort has gone into discovering substrates of cyclin-CDK complexes in eukaryotes, and budding yeast has proved to be a valuable model system in this effort. Through these studies, approximately 75 proteins functioning in different critical cell cycle events like
DNA replication and morphogenesis in budding yeast have been shown to be under CDK1 control (Enserink and Kolodner, 2010). A similar number of targets have been identified in higher eukaryotes (Blethrow et al., 2008; Errico et al.,
2010). However, even conservative estimates predict that CDK1 must have hundreds of targets in any cell. Several large-scale screening and computational studies have generated a larger list of predicted CDK targets and CDK controlled processes (Archambault et al., 2004; Chang et al., 2007; Holt et al., 2009; Moses et al., 2007a; Ubersax et al., 2003). One study in budding yeast (Ubersax et al.,
2003) identified 181 targets for the major mitotic cyclin Clb2-CDK. Another large- scale study (Holt et al., 2009) identified 308 substrates containing a total of 547 phosphorylated CDK sites. Similarly, there are some large-scale studies performed in higher eukaryotes to identify CDK substrates. For example, using a gel-shift assay combined with radioactive labeling, many candidates of individual
18
cyclin-CDK complexes were identified in Xenopus extracts (35 potential substrates for cyclin B-CDK1, 70 for cyclin A-CDK2, and 42 for cyclin E-CDK2)
(Errico et al., 2010). There was considerable overlap in substrates between the complexes tested in this study, but one interesting point that emerged is that not everything with a consensus CDK site works as a substrate; instead, some other requirement may need to be met, such as the presence of RxL type cyclin docking motifs (Errico et al., 2010). A study using human cell lysates and an analogue-sensitive allele of CDK2 combined with mass-spectrometry identified
180 potential substrates belonging to various categories including cell cycle progression, mRNA transcription, cellular structure and organization (Chi et al.,
2008). One large class of proteins in this study is uncharacterized, thus drawing our attention to the fact that we are yet to fully realize the functions of CDK phosphorylations. More than half of the identified phospho-sites were minimal- consensus (S/TP) sites and about 50% of them contained an RxL type motif distal to the sites themselves (Chi et al., 2008).
The studies described above, as well as others(Blethrow et al., 2008), have identified and/or predicted a large number of targets in both yeast and higher eukaryotes for specific forms of CDK. Of particular relevance to this thesis are substrates of the yeast G1/S cyclin-CDK complexes, and therefore the key substrates and processes are discussed in greater detail in the following paragraphs.
19
Whi5: Whi5 is an inhibitor of the SBF transcription factor complex, which is key to the G1/S transition. Following mitosis, Whi5 resides in the nucleus and inhibits transcription of the G1/S regulon. Before cells can commit to a new cell cycle at least 50% of Whi5 needs to be exported from the nucleus (Costanzo et al., 2004;
Doncic et al., 2011). Phosphorylation of Whi5 promotes its nuclear export. Whi5 has 12 CDK sites and the current understanding suggests that several of these
CDK sites need to be phosphorylated to achieve nuclear export and SBF de- repression (Skotheim et al., 2008; Wagner et al., 2009) although there is some ambiguity regarding how many and which sites need to be phosphorylated.
Phosphorylation of Whi5 is initiated (but not completed) by Cln3-CDK1 and that phosphorylation is probably sufficient to promote some SBF de-repression and allow some Cln1/2 to be transcribed. Subsequently Cln1/2-CDK1 completes the phosphorylation of Whi5 and fully turns on the transcriptional program. In the absence of Cln1/2, the nuclear exit of Whi5 is not sharp and incomplete as shown by single cell microscopy (Skotheim et al., 2008). In that study, it was also shown that a whi5-6A mutant cannot make a sharp and complete exit from the nucleus at Start and neither can it turn on some of the SBF controlled genes coherently (Skotheim et al., 2008).
Sic1: Sic1 is an inhibitor of S phase Clb5/6-CDK1 complexes and is key to setting the correct timing for the initiation of DNA replication. Sic1 keeps a temporal window in G1 free of Clb5/6-CDK1 activity, which is essential for new
20
origin licensing (Lengronne and Schwob, 2002). Clb5/6-CDK1 activity can rise only when Sic1 is degraded (Schwob et al., 1994; Verma et al., 1997). Sic1 has nine CDK phosphorylation sites and multiple sites need to be phosphorylated for
SCFCdc4 mediated degradation of Sic1 at the onset of S phase (Feldman et al.,
1997; Nash et al., 2001; Verma et al., 1997). Both Cln2-CDK1 and CLB5-CDK1 can phosphorylate Sic1 in vitro (Koivomagi et al., 2011a; Skowyra et al., 1997).
Although population-average studies (Sedgwick et al., 2006; Verma et al., 1997) in the past had implicated Cln2-CDK1 in Sic1 phosphorylation, recent in vitro and single cell in vivo time-lapse microscopy studies show that in fact the rate of degradation of Sic1 depends on Clb5-CDK1, not Cln2-CDK1 (Koivomagi et al.,
2011a; Yang et al., 2013). However, Cln2-CDK1 mediated initial phosphorylation of Sic1 at certain sites is thought to play a priming role which then allows Clb5-
CDK1 to complete the multiple site phosphorylation that is required for efficient
Cdc4 recognition (Koivomagi et al., 2011a). An in vivo study looking at fluorescently labeled Sic1 in both mother and daughter cells observed that Cln2-
CDK1 controls the timing of Sic1 degradation (“defined as the time from Whi5 nuclear exclusion to the point of the fastest Sic1 degradation”), such that when
Cln1/2 are absent, this timing is highly variable among cells. Also, removing a
Cln2 docking site in Sic1 causes variability in this timing (Yang et al., 2013). The use of two different CDK complexes to separately initiate and then complete substrate phosphorylation is an emerging theme at key cell cycle transition
21
points(Yang et al., 2013), as with the dual-stage inhibition of Whi5 by Cln3-CDK1 and then Cln1/2-CDK1 (discussed above).
Cdh1: Cdh1 (originally known as Hct1) is an important component of the APC complex and one of its main targets is the mitotic cyclin Clb2 (Baumer et al.,
2000). In order to let the mitotic cyclin-CDK activity build up before mitosis, Cdh1 activity needs to be kept in check during G1 and S phase. This regulation is achieved through phosphorylation of Cdh1 by G1/S and S phase cyclin-CDKs
(Jaspersen et al., 1999; Zachariae et al., 1998). Cdh1 has eleven CDK sites and the phosphorylation of multiple sites is correlated with its degree of inactivation by CDK(Zachariae et al., 1998). Also, Cln2 has been shown to bind Cdh1
(Archambault et al., 2004) but less is known about the mechanism of Cln2-CDK1 mediated phosphorylation of Cdh1 and it remains to be seen if its phosphorylation depends on docking and processivity mechanisms similar to that in Sic1.
Polarized bud morphogenesis: Several proteins involved in bud emergence are specific targets of Cln1/2-CDK1. Specific cell size and shape are maintained through a coordination of cell growth with the cell-division cycle. But cell growth is not thought to be controlled by the cell cycle (Cross, 1990; Culotti and Hartwell,
1971; Gross et al., 1997; Johnston et al., 1977; Kipreos et al., 1996). G1/S cyclin-
CDK1 activity in yeast is thought to promote polarized apical bud growth, which
22
later shifts to isotropic bud growth during S phase (when Cln1/2 protein levels have gone down). Heightened activity of G1 cyclin-CDK has been shown to drive extremely elongated bud growth (Barral et al., 1995; Lew and Reed, 1993).
Recent work (McCusker et al., 2007) has shown disruption of CDK1 activity disrupts the secretory pathway, important for delivering vesicles to the growing bud. Cdc42-GTPase signaling is required for the initiation of polarized bud growth and this process is CDK1 dependent (Butty et al., 2002; Gulli et al., 2000;
Lew and Reed, 1993; Moffat and Andrews, 2004). Cdc42 is instrumental in polarized bud emergence in G1 (Adams et al., 1990) and polarized localization of exocyst components Sec4 and Sec15 (Zajac et al., 2005). Cdc42 needs Cdc24-
GEF for activation and inhibition of Cdc24 during bud emergence stops polarized growth (Sloat et al., 1981; Sloat and Pringle, 1978). Cdc24 was found to be associated with many other polarity-related proteins such as Bem1, Rga2, Boi1,
Boi2 (McCusker et al., 2007). Therefore, it appears that bud emergence requires a large complex containing a GEF, a GAP and a scaffold protein for Cdc42 along with some other proteins needed for actin polarization. Many of these proteins associated with Cdc24, including itself, get hyperphosphorylated at the time of bud emergence (G1/S boundary). The authors went on to further show that these proteins are specific targets of the Cln2-CDK and not Clb2-CDK1 (McCusker et al., 2007). Interestingly, all of these proteins contain multiple CDK sites and it was shown that Cln2-CDK1 mediated multi-phosphorylation of Boi1 is important for maintaining proper polarized bud morphogenesis (McCusker et al., 2007).
23
Inhibition of pheromone signaling: The pheromone-responsive mating pathway inhibits entry into the cell cycle by activating a CKI protein, Far1 (discussed in detail later and in Chapter 4). In turn, the mating pathway is itself inhibited by the cell cycle, such that pheromone signaling is prevented in cells that have already passed Start (Oehlen and Cross, 1994; Oehlen et al., 1998), which ensures that the cell does not commit to differentiate and divide at the same time. This inhibition is mediated by the G1/S cyclin-CDK complexes, but not by CDK complexes from S or M phases. There are two ways in which G1/S cyclin-CDKs influence the mating pathway. Firstly Cln2-CDK1 promotes the degradation of
Far1 as the cells enter G1 (Henchoz et al., 1997; McKinney et al., 1993).
Secondly Cln2-CDK1 inhibits the membrane localization of an essential pathway component, the MAPK scaffold protein Ste5 (Bhattacharyya et al., 2006; Winters and Pryciak, 2005). Cln1/2-CDK1 but not other forms of CDK1, phosphorylates the eight CDK sites flanking a membrane localization domain in Ste5. This inhibits the membrane binding of the scaffold protein Ste5 and as a result MAPK signal propagation is stopped (Strickfaden et al., 2007).
Interestingly, all of these CDK sites are of the minimal consensus category and
Ste5 has a Cln1/2 specific docking motif (Bhaduri and Pryciak, 2011). This mechanism ensures that once proper CDK activity levels are reached, pheromone response is inhibited so that DNA replication can proceed without hindrance.
Pheromone signaling can antagonize G1/S cyclin-CDK activity through the CKI
24
Far1, if cells get exposed to pheromone early on in G1. The molecular mechanism behind Far1’s inhibition of Cln-CDK activity has been a matter of ambiguity because while some early reports showed Far1 as a CKI, later studies failed to confirm that observation (Gartner et al., 1998; Peter and Herskowitz,
1994). Recent work from our group (Pope et al., 2014) has given the first direct in vivo evidence that Far1 can inhibit Cln2-CDK phosphorylation of Ste5. At least part of this mechanism is inhibiting the substrate binding of Cln2, but there is another component of it, which probably affects the activity of the CDK directly
(more details later and in Chapter 4)
The two models for regulation of CDK activity during the cell cycle
There are two leading models to explain how different cell cycle events are triggered at different cell cycle stages. One posits different threshold levels of cyclin-CDK activity (the quantitative model), and the other relies on different substrate specificities of different cyclin-CDK complexes (the qualitative model).
Studies on the main mitotic cyclin in fission yeast, Cdc13, led early researchers to propose a quantitative model for CDK activity (Fisher and Nurse, 1996). This model stated that low levels of CDK activity is enough to take the cell through the
S phase (DNA replication) but is not enough to promote mitosis. Later, CDK activity rises and that, besides promoting mitosis, also prevents re-replication.
After mitosis, CDK activity again subsides and the cell gets ready for the next
25
division cycle. Among other things, this model requires S phase and M phase substrates to respond to different thresholds of CDK activity (namely mitotic substrates will get phosphorylated only by high CDK activity while S phase substrates respond to low CDK activity) (Fisher et al., 2012; Stern and Nurse,
1996; Uhlmann et al., 2011). In support of this model, it has been shown that fission yeast cells lacking three important G1 and S phase cyclins (Puc1, Cig1 &
Cig2) are still viable (Martin-Castellanos et al., 2000). More recent work, using an engineered cyclin-CDK fusion protein regulated by different doses of an inhibitor, demonstrated that a fission yeast cell cycle can be driven by a single cyclin-CDK pair (Coudreuse and Nurse, 2010). Several other recent studies show different mitotic events require different levels of CDK1 activity. One study involving the mammalian cyclinB1-CDK1 pair showed that earlier mitotic events required less cyclinB1-CDK1 activity than later ones (Gavet and Pines, 2010). Also, in vitro studies confirmed that late mitotic substrates were phosphorylated by only high levels of cyclinB1-CDK1 activity (Deibler and Kirschner, 2010). Also budding yeast mitotic events like spindle formation and elongation require different levels of mitotic cyclin Clb2 (Oikonomou and Cross, 2011). In this dissertation (Chapter
5) I will present evidence that S. pombe Cdc13 may belong to class of special cyclins which can activate the CDK1 kinase to unusually higher levels as compared to other B-type cyclins.
Although it’s apparent that different cell-cycle events require different levels of
CDK activity, this observation cannot explain all of the specificities in cyclin-CDK
26
function. For example, most organisms use, not only numerous cyclins, but also several CDKs for their cell cycle progression (Roberts, 1999). In budding yeast, the abundance of different cyclins is quite similar (Cross et al., 2002) thus hinting that there is not much change in net CDK1 activity from G1 to M phase.
Therefore, there must be other mechanisms regulating substrate specificities of different cyclin-CDK complexes. In budding yeast, several cell-cycle events require a specific type of cyclin-CDK complex. For example, mitotic events cannot be driven by G1 cyclins and conversely B-type cyclins cannot drive the
G1-specific transcriptional program (Nasmyth, 1996; Schwob and Nasmyth,
1993). In fact mitotic cyclins could not even initiate replication properly unless overexpressed (Cross et al., 1999; Nasmyth, 1996). Also, the pheromone response pathway can only be inhibited by G1/S cyclin-CDK complexes (Oehlen et al., 1998). This distinction between G1 and B-type cyclins is likely to be true even for fission yeast, as the absence of the major G1 cyclin, Puc1, causes a cell cycle delay in G1 (Martin-Castellanos et al., 2000). So the quantitative model only pertains to B-type cyclins. A thorough quantitative comparison of activity and substrate specificity between budding yeast S phase Clb5-CDK1 with M phase
Clb2-CDK1 complexes showed that even though Clb2 modulates the CDK1 active site towards higher activity than Clb5, some substrates are still more specific towards Clb5-CDK1 (Loog and Morgan, 2005). The intrinsic activity of S phase Clb5-CDK1 is low and hence it phosphorylates several mitotic substrates poorly but for some S phase substrates, this low intrinsic activity is compensated
27
by a cyclin-specific docking interaction with the substrates. Conversely, although,
Clb2-CDK1 activity is intrinsically high, allowing broader range of substrate selection in mitosis, lack of substrate docking renders it ineffective on several S phase substrates. More recent work has further advanced this model to include that the two methods of substrate targeting changes reciprocally during cell cycle progression (Koivomagi et al., 2011a; Koivomagi et al., 2011b). In this in vitro study, the authors showed, as the cell cycle progresses, the intrinsic activity of each successive cyclin-CDK pair increases but substrate-specific binding decreases. So this new data supports the quantitative model of CDK activity while incorporating the fact that several cell cycle events require cyclin-specific substrate targeting which compensates for low intrinsic CDK activity of early cyclin-CDK complexes (key aspects of the qualitative model). Work to be presented later in this dissertation will further bolster the cyclin-specificity model with respect to a different class of cyclins, namely the G1/S cyclins Cln1 and
Cln2 (Bhaduri and Pryciak, 2011). In vivo evidence will be presented to advance the claim that some substrates are specific to the Cln1/2-CDK1 complexes because they have Cln1/2 specific docking motifs (Chapter 2).
Mechanisms of substrate specificity of CDK complexes
In spite of the wide functional redundancy within distinct subclasses of cyclins and CDKs, there are many examples of cyclin specific behavior during the cell
28
cycle. In budding yeast, pheromone response can be inhibited only by Cln1/2-
CDK complexes and not by Clb5-CDK or even Cln3-CDK (Oehlen and Cross,
1994). Four G1 cyclin-CDK complexes, namely Cln1/2-CDK1 and Pcl1/2-PHO85, together share an essential function of initiating polarized bud morphogenesis and deletion of all of these four cyclins causes inviability which cannot be rescued by Cln3 or the Clbs (Moffat and Andrews, 2004). The mitotic Clb2-CDK1 complex in yeast cannot trigger the expression of the G1/S regulon, normally turned on by Cln3-CDK1. Instead Clb2-CDK1 can repress the expression of those genes (Amon et al., 1993). Also, Cln1/2-CDK1 promotes polarized bud growth whereas Clbs, especially Clb2-CDK1 promotes isotropic bud growth (Lew and Reed, 1993). From several studies in budding yeast, it was clear that Cln3 and Cln1/2 promote the entry into cell cycle through different mechanisms: Cln3 turns on the massive G1 transcriptional program (Dirick and Nasmyth, 1991;
Koch and Nasmyth, 1994; Stuart and Wittenberg, 1995), whereas Cln2 promotes additional G1 events like bud morphogenesis and activation of Clb-CDK complexes (Benton et al., 1993; Cvrckova and Nasmyth, 1993; Lew and Reed,
1993). Then, by putting Cln2 under control of the Cln3 promoter, a subsequent study (Levine et al., 1996) showed that Cln2 and Cln3 still differed in their ability to promote viability in certain genetic backgrounds although this study did not take into account different post-translational regulation of cyclins. This clearly showed that the difference between Cln2 and Cln3 is not simply due to their difference in the timing of expression and of expression levels. Budding yeast
29
mitotic cyclin, Clb2, expressed from Clb5 promoter, is not as potent as Clb5 in promoting the onset of DNA replication (Cross et al., 1999) and conversely, a proteolysis-resistant Clb5 is unable to inhibit mitotic exit when overexpressed, unlike a similar Clb2 allele (Jacobson et al., 2000). Similarly, in metazoans, cyclin
D2 and D3 can prevent differentiation of 32D myeloid cells when stimulated by granulocycle colony-stimulating factor but cyclin D1 is unable to do this job (Kato and Sherr, 1993). In mice, replacing cyclin D1 coding sequence with cyclin E, resulted in normal cell cycle progression, but a detailed investigation found that cyclin E failed to fully recapitulate cyclin D1 specific events like Rb phosphorylation, but instead bypassed the need for cyclin D1 whose main job is to promote cyclin E-CDK2 activity (Geng et al., 1999).
Cyclin-CDKs employ several different mechanisms to specifically select their substrates. The very first selection happens at the level of the CDK active site. In order to get phosphorylated by CDK, a substrate has to have either a full consensus sequence (S/T-P-x-R/K) or at least a minimal consensus sequence
(S/T-P) (Beaudette et al., 1993; Nigg, 1993a, b; Songyang et al., 1994). In a crystal structure of metazoan cyclinA with CDK2, a substrate-derived peptide containing the consensus site is shown to present the consensus residues to the active site of the CDK, with no direct contact with cyclinA (Brown et al., 1999).
Interestingly, in most cases, CDK phosphorylation sites are located in poorly conserved and intrinsically disordered part of the substrates (Holt et al., 2009;
30
Moses et al., 2007a; Moses et al., 2007b). One recent study in budding yeast has shown that different cyclins can, however, activate the same CDK1 holoenzyme to different extents, thereby altering the substrate specificity at the active site of the CDK (Koivomagi et al., 2011b). Mechanisms controlling this effect on activity are not well understood but may involve different modulations of the enzymatic efficiency of the CDK active site by different cyclins as observed for mammalian cyclins B1 and A2 with CDK2 (Brown et al., 2007).
Not only can cyclins indirectly influence CDK’s substrate specificity, but they can also perform a more direct role in choosing substrates. Many B-type cyclins contain a hydrophobic patch (hp) composed of some version of a Met-Arg-Ala-
Ile-Leu (M-R-A-I-L) sequence that binds to a Arg-x-Leu-Ф or Arg-x-Leu-x
Ф (where x is any amino acid and Ф is large hydrophobic amino acid) motif, commonly referred to as the RxL motif (Adams et al., 1996; Cross and Jacobson,
2000; Kelly et al., 1998; Schulman et al., 1998). The RxL docking site has a dramatic impact on the efficiency of phosphorylation of a substrate by some cyclin-CDK complexes while not by others (Schulman et al., 1998; Takeda et al.,
2001; Ubersax and Ferrell, 2007). One study found that the RxL motif increased the catalytic efficiency of phosphorylation at a minimal consensus (simply S/T-P) site, but did not affect the full consensus site much (Stevenson-Lindert et al.,
2003). This suggests that suboptimal phosphorylation sites coupled with a cyclin specific docking motif can be a method for promoting substrate selectivity of CDK
31
complexes. Suboptimal sites will ensure that the phosphorylation site is not favored by any of the CDK forms while a cyclin specific docking motif may increase the local concentration of a particular form of the CDK around the substrate, enough to favor even a slow reaction at the CDK active site. Using linkers of varying length between the RxL motif and the CDK sies, one study suggested that both regions must be simultaneously bound to the cyclin-CDK to maximize the phosphorylation of a substrate (Takeda et al., 2001). The structure of mammalian cyclin A-CDK2 with the CKI p27Kip1 and a peptide for the transcription factor p107, show that the RxL docking site binds to a surface exposed hydrophobic patch (hp) on the cyclin (Brown et al., 1999). This hp site is conserved in all cyclins A, B, D, E, in higher eukaryotes and in S-phase cyclins
(Clb5/6) in budding yeast (Brown et al., 1999; Cross and Jacobson, 2000; Cross et al., 1999). Mutating the hp region disrupts function in vivo and reduces enzymatic activity on RxL containing substrates in vitro (Adams et al., 1996; Loog and Morgan, 2005; Schulman et al., 1998). In yeast, the S-phase cyclin Clb5 interacts with a number of substrates in an hp dependent manner (Archambault et al., 2005; Wilmes et al., 2004). On the contrary, budding yeast mitotic cyclins
Clb1 and Clb2 do not seem to depend so much on their hydrophobic patch (Loog and Morgan, 2005) in choosing substrates and at the sequence level, the hp region of Clb1/2 looks different than the hp regions of other B-type cyclins
(Archambault et al., 2005), although it may be involved in interacting with the
Swe1 kinase which is both a substrate and a regulator of Clb2 (Asano et al.,
32
2005; Harvey et al., 2005; Hu and Aparicio, 2005; Hu et al., 2008; Keaton et al.,
2007). Recent work on budding yeasts G1/S cyclins, show that they too contain a region which can interact with LLPP type hydrophobic sequences in certain substrates (Bhaduri and Pryciak, 2011; Koivomagi et al., 2011a; Koivomagi et al.,
2011b) and we will present evidence in this dissertation that the substrate- binding region in G1/S cyclin Cln2 is close to but not same as the MRAIL region in B-type cyclins (Chapter 3).
The substrate specificity of different cyclin-CDK complexes are also regulated through differential localizations of cyclins (Pines, 1999). Localizations of cyclins to particular compartments may help control their access to both substrates and regulators, and thereby affect their functions. For example, mammalian cyclins
B1 and B2 localize to microtubules and the Golgi apparatus, respectively. At the microtubule, cyclin B1 reorganizes nuclear, cytoskeletal and membrane compartments whereas cyclin B2 helps disassemble the Golgi apparatus. By making chimeras between cyclin B1 and B2, it was possible to switch their roles
(Draviam et al., 2001). In budding yeast, G1 cyclin Cln3 is primarily nuclear and it correlates well with its role of phosphorylation of the transcriptional repressor
Whi5. Forcibly excluding Cln3 from the nucleus makes Cln3-CDK1 largely nonfunctional in this capacity. Likewise, most of Cln2’s functions correlate well with its largely cyctoplasmic and bud tip localization pattern. However, restricting
Cln2 solely to the cytoplasmic compartment compromises some of its functions,
33
thus suggesting that Cln2 also has an important nuclear role. Quite interestingly, targeting Cln3 to the cytoplasm gives it a limited ability to carry out some of the cytoplasmic roles of Cln2. For example, cytoplasmically targeted Cln3, but not wild type Cln3, can somewhat rescue a cln1Δcln2Δpcl1Δpcl2Δ cell, which is inviable (Edgington and Futcher, 2001; Miller and Cross, 2000, 2001a, b). These results demonstrate that cyclin localization can control its substrate specificity.
There are numerous other examples of how in vivo functions of cyclins are controlled by their subcellular localizations (Baldin et al., 1993; Cardoso et al.,
1993; Diehl and Sherr, 1997; Hagting et al., 1998; Hood et al., 2001; Knoblich et al., 1994; Lukas et al., 1994; Maridor et al., 1993; Ohtsubo et al., 1995; Pines and Hunter, 1991).
Of course, apart from the above-mentioned mechanisms, the ability of individual cyclin-CDK complexes to act on particular substrates is also influenced by their patterns of expression; i.e., whether they are co-expressed at the same cell cycle stage, versus at non-overlapping stages, and their different susceptibility to activating or inhibiting factors (Bloom and Cross, 2007).
Inhibition of CDKs by CKIs
CDK inhibitors play a very important role in regulating the activity of various cyclin-CDK complexes. In mammalian cells there are two different families, the
34
INK4 family that inhibits CDK4/6 (Guan et al., 1994; Hannon and Beach, 1994;
Hirai et al., 1995; Serrano et al., 1993; Sherr and Roberts, 1999) and the Cip/Kip family that inhibits mainly G1 and S phase cyclin-CDK complexes (el-Deiry et al.,
1994; Harper et al., 1993; Polyak et al., 1994a; Polyak et al., 1994b; Toyoshima and Hunter, 1994; Xiong et al., 1993). INK4 proteins make heterodimers with
CDK4/6 and force the CDK to assume a conformation where it can no longer bind the cyclin and hence becomes inactive (Brotherton et al., 1998; Russo et al.,
1998). Cip/Kip family of CKIs can engage both the cyclin and the CDK subunit
(Chen et al., 1995; Luo et al., 1995; Nakanishi et al., 1995) to bring about effective inhibition. In fact the crystal structure of mammalian cyclin A-CDK2 with the CKI p27Kip showed that p27 engaged the cyclin A hydrophobic patch region by presenting a LFG motif and the CDK active site was engaged by a region in p27 that mimicked the interactions of the ATP (Russo et al., 1996). A member of the same family, p21, has been shown to inhibit cyclinB-CDK1 under special circumstances (Charrier-Savournin et al., 2004; Satyanarayana et al.,
2008).
In budding yeast there are three known CDK1 inhibitors, which regulate different stages of the cell cycle. One of them, Sic1, inhibits mainly S phase cyclin Clb5/6-
CDK1 complexes and regulates the commitment step of the cell cycle (Yang et al., 2013) (discussed above) and another one, Cdc6, likely inhibits mitotic cyclin-
CDK1 complexes when overexpressed and helps regulate mitotic exit
35
(Archambault et al., 2003; Bueno and Russell, 1992; Calzada et al., 2001;
Elsasser et al., 1996). A third CKI in budding yeast, Far1, is mainly involved in regulating the mating pathway and is important for pheromone-induced arrest of cell cycle at G1 (Chang and Herskowitz, 1990). Far1 inhibits the Cln1/2-CDK1 complexes (Peter and Herskowitz, 1994) but not others (Chapter 4).
Focus of this dissertation
This dissertation focuses on the mechanism of the substrate specificity of budding yeast G1/S cyclin-CDK complexes, the Cln1/2-CDK1 complexes. In
Chapter 2, we will present evidence that several CDK1 substrates contain a particular type of docking motif that can only bind to Cln1/2 and not other yeast cyclins. This results in high cyclin specificity during the early cell cycle. One can switch the cyclin specificity simply by switching the docking motif. In Chapter 3, we show that Cln2 contains a highly conserved substrate-docking motif, which is close to, but in a different region than, the hydrophobic patch region found in most B-type cyclins. Mutating this patch in Cln2 has a variety of negative effects on cell cycle progression, the major effect being the significant increase in cell size at the time of commitment to a new cell cycle (Whi5 export, budding and
DNA replication). In Chapter 4, we will elucidate the mechanism of action of the
CKI Far1. Our results indicate that Far1 inhibits Cln2-CDK1 complex partially by inhibiting Cln2’s substrate binding and partially by inhibiting the activity of the
36
complex. In Chapter 5, we show that this method of substrate recognition is highly conserved in G1 cyclins of several fungal species as distant as molds and mushrooms and that some of this fungal cyclins have evolved to have unusually high potency, which may give them ability to regulate cell cycle events differently.
37
CHAPTER II
Cyclin-specific docking motifs promote phosphorylation of
yeast signaling proteins by G1/S CDK complexes
The following Chapter contains the manuscript:
Bhaduri, S. & Pryciak, P. M. (2011). Cyclin-specific docking motifs promote phosphorylation of yeast signaling proteins by G1/S CDK complexes. Current
Biology, 21(19), 1615-1623 (selected amongst the top 25 Hottest Articles in
Current Biology between October to December 2011) [PMID: 23817205]
I solely performed all experiments presented. The manuscript was prepared by myself and Dr. Peter Pryciak.
38
Abstract
The eukaryotic cell cycle begins with a burst of CDK phosphorylation. In budding yeast, several CDK substrates are preferentially phosphorylated at the G1/S transition rather than later in the cell cycle when CDK activity levels are high.
These early CDK substrates include signaling proteins in the pheromone response pathway. Two such proteins, Ste5 and Ste20, are phosphorylated only when CDK is associated with the G1/S cyclins Cln1 and Cln2, and not G1, S, or
M cyclins. The basis of this cyclin specificity is unknown.
Here we show that Ste5 and Ste20 have recognition sequences, or “docking” sites, for the G1/S cyclins. These docking sites, which are distinct from
Clb5/cyclin A-binding “RxL” motifs, bind preferentially to Cln2 and Cln1. They strongly enhance Cln2-driven phosphorylation of each substrate in vivo, and function largely independent of position and distance to the CDK sites. We exploited this functional independence to re-wire a CDK regulatory circuit in a way that changes the target of CDK inhibition in the pheromone response pathway. Furthermore, we uncover functionally active Cln2 docking motifs in several other CDK substrates. The docking motifs drive cyclin-specific phosphorylation, and the cyclin preference can be switched by using a distinct motif.
Our findings indicate that some CDK substrates are intrinsically capable of being phosphorylated by several different cyclin-CDK forms, but they are inefficiently
39
phosphorylated in vivo without a cyclin-specific docking site. Docking interactions may play a prevalent but previously unappreciated role in driving phosphorylation of select CDK substrates preferentially at the G1/S transition.
40
INTRODUCTION
Cyclin-dependent kinases (CDKs) are central regulatory enzymes of the eukaryotic cell cycle (Morgan, 2007). In most eukaryotes, different CDK forms are specialized for driving distinct events in the cell cycle. In metazoans, these forms can differ in both the cyclin subunit and the CDK enzyme. In simpler eukaryotes such as yeasts, a single CDK enzyme associates with multiple different cyclins, which impart different functional properties to the cyclin-CDK complex. The ways in which the cyclin affects these properties are understood partly though still incompletely. For example, cyclins can affect the specific activity of the CDK enzyme, the interaction with particular substrates, or the targeting to distinct subcellular locations (Bloom and Cross, 2007; Ubersax and
Ferrell, 2007).
In the budding yeast Saccharomyces cerevisiae, a single CDK protein
(Cdc28) associates with nine different cyclins (Bloom and Cross, 2007; Enserink and Kolodner, 2010). Six B-type cyclins (Clb1-Clb6) drive DNA synthesis and mitosis (S and M phases), whereas the transition from G1 to S phase is driven by the G1 cyclin Cln3 and the G1/S cyclins Cln1 and Cln2. Although there is functional overlap, these various cyclins are clearly specialized for optimum performance of discrete tasks. Even the three semi-redundant Cln proteins show functional distinctions, as cln3∆ and cln1∆ cln2∆ cells each display unique
41
phenotypic defects (Cross, 1988; Moffat and Andrews, 2004; Nash et al., 1988;
Skotheim et al., 2008). Interestingly, there are several CDK substrates whose phosphorylation peaks during maximum expression of Cln1/2 (McCusker et al.,
2007; Oehlen and Cross, 1998; Strickfaden et al., 2007; Wu et al., 1998), and it is not clear why later cyclins are less effective; e.g., despite the fact that the M- phase cyclin Clb2 confers especially strong CDK activity (Loog and Morgan,
2005), some substrates are phosphorylated more readily by Cln2-Cdc28 than by
Clb2-Cdc28. To date, no molecular mechanism explains why any particular substrate is preferentially phosphorylated in a Cln1/2-specific manner.
Cln1/2-specific substrates include proteins in the pheromone response pathway. This signaling pathway triggers a G1 phase arrest that synchronizes cells prior to mating (Bardwell, 2005; Dohlman and Thorner, 2001). In cells that have already begun the cell cycle, this pathway is transiently inactivated so that cell division can conclude (Oehlen and Cross, 1994; Wassmann and Ammerer,
1997). Three proteins in this pathway are phosphorylated at the G1/S transition:
Far1 (a CDK inhibitor protein), Ste20 (a PAK-family kinase), and Ste5 (a MAP kinase cascade scaffold protein) (McKinney et al., 1993; Oehlen and Cross,
1998; Strickfaden et al., 2007; Wu et al., 1998). While the role of Ste20 phosphorylation remains unknown (Oda et al., 1999), CDK phosphorylation of
Far1 and Ste5 inactivates the cell cycle arrest and signal transduction functions of the pheromone pathway, respectively (Henchoz et al., 1997; McKinney et al.,
42
1993; Strickfaden et al., 2007). Notably, Ste20 and Ste5 are Cln1/2-specific substrates (Oehlen and Cross, 1998; Strickfaden et al., 2007; Wu et al., 1998), but the mechanistic basis of this specificity is unknown. S-phase cyclins such as mammalian cyclin A and yeast Clb5 have a “hydrophobic patch” that allows them to recognize specific “RxL” motifs in some substrates (Cheng et al., 2006;
Schulman et al., 1998; Wilmes et al., 2004). Some related examples exist for other cyclins (Dowdy et al., 1993; Kelly et al., 1998), but not for the yeast G1 or
G1/S cyclins. Moreover, as with many CDK substrates, Ste20 and Ste5 are each phosphorylated at a large number of sites, and this can be important for proper regulation (Strickfaden et al., 2007).
In this study we probe the molecular basis of cyclin specificity during G1/S
CDK phosphorylation in vivo. We find that both Ste5 and Ste20 have specific recognition sequences, or “docking” sites, that interact preferentially with the cyclin Cln2. In each protein, the docking sites promote efficient phosphorylation of CDK sites, and they do so in a cyclin-specific manner. Furthermore, these docking sites function largely irrespective of distance or orientation relative to the phosphorylation sites, and they are interchangeable between substrates. We identify functionally similar behavior for motifs in several other CDK substrates, suggesting that these docking sites may represent the first of many previously unrecognized recognition sequences for the G1 or G1/S cyclins in yeast.
43
RESULTS
Cyclin-specific phosphorylation of Ste5 and Ste20.
Pheromone responsiveness rises and falls in opposition to the periodic fluctuations in Cln1/2 levels (Oehlen and Cross, 1994; Wassmann and Ammerer,
1997). Similarly, both Ste20 and Ste5 are phosphorylated in a periodic pattern dependent on Cln1/2 cyclins (Oehlen and Cross, 1998; Strickfaden et al., 2007;
Wu et al., 1998). To investigate the basis of this cyclin specificity, we asked if it is an intrinsic feature of the CDK phosphorylation sites themselves or if it involves other structural or functional features of each substrate protein. Ste5 and Ste20 are large, multi-domain proteins (>900 residues) that can be roughly divided into
N-terminal regulatory/localization regions and C-terminal catalytic/signaling regions (Figure 2.1A). In each case the CDK sites are concentrated in the N- terminal regions. Using N-terminal fragments of each protein (Ste51-370, Ste51-337,
Ste2080-590) as substrates, we found that cyclin specificity was maintained. First, their phosphorylation in synchronous cultures peaked at the G1/S boundary (bud emergence; Figure 2.1B) instead of at times when the M-phase cyclin Clb2 was maximal. Second, when using the inducible GAL1 promoter (PGAL1) to drive expression of various cyclins, phosphorylation of the Ste5 and Ste20 fragments was observed only with Cln1 and Cln2, and not with Cln3, Clb5, or Clb2 (Figure
2.1C). (Although unequal levels of cyclins could contribute to these differences,
Clb2 was able to drive phosphorylation of the CDK substrate Swe1 [Figure 2.1C]
(Harvey et al., 2005), and later results will show activity for both Clb5 and Clb2 in
44
Figure 2.1. Cyclin specific phosphorylation of Ste5 and Ste20 regulatory domains
(A) Domain structures of Ste5 and Ste20. Red circles indicate CDK sites (Oda et al., 1999; Strickfaden et al., 2007); in Ste20, only the 13 confirmed sites (of 23 possible) are shown.
(B) Phosphorylation of Ste5 and Ste20 fragments in synchronous cdc15-2 cultures, after release from M phase arrest. Full-length Ste20 is shown for comparison; its phosphorylation behavior was described previously (Oehlen and
Cross, 1998; Wu et al., 1998). Cell cycle progression was monitored by anti-Clb2 immunoblot and by budding; representative examples are shown.
(C) HA-tagged Ste5 or V5-tagged Ste20 fragments, expressed from native promoters, were monitored after galactose-induced expression of GST-tagged cyclins. Reduced electrophoretic mobility signifies phosphorylation, as confirmed by phosphatase treatment (Appendix Figure 1). For comparison, V5-tagged
Swe1 demonstrates activity for Clb2. The relative expression levels for GST- cyclins were highly reproducible; one representative example is shown. A variant of Cln3 lacking ten CDK sites (Cln310A) was used to increase its stability. Results were similar in sic1∆ cells (Appendix Figure 2), in which the Clb-CDK inhibitor
Sic1 is absent.
45
Figure 2.1. Cyclin specific phosphorylation of Ste5 and Ste20 regulatory domains
A regulation signaling
Ste5 PM RING K PH VWA 337 917
regulation signaling
Ste20 BR CRIB P kinase 590 939
B time after cdc15-2ts release (min.) 0 20 40 60 80 100 120 140 160 180
Ste5 1-370
Ste20 80-590
Ste20 1-939
Clb2
small 100 buds 50 (%)
0
C PGAL1- GST- 10A 10A Cln2 Cln1 Clb5 Clb2 Cln2 Cln1 Clb5 Clb2 vector vector cyclin: Cln3 Cln3
Ste5 1-337
Ste20 GST 80-590
Swe1
46
similar assays). Thus, stage-specific and cyclin-specific phosphorylation of Ste5 and Ste20 does not require their signaling functions, and the determinants of specificity must lie within their N-terminal fragments.
A distal recognition sequence promotes CDK phosphorylation of the Ste5
N-terminus.
We used the Ste51-337 fragment to study the requirements for phosphorylation by
Cln2-Cdc28. As expected, phosphorylation required the same 8 CDK sites shown previously to regulate full-length Ste5 (Figure 2.2B) (Strickfaden et al.,
2007). Nevertheless, these sites were not sufficient to ensure efficient phosphorylation. By making further truncations, we discovered that phosphorylation required a short stretch of sequence (276-283) far away from the
CDK sites (Figure 2.2B). Similarly, alanine replacement of four residues within this region (LLPP) also disrupted phosphorylation (Figure 2.2B). In contrast, internal deletions showed that several other large segments of the Ste5 N- terminus were dispensable (Figure 2.2B). We conclude that efficient Cln2-Cdc28 phosphorylation of Ste5 requires specific sequences that are separate from the phosphorylation sites themselves. For now we tentatively refer to this required region as a Cln2 docking site.
This putative Cln2 docking site lies within a larger inter-domain region of Ste5 with several notable features (Figure 2.3A), including: (i) a MAPK binding site; (ii) four MAPK phosphorylation sites, which possibly could also act as CDK sites due
47
Figure 2.2. A distal docking motif promotes Cln2-Cdc28 phosphorylation of
Ste5
(A) Locations of key Ste5 features and mutations. Residues 275-283 contain the putative Cln2 docking motif required for efficient phosphorylation of the N- terminal CDK sites. Mutations used in later panels are indicated; see Figure
2.3A for details.
(B) Phosphorylation of the Ste5 N-terminus (Ste51-337) requires both the CDK sites and a distal LLPP motif between residues 275 and 283. Phosphorylation was triggered by galactose-induced expression of a PGAL1-CLN2 construct (+) or a vector control (-).
(C) The role of the LLPP motif is independent of MAPKs (fus3∆ kss1∆), the phosphatase Ptc1 (ptc1∆), and the MAPK binding site (ND mutant). Results show the Ste51-337 fragment except as indicated otherwise. The fus3∆ kss1∆ strain (PPY1173) was tested in parallel with a congenic wild-type strain
(PPY640). LLPP function also does not require the MAPK phosphorylation sites, but non-phosphorylatable mutations at these sites (4AV) mildly reduce the extent of Cln2-Cdc28 phosphorylation. Also see Figure 2.3B,C.
(D) Cln2-driven phosphorylation of full-length Ste5 (V5-tagged) requires the
LLPP motif. For the 8A lanes, a longer exposure (of the same blot) is shown to compensate for imperfect loading.
48
(E) Mutation of the LLPP motif disrupts the ability of Cln2 to inhibit pheromone signaling. Fus3 phosphorylation was monitored in ste5∆ fus3∆ kss1∆ strains (±
PGAL1-CLN2) harboring STE5 variants and wild-type FUS3 on plasmids.
(F) The LLPP motif mediates regulation by Cln2 in the absence of Fus3-Ste5 binding (Ste5 ND mutant) and Fus3 kinase activity (fus3-K42R mutant). Strains
(as in panel D) harbored plasmids with the indicated forms of STE5 and FUS3.
49
Figure 2.2. A distal docking motif promotes Cln2-Cdc28 phosphorylation of
Ste5
A 275 YSPLLPPFG 283 D
Ste5 PM RING K PH VWA ND 102 337 917 Ste5 allele: 8A wt LLPP ND LLPP P -CLN2: 8A Cdk phosphorylation sites GAL1 - + - + - + - + - + LLPP Cln2 & Ptc1 docking ND MAPK docking full-length 4AV blocks MAPK phosphorylation Ste5 4E mimics MAPK phosphorylation B E wt 8A 1-337 1-315 1-300 1-283 1-275 1-262 PGAL1 CLN2: - + - + - + - + - + - + - + - + factor (min.) Ste5 PGAL1 α allele CLN2 0 5 15 30 45 60 0 5 15 30 45 60
wt -
∆124 ∆152 ∆177 ∆239 wt + PGAL1 wt LLPP -151 -173 -229 -256 CLN2: - + - + - + - + - + - + 8A +
LLPP +
phospho-Fus3 total Fus3
C wild type fus3∆ kss1∆ ptc1∆ F 1-283 1-283 ND PGAL1 wt LLPP wt LLPP wt LLPP 1-315 1-275 Ste5 allele: wt 8A LLPP ND LLPP CLN2: - + - + - + - + - + - + - + - + PGAL1-CLN2: - + - + - + - + - + FUS3-wt phospho- Fus3 fus3-K42R ND 4AV 4E ND wt LLPP 4AV 4E FUS3-wt PGAL1 LLPP LLPP LLPP total CLN2: - + - + - + - + - + - + - + - + Fus3 fus3-K42R + α factor, 15 min.
50
to similar target sequences (i.e., SP/TP); and (iii) a binding site for the phosphatase Ptc1 (Bhattacharyya et al., 2006; Malleshaiah et al., 2010). None of these features seemed crucial for docking site function. MAPK binding played no evident role, as the results were unaffected by deleting MAPK genes (fus3∆ kss1∆) or by mutating the MAPK binding site (ND mutant) (Figure 2.2C, 2.3B).
At the MAPK phosphorylation sites, phospho-mimetic mutations (4E) had no effect (Figure 2.2C), but non-phosphorylatable mutations (4AV) caused a mild reduction; thus, phosphorylation at one or more of these sites (e.g., by a MAPK or CDK) may enhance further CDK phosphorylation elsewhere, or the mutations may mildly disrupt recognition of the docking motif. (All four MAPK sites cannot be required, because the shorter Ste51-283 fragment retains only two sites yet remains a good substrate; Figure 2.2B,C). Finally, although the required LLPP motif overlaps a binding site for Ptc1 (Malleshaiah et al., 2010), it promoted CDK phosphorylation identically in ptc1∆ cells (Figure 2.2C, 2.3C). Altogether, these data show that recognition of the putative Cln2 docking site can be separated from MAPK and Ptc1 binding, though it may be affected by either the sequence or phosphorylation status of adjacent SP/TP sites. Furthermore, as with the N- terminal fragments, the LLPP motif was also required for CDK phosphorylation of full-length Ste5 (Figure 2.2D).
Next, we tested if the Cln2 docking site is required for CDK inhibition of Ste5 signaling (Strickfaden et al., 2007). Indeed, as with mutation of the CDK sites
51
Figure 2.3. The Cln2 docking region in Ste5, and requirements for CDK phosphorylation and regulation
(A) Expansion of Ste5 residues 258-337, highlighting the following features: (i) a
MAPK binding site (denoted “K” in the schematic above); (ii) four MAPK phosphorylation sites; and (iii) a Ptc1 binding site. Note that the putative Cln2 docking motif identified in this study (LLPP) overlaps the sequence previously implicated in Ptc1 binding (Malleshaiah et al., 2010). Also indicated are the mutations used in Figure 2.2. The ND mutation disrupts MAPK binding
(Bhattacharyya et al., 2006), while 4AV and 4E are non-phosphorylatable and phospho-mimetic mutations that also have opposing effects on MAPK binding
(Malleshaiah et al., 2010).
(B) The ND and ND/LLPP mutant results from Figure 2.2C are shown here in an expanded form that includes additional controls (wt and LLPP) run alongside on the same gel. Also included on this gel were the wt vs. 8A mutant results that are shown in Figure 2.2B.
(C) The results using the ptc1∆ mutant strain that are shown in Figure 2.2C are shown here in parallel with the same fragments analyzed in a wild type strain, conducted in parallel. Note that both wild type and ptc1∆ strains show the same effects of both truncations (e.g., compare 1-315 vs. 1-275) and point mutations
(e.g., compare wt vs. LLPP versions of 1-283). Thus, despite its overlap with the
Ptc1 binding site, the LLPP motif controls Cln2-Cdc28 phoshorylation independent of Ptc1.
52
(D) The ability of PGAL1-CLN2 to inhibit pheromone response is disrupted in a synergistic way by Ste5 mutations in the LLPP motif and the MAPK binding site
(ND). These experiments are related to Figure 2.2E-F, but here pheromone response was measured using a transcriptional reporter (FUS1-lacZ) in either
FUS3 KSS1 strains or fus3∆ kss1∆ strains with a FUS3-wt plasmid (as in Figure
2.2E-F). Bars, mean ± SD (n = 8 [top] or 3 [others]). As shown in Figure 2.2F, when the kinase activity of Fus3 is eliminated, the ability of Cln2 to inhibit pheromone response is fully dependent on the LLPP motif. But when Fus3 is active the behavior is more complex. This is likely because the LLPP motif also binds Ptc1, which antagonizes Ste5-Fus3 association and limits Fus3 mediated negative feedback (Malleshaiah et al., 2010). Consequently, while the LLPP mutation disrupts inhibition by Cln2, it simultaneously increases Fus3-Ste5 binding and inhibition, which may have a compensatory effect. Hence, the impact of the LLPP mutation on regulation by Cln2 is most clearly revealed in three distinct settings: (i) immediately after pheromone stimulation, before negative feedback kicks in (Figure 2.2E); (ii) when using a kinase-dead form of Fus3
(Figure 2.2F); and (iii) when using the ND mutation to disrupt Fus3-Ste5 binding
(Figure 2.2F and this Figure). Finally, because the LLPP mutation seems more effective at restoring Fus3 phosphorylation than transcriptional induction, the transcriptional response may require sustained signaling or it may have a non- linear dependence on Fus3 activation.
53
Figure 2.3. The Cln2 docking region in Ste5, and requirements for CDK phosphorylation and regulation
A Ste5 PM RING K PH VWA 102 337 917
Cln2 dock & Ptc1 binding MAPK binding
KIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIP wt KIPDSELSITPQSRFPPYSPaaaaFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIP LLPP mutant KIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERaTaaSQAPSLNPNLIaAAaPKERaQIPQKKSNYTFLHSPLGHRRIP ND mutant KIPDSELSIaPQSRFPPYaPLLPPFGLSYvPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHaPLGHRRIP 4AV mutant KIPDSELSIePQSRFPPYePLLPPFGLSYePVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHePLGHRRIP 4E mutant
258 275 283 315 337
MAPK phosphorylation sites
B Ste5 1-337 D - PGAL1-CLN2 + PGAL1-CLN2
ND 150 wt 8A wt LLPP ND P LLPP GAL1 FUS3 KSS1 CLN2: - + - + - + - + - + - + 100 120 min. α factor 29 50 24 7.7 0
C 1-283 1-283 150 1-315 1-275 FUS3 kss1∆ P wt LLPP GAL1 100 120 min. α factor CLN2: - + - + - + - + 50 9.1 11 0.71 0 wild type ( β -galactosidase units) strain 30
FUS1-lac Z transcriptional response FUS3 kss1∆ 20 30 min. α factor ptc1∆ 10 1.9 1.0 strain 0.26 0 wt 8A LLPP ND ND LLPP
54
(8A), mutation of the LLPP motif restored the ability of pheromone to activate the
MAPK Fus3 in PGAL1-CLN2 cells (Figure 2.2E). However, this restored activation was unusually transient, and the transcriptional response was only partially restored (Figure 2.3D). This complex behavior likely reflects the additional role of the LLPP region in binding to Ptc1, which antagonizes the ability of Fus3 to bind
Ste5 and down-regulate signaling (Malleshaiah et al., 2010). That is, although the LLPP mutation disrupts Cln2 docking, it simultaneously leads to excessive binding and inhibition by Fus3, which may have a compensatory effect. To eliminate contributions from Fus3, we used the Ste5 ND mutation to disrupt Fus3 binding (Bhattacharyya et al., 2006), or a kinase-inactive form of Fus3 (K42R). In these contexts, the LLPP mutation clearly blocked the inhibitory effect of Cln2
(Figures 2.2F, 2.3D). Therefore, the LLPP motif can mediate CDK inhibition in the absence of both Fus3 binding and kinase activity, whereas excess Fus3 activity may obscure this role. Although the overlap between Cln2 and Ptc1 sites creates an added layer of complexity, overall these results establish that CDK regulation of Ste5 involves both CDK phosphorylation sites and a separate Cln2 docking motif.
Cyclin-specific binding sites in Ste20 and Ste5.
Efforts to test if Ste5 binds Cln2 were hampered by technical issues (e.g., non- specific precipitation), but binding of Ste20 to Cln2 is readily detectable in cell extracts (Archambault et al., 2004; Oda et al., 1999). Therefore, we searched for
55
the responsible sequences in Ste20 using GST-Ste20 and Cln2-myc13 fusions.
An N-terminal fragment (Ste201-333) was sufficient to bind Cln2, and this required residues 73-119 (Figure 2.4B). The C-terminal end of this fragment, which harbors a membrane-binding “basic-rich” (BR) domain, was not required but it did enhance binding (Figure 2.5B); hence, further analyses kept the C-terminus fixed at position 333. The required region (73-119) includes a conserved block of ~20 residues (Figure 2.5C), and mutating consecutive sets of residues in this region revealed that an eight-residue stretch (SLDDPIQF) was critical for binding to
Cln2 (Figure 2.4Ci). We then asked if the role of this Ste20 motif could be replaced with a small fragment from Ste5 that harbors its putative Cln2 docking site. Indeed, the Ste5 site mediated Cln2 binding, and this required the same
LLPP sequence that promotes Ste5 phosphorylation (Figure 2.4Cii).
Furthermore, each sequence preferentially bound to Cln2 over other cyclins
(Figure 2.4D), and weakly to Cln1. Collectively, these experiments identify docking sites in both Ste20 and Ste5 that can discriminate among different cyclins to mediate specific binding. The two sites are not highly similar but each contains the motif LxxPΦxΦ (where Φ is hydrophobic), raising the possibility that a degenerate pattern of hydrophobic side chains forms the Cln2 recognition motif.
56
Figure 2.4. Cyclin-specific binding by docking motifs in Ste20 and Ste5
(A) The diagram indicates endpoints used for mapping the Cln2-binding region in
Ste20, which is outlined in red.
(B) Cells co-expressing GST fusions to Ste20 fragments and Cln2-myc13 were lysed, and complexes were recovered using glutathione sepharose. Input (5%) and bound proteins were analyzed by anti-myc and anti-GST blots.
(C) Starting with a Ste2072-333 fragment, alanine substitutions were made at blocks of residues in the 72-118 region (see Figure 2.5C; numbering starts at 2 because additional flanking mutations were used in other assays). Cln2 binding was tested as in panel B. Separately, the required Ste20 region was replaced by a Ste5263-335 fragment (ii), in both wt and LLPP mutant forms, to test the ability of this Ste5 sequence to mediate Cln2 binding.
(D) Ste20 and Ste5 docking sites show cyclin-specific binding. GST alone (-) or
GST fusions (+) were used to co-precipitate myc13-tagged cyclins (expressed from the CYC1 promoter) in yeast lysates. The GST fusions were to Ste201-333
(Ste20 motif) or to the Ste5263-335-Ste20120-333 chimera used in panel Cii (Ste5 motif). Cln310A showed varying levels of non-specific precipitation but no reproducible binding to either GST fusion.
(E) Cln2-induced phosphorylation was assayed for V5-tagged forms of full-length
Ste20 (1-939) or N-terminal fragments (80-590, 80-500), with or without mutations in the docking site (mut3) or the 13 confirmed CDK sites (CDK*).
57
(F) The Cln2 docking site from Ste20 can drive phosphorylation of a heterologous substrate. Phosphorylation was analyzed using Ste51-283 (i), Ste51-
260 (ii), and wt or mut3 versions of the Ste20 docking site (residues 80-115) fused to Ste51-260 (iii).
58
Figure 2.4. Cyclin-specific binding by docking motifs in Ste20 and Ste5
A Ste20 BR CRIB P kinase 1 72 120 333 590 939
B GST-Ste20: C 2 3 4 5 NNVVSLDDPIQFTRV vector vector 1-939 1-333 72-333 120-333 Ste20 Cln2-myc: - + + + + + (i) BR 72-118 myc input Ste5 (ii) BR myc bound 263-335
GST
input wt mut2 mut3 mut4 mut5 wt LLPP myc bound GST GST bound (i) (ii) D cyclin-myc: none Cln2 Cln1 Cln310A Clb5 Clb2 GST fusion: - + - + - + - + - + - +
myc input Ste20 motif myc bound
myc input Ste5 motif myc bound
E F Ste20 derivative: (i) Ste51-283 PM RING wt mut3 cdk* 1-260 PGAL1 (ii) Ste5 PM RING CLN2: - + - + - + (iii) + Ste2080-115 PM RING 1- 939 (i) (ii) (iii) (iii) wt mut3 PGAL1 80- CLN2: - + - + - + - + 590
80- 500
59
The Cln2 docking site in Ste20 enhances phosphorylation.
Ste20 contains 23 potential CDK sites, of which at least 13 are used in vivo (Oda et al., 1999). To test if Cln2 docking affects Ste20 phosphorylation, we compared mutations in either the docking site (mut3) or the 13 confirmed CDK sites (CDK*), using full-length Ste20 and several N-terminal fragments (Figure
2.4E). In full-length Ste20 (1-939), the docking site mutation reduced the magnitude of the Cln2-induced mobility shift, but did not eliminate it (i.e., unlike the CDK* mutation). This partial phenotype could signify less efficient use of all sites, or a specific defect at particular sites due to their position or sequence context; in this regard, it is noteworthy that 9 of the 13 confirmed CDK sites are
“minimal” sites (S/T-P) whereas only 4 are “consensus” sites (S/T-P-x-K/R). The docking site mutation again caused a partial phenotype for the largest N-terminal fragment (80-590), but it caused a strong disruptive phenotype for smaller fragments such as 80-500 (Figure 2.4E) and 80-333 (Appendix Figure 3). While we did not parse these differences further, we note that the two smaller fragments retain only one consensus CDK site, raising the possibility that docking is especially important for phosphorylating minimal sites. As a separate test of the activity of the Ste20 docking motif, we asked if it could substitute for the analogous site in Ste5. Indeed, the Ste20 motif restored strong phosphorylation to the Ste51-260 fragment, and this activity was blocked by mutations that disrupt Cln2 binding (Figure 2.4Fiii). Thus, the Ste20 docking motif can stimulate Cln2- Cdc28 phosphorylation of native sites in Ste20 or sites
60
Figure 2.5. Ste20-Cln2 binding and conservation of the Cln2 docking site
(A) Diagram of Ste20 showing the location of the Cln2 docking site outlined in red.
(B) Effect of the Ste20 BR domain on binding between GST-Ste20 fragments
1- and Cln2-myc13. Binding assays were conducted as in Figure 2.4B. The Ste20
254 fragment lacks the BR domain, whereas the BR* derivative has mutations at eight basic residues that provide membrane affinity (Takahashi and Pryciak,
2007). Though the BR domain was not required for Cln2 binding, it did enhance both total binding and capture of the slowest migrating Cln2 species. This could imply some subcellular segregation of different Cln2 phosphoisoforms, or that the polybasic BR domain contributes extra affinity for poly-phosphorylated forms of
Cln2. Hence, for simplicity, subsequent analyses kept the C-terminus fixed at position 333.
(C) Conservation of sequences encompassing the Cln2 docking site. The S. cerevisiae Ste20 sequence (at top) was aligned to orthologs from ten other yeasts. Red and blue highlights indicate the most conserved residues. At bottom are residues 80-109 (S. cerevisiae) with brackets indicating blocks of residues replaced with alanines, as used in Figures 2.4C and 2.6C.
61
Figure 2.5. Ste20-Cln2 binding and conservation of the Cln2 docking site
A
Ste20 BR CRIB P kinase 120 1 120 254 333
B
GST-Ste20: 1-333 120-333 1-333 BR* 1-254 Cln2-myc: + + + +
myc bound
GST
C Ste20 BR CRIB P kinase
80 109
1 2 3 4 5 6 7 8 blocks of Ala mutations
62
in a heterologous substrate.
Re-wiring a CDK regulatory circuit via a Ste20Ste5PM chimera.
CDK phosphorylation of Ste5 serves to inhibit pheromone response at the G1/S transition (Strickfaden et al., 2007). We wished to explore whether the responsible regulatory mechanism could be moved to other proteins, and whether such synthetic approaches (Lim, 2010; Pryciak, 2009) could help further probe the factors controlling CDK regulation. Therefore, we attempted to transfer the regulatory effects of CDK phosphorylation from Ste5 onto Ste20. Our rationale stems from the fact that each protein requires a short membrane- binding motif for its plasma membrane localization and signaling activity
(Takahashi and Pryciak, 2007; Winters et al., 2005), and the function of the Ste5 motif, termed the PM domain, is inhibited by phosphorylation at adjacent CDK sites (Strickfaden et al., 2007). Thus, we replaced the membrane-binding (BR) motif in Ste20 with Ste5 fragments that contain both the PM domain and its flanking CDK sites (Figure 2.6A), and then asked if Ste20 now could be inhibited by CDK phosphorylation.
The Ste5 PM domain was a highly effective substitute for the Ste20 BR domain (Figure 2.6B), irrespective of the precise size of the transferred Ste5 fragment. As hypothesized, the function of these Ste20Ste5PM chimeras in the
63
Figure 2.6. Re-wiring a CDK regulatory circuit with a Ste20Ste5PM chimera
(A) The Ste20Ste5PM chimeras. Ste20 residues 124-311, containing the membrane-binding BR domain, were replaced with three fragments from Ste5 that include its membrane-binding PM domain plus 7 or 8 flanking CDK sites.
(B) Pheromone signaling by Ste20Ste5PM chimeras is inhibited by Cln2. Because
Cln2-CDK normally inhibits signaling via Ste5, these tests used cells with a non- phosphorylatable Ste5 variant (ste20∆ STE5-8A). Wild-type Ste20 (wt) or
Ste20Ste5PM chimeras (from panel A) were introduced on plasmids, and pheromone response was measured using a transcriptional reporter (FUS1- lacZ). Signaling by all three chimeras (#A, #B, #C) was inhibited by Cln2, but this was blocked by mutations in the CDK phosphorylation sites (7A, 8A). Deletions of the Ste20 N-terminus, made in the #A chimera, show that residues 87-119 are required for regulation by Cln2. Bars, mean ± SD (n = 3).
(C) Sequences required for regulation by Cln2 were analyzed using a chimera similar to #A, containing only Ste20 residues 80-109 upstream of Ste5 1-85 (see
Figure 2.7C). Alanine mutations replaced eight blocks of residues (left) or individual residues in the SLDDPIQF motif (right). These were compared to an un-mutated sequence (wt) and a chimera that lacks the sequence entirely (-).
Signaling was assayed as in panel B. Bars, mean ± SD (n = 3).
(D) Docking sites from Ste20 (80-115) or Ste5 (257-330) were inserted at different positions (i-iv) into a variant of chimera #A that lacks residues 87-119
64
(see panel B). Insertions at position ii also removed residues 1-86. Signaling was assayed as above. Bars, mean ± SD (n = 3).
(E) Bud tip localization of Ste20Ste5PM chimera in cycling cells is inhibited via the
CDK sites (7A) and the Cln2 docking site (mut3). Strain BY4741 harbored GFP-
Ste20 plasmids. Representative images show unfixed cells (left); localization was quantified after formaldehyde fixation (right). Bars, mean ± SD (n = 3 experiments; >150 cells per allele per experiment).
(F) The growth function of Ste20 is inhibited in the Ste20Ste5PM chimera, if CDK and docking sites are intact. Serial (1/5x) dilutions of strain KBY211 harboring the indicated Ste20 plasmids were spotted onto plates, and incubated at 25˚ or 36˚ C for 4 days. As a control, the ∆BR allele removes the BR domain in full-length
Ste20 (Takahashi and Pryciak, 2007).
65
Figure 2.6. Re-wiring a CDK regulatory circuit with a Ste20Ste5PM chimera
A 72 119 B - PGAL1-CLN2 + PGAL1-CLN2 140 Ste20 BR CRIB P kinase 120 Ste20Ste5PM CRIB P kinase 100 chimeras 80 #A PM (1-85) (%) 60 #B PM (1-125) 40 #C PM (1-176) 20 pheromone response 0 7A mutated Cdk sites 8A Ste20 none wt #A #A #B #B #C #C ∆1- ∆1- ∆87- plasmid: 7A 8A 8A 119 72 119 C Ste20 DDDNNVVSLDDPIQFTRVSSSSVISGMSSS #A 80-109: D i ii iii iv 1 2 3 4 5 6 7 8
myc13 PM CRIB P kinase - PGAL1-CLN2 + PGAL1-CLN2 120 120 100 100 - PGAL1 80 pheromone 80 CLN2 response 60 60 (%) + PGAL1 40 CLN2 40 20 20 location:0 pheromone response (%) - i ii iii iv ii iii 0 inserted dock: Ste20 Ste5 - wt 1 2 3 4 5 6 7 8 S L D D P I Q F
40 ts E WT #A F ste20∆ cla4∆ + cla4-75 25˚ C 36˚ C 30 vector 20 wild type 7A mut3 ∆BR 10 #A #A-7A
bud tip localization (%) 0 #A-mut3 #A 7A mut3
66
pheromone response pathway was inhibited by expression of Cln2 (Figure 2.6B).
(Because Cln2 ordinarily inhibits pheromone response via Ste5, these assays used cells harboring a CDK-resistant derivative, Ste5-8A.) Importantly, this inhibition specifically required intact CDK sites flanking the PM domain (Figure
2.6B), despite the presence of other CDK sites elsewhere in Ste20. Moreover, the inhibition was cyclin-specific and was not accompanied by any reduction in protein levels (Figures 2.7A,B). Thus, these experiments show that the CDK regulatory target in the pheromone pathway can be switched to a different protein, and that the CDK-inhibited domain from Ste5 constitutes a portable regulatory module. Furthermore, inhibition of the Ste20Ste5PM chimera required the region of Ste20 (residues 87-119) that contains its Cln2 docking site (Figure
2.6B, right). This finding establishes two further points: (i) the mere presence of
CDK sites in the transferred Ste5 fragment is insufficient to make it an effective target of CDK down-regulation; and (ii) the Cln2 docking site in Ste20 can control functional regulation via CDK phosphorylation.
We used the Ste20Ste5PM chimera to dissect which docking site residues were required for regulatory activity. This function was fully contained in a 30-residue region (80-109) spanning the conserved stretch noted earlier (Figure 2.7C), and it required the same 8-residue motif involved in Cln2 binding (SLDDPIQF) (Figure
2.6C, left). Notably, no single residue in this motif was absolutely required, though partial phenotypes were seen for mutations at the L, P, and F residues
67
Figure 2.7. Ste20Ste5PM chimeras: cyclin specificity, protein levels, and minimal motif
(A) Inhibition of Ste20Ste5PM signaling is cyclin specific. A ste20∆ STE5-8A strain
(PPY2142) was co-transformed with plasmids expressing a Ste20Ste5PM chimera
(see Figure 2.6A) and a galactose inducible cyclin construct (or a vector control).
Pheromone response was assayed as in Figure 2.6B. Signaling was inhibited strongly by Cln2 and partially by Cln1, each of which was blocked by mutating the CDK sites (7A). Signaling was unaffected by Cln310A or Clb5. Expression of
Clb2 inhibited signaling regardless of the CDK sites, and hence this is most likely due to pleiotropic effects on cell physiology resulting from prolonged high levels of Clb2 produced by this construct (which is eventually lethal). Bars, mean ± SD
(n = 4).
(B) Protein levels of Ste20Ste5PM chimeras are not affected under conditions in which pheromone signaling is inhibited. Top, the same strains, plasmids, and treatment conditions used to analyze signaling in Figure 2.6B were used to prepare cell extracts for protein analysis by immunoblotting. Equal amounts of protein were loaded in each case (20 µg/lane). Note that in no case does PGAL1-
CLN2 cause a reduction in protein levels. Also note that in the absence of the
PM-proximal CDK sites (7A), the chimera is still phosphorylated at native sites in
Ste20 and yet signaling is not inhibited (see Figure 2.6B); this demonstrates that down-regulation is not achieved by phosphorylation elsewhere in the protein but instead specifically requires that phosphates are added adjacent to the PM
68
domain. Bottom, a similar analysis was performed using myc13-tagged chimeras, showing results analogous to the GFP-tagged chimeras.
(C) Deletions and truncations were used to show that Ste20 residues 80-109 constitute a minimal motif sufficient to mediate Cln2 inhibition of the chimeras.
Signaling was assayed as in Figure 2.6B. Bars, mean ± SD (n = 3-4).
69
Figure 2.7. Ste20Ste5PM chimeras: cyclin specificity, protein levels, and minimal motif
A Ste20Ste5PM chimera: #A C #A-7A 120 Cln2 100 PM inhibition 80 + 1-284 CRIB P kinase 60 + 1-123 CRIB P kinase 40 - 1-86 CRIB P kinase 20 + 73-123 CRIB P kinase pheromone response (%) 0 + 80-115 CRIB P kinase PGAL1-cyclin: Cln2 Cln1 Clb2 Clb5 none + 80-109 CRIB P kinase Cln3-10A Cln3-10A - wt BR CRIB P kinase B #A
#A ∆1- ∆1- ∆87- GFP-Ste20: none wt #A 7A 119 72 119 - PGAL1-CLN2 + PGAL1-CLN2 PGAL1-CLN2: - + - + - + - + - + - + - + 125 100 short pheromone exposure response 75 (% of wt) 50 25 long exposure 0
Ste20 plasmid: wt 1-86 1-284 1-123 73-123 80-115 80-109 #A myc -Ste20: none wt #A 13 7A
PGAL1-CLN2: - + - + - + - +
short exposure
long exposure
70
(Figure 2.6C, right). Thus, Cln2 docking may involve contacts distributed throughout the motif. We also found that docking site function is highly flexible, as it remained active when placed on either side of the PM domain and up to
~280 residues from the nearest CDK site (Figure 2.6D). Moreover, the docking site from Ste5 could also function in the chimera (Figure 2.6D, right). Finally, additional tests showed that the CDK regulation conferred upon the Ste20Ste5PM chimera is not limited to pheromone response or to over-expressed Cln2.
Specifically, Ste20 performs additional functions in cycling cells, and its ability to localize to growing bud tips, or to sustain viability in the absence of the related
PAK Cla4, requires plasma membrane contact (Leberer et al., 1997; Peter et al.,
1996; Takahashi and Pryciak, 2007). These abilities were inhibited in the
Ste20Ste5PM chimera in a manner that required both docking and CDK sites
(Figure 2.6E, F). Hence, the chimera converts Ste20 from a multi-functional kinase into a form that is restricted to functioning in non-cycling cells. Altogether, the results clearly reveal the feasibility of creating new CDK regulatory circuits via a combination of Cln2 docking and CDK phosphorylation sites, and they establish the Ste20Ste5PM chimera as a functionally flexible platform with which to assay docking site activity.
Functional Cln2 docking sites in other CDK substrates.
To assess whether the Cln2 docking behavior seen with Ste5 and Ste20 might be more widespread, we searched for similar sites in other CDK substrates.
71
Matches to the LxxPΦxΦ motif or the core Ste5 site (LLPP) were too numerous for a proteome-wide analysis. Nevertheless, we scanned the sequences of known Cln1/2-Cdc28 targets and Cln2 binding partners, plus Cdc28 substrates found in large-scale screens (Archambault et al., 2004; Enserink and Kolodner,
2010; Holt et al., 2009; Ubersax et al., 2003), for Leu/Pro-rich sequence motifs that are conserved among fungal orthologs and that lie outside of known or predicted structural domains. Although not comprehensive, as an initial test case we chose seven such sequences (from Sic1, Whi5, Srl3, Bem3, Tus1, Exo84, and Pea2; see Figure 2.9), including one recently implicated in Cln2-Cdc28 phosphorylation of Sic1 (Koivomagi et al., 2011b). We then tested these sequences for their ability to functionally substitute for the Ste5/Ste20 docking sites, using two experimental settings: (i) Cln2 inhibition of signaling by the
Ste20Ste5PM chimera; and (ii) Cln2-driven phosphorylation of the Ste5 N-terminus.
Remarkably, the majority of these sequences had measurable activity. In the signaling assays (Figure 2.8A), they mediated Cln2 inhibition to varying degrees, from strong (Sic1, Whi5, Exo84) to moderate (Tus1, Pea2) to weak (Bem3); only the Srl3 sequence was ineffective. Importantly, their inhibitory effects were a specific response to Cln2 expression, and no non-specific effects were seen.
The three most potent sequences contain exact matches to the Ste5 LLPP motif
(Figure 2.9B), though it is notable that each was in fact more potent than the
Ste5 sequence in these assays (Figure 2.8A); thus, additional context features
72
Figure 2.8. Identification of additional candidate Cln2 docking sites
(A) Candidate Cln2 docking sites from seven CDK substrates (see Figure 2.9) were inserted into a Ste20Ste5PM chimera lacking the endogenous docking site.
These derivatives were compared to chimeras containing the Ste5 or Ste20 docking sites inserted at the same position, or no docking site (none). Cln2 inhibition of pheromone response was assayed as in Figure 2.6. Bars, mean ±
SD (n = 5).
(B) The same candidate docking sites used in panel A were inserted at the end of a Ste5 fragment (Ste51-260) that lacks its endogenous docking site, and Cln2- driven phosphorylation was assayed. See Figure 2.9C for additional repetitions.
73
Figure 2.8. Identification of additional candidate Cln2 docking sites
A candidate docking sites
myc13 PM CRIB P kinase
- PGAL1-CLN2 + PGAL1-CLN2 140 120 100 80 60 40 20 pheromone response (%) 0 insert: Srl3 none Ste5 Sic1 Tus1 Pea2 Ste20 Whi5 Bem3 Exo84 B
PM RING Ste5 1-337 Ste5 1-260 + candidate dock
wt Srl3 LLPP Ste20 Sic1 Whi5 Bem3 Tus1 Exo84 Pea2 PGAL1 CLN2: - + - + - + - + - + - + - + - + - + - +
short exp.
long exp.
74
likely influence the efficacy of this motif. Similarly, the Pea2 sequence closely resembles the motif in Ste20, and yet was less potent. The phosphorylation assays yielded similar overall results, with a range of activity (Figures 2.8B and
2.9C). The relative activities in the two assays were generally correlated, but there were some discrepancies; for example, the Whi5 and Pea2 sequences were each weaker in the phosphorylation assay than the sequences with which they showed comparable potency in the signaling assay. Together, these results clearly establish the utility of each assay for their ability to rapidly evaluate multiple candidate Cln2 docking sites, and to compare efficacy in parallel.
Overall, given the large fraction of sequences that were effective, the findings suggest that Cln2 recognition sites of various strengths may be quite prevalent among Cln-CDK targets.
The phosphorylation role of docking sites is cyclin-specific
Finally, we tested whether the Cln2 docking sites enhance phosphorylation by all forms of cyclin-CDK or only by specific forms. We used the Ste51-260 fragment as a starting substrate, and monitored its phosphorylation by inducing expression of different cyclins in asynchronous cells (Figure 2.10A). In the absence of any docking site, none of the cyclins drove appreciable phosphorylation. When Cln2 docking sites from Ste5, Ste20, or Exo84 were appended to this substrate, phosphorylation was enhanced in a manner that was clearly cyclin-specific. Cln2 was generally most effective, followed by Cln1. (With the Ste20 site, Clb2 could
75
Figure 2.9. Sources of candidate Cln2 docking sites from other CDK substrates
(A) For each protein, its structural or functional domains, possible CDK phosphorylation sites, and candidate Cln2 docking motifs are diagrammed.
Sequence alignments show the extent of conservation (among fungal orthologs) of the tested regions. Note that Srl3, which is a Cln2 binding protein
(Archambault et al., 2004), is a paralog of Whi5; but because the candidate Cln2 docking site in Whi5 is less well conserved in Srl3, we tested a Leu/Pro-rich sequence further downstream. Also note that there are several Cln1/2-Cdc28 targets involved in cell polarization (Rga1, Rga2, Bem2, Bem3, Tus1, Cdc24,
Boi1, Boi2) (Archambault et al., 2004; Breitkreutz et al., 2010; Knaus et al., 2007;
Kono et al., 2008; McCusker et al., 2007; Sopko et al., 2007; Wai et al., 2009), which we considered good candidates for harboring possible Cln2 docking sites.
The large size of some of these proteins made it difficult to identify candidate sequences for our initial survey; hence, we chose two examples (Bem3 and
Tus1) in which single regions stood out. Subsequent studies will comprehensively test multiple sequences from such proteins.
(B) Sequences chosen to test for Cln2 docking activity (in Figure 2.8), with red highlighting of the motifs that are most similar to those characterized in Ste5 and
Ste20.
(C) Two additional repetitions of the experiments shown in Figure 2.8B are shown here alongside those presented in Figure 2.8B (shown here as repeat #3).
76
Note the consistency in the extent of phosphorylation, indicating that the relative efficacy of each site is a reproducible feature. Some of the weaker sites (Bem3,
Pea2) gave effects that were more detectable in some repeats than others, whereas the Srl3 site was ineffective in all cases.
77
Figure 2.9. Sources of candidate Cln2 docking sites from other CDK substrates
A B Sic1 1 CKI 284 Sic1 121-150 QNVDIDAAEEEEEGEVLLPPSRPTSARQLH Whi5 121-150 EEENENQKKYDGHVSMPLLPPTTPKSRRSE Srl3 135-164 KLSKEHEQVALIPPPPTEKIRKGSYSNKFA Bem3 98-131 DSRDSYVNDQSFVLPPRSAERKAHIKSLNLPIPT Tus1 21-50 QESQRKSIELPKLPPLNTRNSFLDDSDNGT Exo84 281-310 NFNNVESHSNSPALLPPLKAGQNGNLMRRD Pea2 187-216 SIQKGIDIKPIPLDDPVKFLKNGINSILDT Whi5 1 295 Ste20 80-109 DDDNNVVSLDDPIQFTRVSSSSVISGMSSS Ste5 261-290 DSELSITPQSRFPPYSPLLPPFGLSYTPVE
Srl3 1 246
Bem3 1 PX PH RhoGAP 1128
Tus1 1 RhoGEF PH CNH 1307
C PM RING Ste5 1-337 Ste5 1-260 + candidate dock
Exo84 1 753 wt Srl3 LLPP Ste20 Sic1 Whi5 Bem3 Tus1 Exo84 Pea2 PGAL1 CLN2: - + - + - + - + - + - + - + - + - + - +
#1
Pea2 1 420 #2
#3 short
globular or functional domain #3 key: possible Cdk site (S/T-P) long candidate Cln2 docking motif
78
drive some weak phosphorylation detectable in longer exposures.) As a further test, we fused the same substrate to a different type of docking site: namely, a short sequence containing an “RxL” motif from Fin1, a CDK substrate that is normally preferred by Clb5 (Loog and Morgan, 2005). This motif switched the cyclin preference and caused phosphorylation to be driven strongly by Clb5, plus moderately by Clb2 (Figure 2.10A, bottom). (It is noteworthy that the band patterns were not identical, suggesting different extent or distribution of phosphorylation events.) These results clearly indicate that CDK sites in the
Ste5 N-terminus are intrinsically capable of being phosphorylated by several different cyclin-CDK forms, but they are not effectively phosphorylated in vivo in the absence of cyclin-specific docking sites, and hence this provides specificity to the CDK phosphorylation.
79
Figure 2.10. Docking sites drive cyclin-specific phosphorylation
(A) Phosphorylation of a single substrate (Ste51-260) was monitored with and without the addition of the indicated docking sites, in cells expressing different
PGAL1-induced cyclins. Docking sites from Ste5, Ste20, and Exo84 preferentially enhance phosphorylation by Cln1/2-Cdc28, whereas an RxL-containing fragment from Fin1 converts the substrate into one that is preferred by Clb5 and Clb2.
(B) Schematic comparison of different cyclin-CDK complexes, with a general model for how cyclin-specific docking interactions can selectively enhance substrate phosphorylation by individual forms of cyclin-CDK.
80
Figure 2.10. Docking sites drive cyclin-specific phosphorylation
A PGAL1-GST-cyclin
Ste5 1-260 10A 10A + dock: Cln2 Cln1 Cln2 Cln1 Clb5 Clb2 vector Cln3 Clb5 Clb2 vector Cln3
none
Ste5
Ste20
Exo84
Fin1 RxL
short exposure long exposure
B Clb5 preferred G1 G1/S S M substrate Cdk Cln2 preferred cyclin Cln3 Cln2 C b5 Clb2 substrate
81
DISCUSSION
In this study we identified docking sites for the yeast G1/S cyclins in several CDK substrates. These sites bind preferentially to Cln2 and enhance phosphorylation of CDK substrates in a cyclin-specific manner in vivo. They are also functionally modular, in that they can promote phosphorylation at a variety of distances and positions relative to the CDK sites, and the cyclin specificity of phosphorylation can be switched by exchanging docking sites. We exploited this functional modularity to re-wire a CDK regulatory circuit so as to change the target of Cln2-
Cdc28 regulation in the pheromone response pathway, and to identify candidate
Cln2 docking sites in several other CDK substrates. The relative ease with which these other sites were found suggests that there may be numerous examples of such sites for the G1 or G1/S cyclins in yeast. Indeed, recent studies from another group show that the Sic1 sequence which we used to drive Cln2-Cdc28 phosphorylation of heterologous substrates does in fact promote phosphorylation of Sic1 itself and can also act as a competitive inhibitor of other Cln2-Cdc28 substrates (Koivomagi et al., 2011b). Collectively, these findings suggest that docking interactions play a prevalent but previously unappreciated role in driving phosphorylation of G1/S CDK substrates.
The use of separate docking and phosphorylation sites offers functional and regulatory flexibility. At one extreme, it can allow different kinases to
82
phosphorylate the same sites, as we observed by replacing a Cln2 docking site with an RxL motif favored by B-type cyclins. It may also allow the sequence requirements at phosphorylation sites to be relaxed. While most kinases favor certain residues flanking the phosphorylation site (Mok et al., 2010; Ubersax and
Ferrell, 2007), this ideal context may not be present or tolerated in all relevant substrates. Indeed, proteome-wide analysis (Holt et al., 2009) suggests that roughly two thirds of CDK sites in yeast are not “consensus” sites (S/T-P-x-K/R).
In Ste5, none of the 8 N-terminal CDK sites matches this consensus. The presence of a Cln2 docking site converts the Ste5 N-terminus from a weak substrate into a better substrate, but only for Cln1/2-Cdc28. This enhancement may compensate for poor sequence context, which in turn could minimize use by other cyclin-CDKs, thus providing a regulatory benefit. Other possible benefits of cyclin docking interactions include: (i) they may enhance CDK phosphorylation even for substrates that are not cyclin specific; (ii) they may help drive multi-site phosphorylation of CDK substrates (Salazar et al., 2010); and (iii) they may impart useful regulatory behavior by fostering interplay with competitors or other bound factors. Indeed, the Cln2 docking site in Ste5 overlaps a binding site for the phosphatase Ptc1 (Malleshaiah et al., 2010), and these two factors may compete for access to Ste5 in vivo. Overlapping cyclin and phosphatase binding sites have also been found in the mammalian protein Rb (Hirschi et al., 2010), suggesting a common theme.
83
Differences in docking strength may impact the extent and/or timing of substrate phosphorylation (Salazar et al., 2010). For example, the docking sites in Ste5 and Ste20 bind stronger to Cln2 than Cln1, and such differences could contribute to disparities in efficacy of these two cyclins (Chang and Herskowitz,
1992; Oehlen and Cross, 1994; Queralt and Igual, 2004). We also observed varying degrees of potency for different Cln2 docking sites, though the responsible sequence features remain uncertain. The Ste5 and Ste20 sites share an LxxPΦxΦ motif and an overall enrichment in Leu, Pro, and/or hydrophobic residues, which was used as a criterion to identify additional sites.
An LLPP motif is shared by several of the strong sites, but the docking site in
Ste20 does not match this motif and yet is very potent. Thus, deducing the key sequence features of Cln2 docking sites will require subsequent study, as will determination of whether they bind directly to the cyclin versus the cyclin-CDK complex.
Subcellular localization can also contribute to functional specialization of cyclins (Draviam et al., 2001; Edgington and Futcher, 2001; Miller and Cross,
2000). Hence, in addition to driving phosphorylation in cis, some cyclin docking sites may help localize cyclins and/or promote phosphorylation in trans of other proteins in the same complex or subcellular locale (Pascreau et al., 2011). In fact, prior to our discovery that it binds Cln2, we originally found that the Cln2 docking site in Ste20 could trigger hyperpolarized growth when over-expressed
84
and membrane-localized (Takahashi and Pryciak, 2007); in retrospect, this phenotype could result from the generation of excess cortical binding sites for
Cln2, which promotes apical polarized growth (Lew and Reed, 1993). Several
Cln1/2-Cdc28 substrates are involved in cell polarity (Enserink and Kolodner,
2010) (see Figure 2.9 legend), so it will be of interest to determine whether they each contain Cln1/2 docking sites or if docking sites in some can serve a scaffolding role that promotes CDK phosphorylation of co-bound or co-localized substrates. Synthetic approaches, such as those described here, can be used to discover these docking sites as well as to characterize their functional properties and activities in a standardized setting, which ultimately can illuminate how the regulatory behavior of native proteins and pathways arises from the combined properties of individual motifs.
ACKNOWLEDGEMENTS
We are grateful to Matthew Winters and Rachel Lamson for technical assistance, and to Mart Loog for discussions and communication of unpublished results. We
10A also thank Jenny Benanti for the Cln3 allele, Patty Pope for cyclin-myc13 constructs, Wendell Lim for the Ste5 ND mutant, and Dan McCollum and Jenny
Benanti for helpful discussions.
85
Materials and Methods
Yeast Strains and Plasmids
Standard procedures were used for growth and genetic manipulation of yeast
(Rothstein, 1991; Sherman, 2002). Cells were grown at 30°C in yeast extract/peptone medium with 2% glucose (YPD) or galactose (YPGal), or in synthetic (SC) medium with 2% glucose and/or raffinose. Strains and plasmids are listed in the tables below.
Protein analysis in whole yeast cell lysates
Except for GST co-precipitation assays, protein analysis used whole cell lysates prepared by glass-bead lysis of frozen cell pellets directly in trichloroacetic acid
(TCA) solution, as described previously (Lee and Dohlman, 2008), which provides good preservation of protein phosphorylation state. Ten mL of culture
(OD660 ~ 0.7) was collected by centrifugation, and cell pellets were frozen in liquid nitrogen and stored at -80°C. Frozen pellets were thawed by adding 300 µL of
TCA buffer (10 mM Tris.HCl, pH 8.0, 10% TCA, 25 mM ammonium acetate, 1 mM Na2EDTA), transferred to a microcentrifuge tube, lysed by vortexing with glass beads (five 1-min cycles, with chilling on ice for 3 min between cycles).
The cell lysate was transferred to a new tube and centrifuged (16,000 x g, 10 min at 4˚C). The pellet was resuspended in 150 uL of solution R (0.1 M Tris.HCl, pH
11.0, 3% SDS), boiled for 5 min, cooled to room temperature, and re-centrifuged
86
for 30 sec. Then, 120 µL of supernatant was transferred to a fresh tube.
Aliquots were reserved to determine protein concentration using a detergent- compatible (bicinchoninic acid) assay (Thermo Scientific # 23225), and the remainder was combined with 2x SDS-PAGE sample buffer and boiled for 5 min.
Phosphorylation Gel Shift Assays
Cultures harboring HA3- or V53-tagged proteins, plus a PGAL1-GST-cyclin construct or a vector control, were grown in 2% raffinose media and induced with
2% galactose for 3 hr. Alternatively, to reduce toxic effects of Clb2 expression, the experiments comparing all five PGAL1-GST-cyclins in parallel used only 1 hr galactose induction. Wild-type strain BY4741 was used except where noted otherwise. Using samples prepared by the TCA method described above, equivalent amounts of protein (20 µg/lane) were separated by SDS-PAGE, and transferred to PVDF membranes (Immobilon-P; Millipore) using a submerged transfer apparatus. Blots were probed with mouse anti-HA (1:1000, Covance
#MMS-101R), anti-V5 (1:5000, Invitrogen #46-0705), or anti-GST (1:1000, Santa
Cruz Biotechnologies #sc-138) antibodies, and detected using HRP-conjugated goat anti-mouse antibodies (1:3000, BioRad #170-6516) and Pierce SuperSignal
West Pico (#34080) chemilluminescent reagent. To follow phosphorylation in synchronous cultures, cdc15-2 strain PPY1762 harboring tagged proteins was grown overnight at 25°C, arrested at 37°C for 3 hr, and then released at 25°C.
Aliquots were taken at 20 min intervals, then chilled on ice for 5 min, pelleted,
87
and frozen in liquid nitrogen. Cell extracts were prepared and analyzed as described above. In parallel, cells at each time point were fixed with 5% formaldehyde and scored for small buds by microscopy. Clb2 was detected with rabbit anti-Clb2 (1:1000, Santa Cruz Biotechnologies #sc-9071) and AP- conjugated goat anti-rabbit (1:3000, BioRad #170-6518) antibodies, with Immun-
Star-AP substrate (BioRad #170-5018).
Most SDS-PAGE analysis used standard (Laemmli) methods, in which separating gels included 8% acrylamide [37.5:1 acryl:bis] with 0.1 % SDS.
However, to better separate phosphorlyated forms of large proteins (i.e., full- length Ste5 and Swe1), a higher acrylamide:bis ratio was used and SDS was omitted from the gel (i.e., separating gel: 0.375 M Tris-HCl pH 8.8, 7.5 % acrylamide [43.4:1 acryl:bis]; stacking gel: 0.125 M Tris-HCl pH 6.8, 5 % acrylamide [37.5:1 acryl:bis]; running buffer: 0.05 M TRIZMA base, 0.38 M glycine, 0.1 % SDS; electrophoresis: 20 mA for roughly 5 hr).
Signaling Assays
To measure effects of PGAL1-CLN2 on pheromone response, cells were grown in
2% raffinose selective media, induced with 2% galactose, and then treated with α factor. (i) For assays of transcriptional response, 1 hr galactose induction was followed by 2 hr treatment with 5 µM α factor; then, FUS1-lacZ expression was measured by β-galactosidase assay as described previously (Lamson et al.,
2002; Strickfaden et al., 2007). (ii) For assays of MAPK phosphorylation, 75 min.
88
galactose induction was followed by 0-60 min. treatment with 1 µM α factor.
Phosphorylated Fus3 was detected with rabbit anti-phospho-p44/42 (1:1000, Cell
Signaling Technology #9101) and HRP-conjugated goat anti-rabbit (1:3000,
Jackson ImmunoResearch #111-035-144) antibodies; then, blots were stripped
(Thermo Scientific #21059) and probed with goat anti-Fus3 (1:2000, Santa Cruz
Biotechnologies #sc-6773) and HRP-conjugated donkey anti-goat (1:3000, Santa
Cruz Biotechnologies #sc-2020) antibodies. (Pierce SuperSignal West Pico reagent was used for each.) (iii) For assaying the levels of Ste20Ste5PM chimera proteins, epitope-tagged forms were detected with mouse anti-GFP (1:1000,
Clontech #JL-8) and HRP-conjugated goat anti-mouse (1:3000, BioRad #170-
6516) antibodies, or rabbit anti-myc (1:200, Santa Cruz Biotechnologies #sc-789) and HRP-conjugated goat anti-rabbit (1:3000, Jackson ImmunoResearch #111-
035-144) antibodies (with Pierce SuperSignal West Pico reagent).
GST Binding Assays
Cultures (25 ml) of strain BY4741 harboring PGAL1-GST-tagged Ste20 or
Ste5 Ste20 chimeric fragments, with or without cyclin-myc13 constructs, were induced with 2% galactose for 3 hr, harvested, and stored at -80°C. Extracts were prepared by glass bead lysis in a non-ionic detergent buffer as described previously (Lamson et al., 2002). Aliquots were reserved to assess input levels.
GST fusions were collected by binding to glutathione-sepharose beads (GE
Healthcare #17-0756-01) and detected with anti-GST antibodies described above
89
and AP-conjugated goat anti-mouse antibodies (1:3000, BioRad #170-6520) and
Immun-Star-AP substrate. Cyclin-myc13 proteins were detected using rabbit anti- myc (1:200, Santa Cruz Biotechnologies #sc-789) and HRP-conjugated goat anti-rabbit (1:3000, Jackson ImmunoResearch #111-035-144) antibodies, and
Pierce SuperSignal West Pico (#34080) reagent.
90
Table 2.1: Yeast strains used in Chapter II
Yeast strains used in this study bkg strain name genotype source § nd*
(a) BY4741 MATa his3∆1 leu2∆0 ura3∆0 met15∆0 (1) (a) BY4741 ptc1∆ MATa his3∆1 leu2∆0 ura3∆0 met15∆0 ptc1∆::kanR (2) (a) BY4741 sic1∆ MATa his3∆1 leu2∆0 ura3∆0 met15∆0 sic1∆::kanR (2) (a) PPY2285 MATa his3∆1 leu2∆0 ura3∆0 met15∆0 SWE1-3xV5::kanR this study
(b) PPY640 MATa FUS1::FUS1-lacZ::LEU2 (3) (b) PPY858 MATa FUS1::FUS1-lacZ::LEU2 ste5::ADE2 (3) (b) PPY1173 MATa FUS1::FUS1-lacZ::LEU2 fus3::LEU2 kss1::ura3FOA (4) (b) PPY1665 MATa FUS1::FUS1-lacZ::LEU2 fus3::LEU2 kss1::ura3FOA ste5::ADE2 this study (b) PPY1695 MATa FUS1::FUS1-lacZ::LEU2 ste5::ADE2 HIS3::PGAL1-CLN2 (5) (b) PPY1762 MATa ade1 cdc15-2 ste5::ADE2 (5) (b) PPY2142 MATa FUS1::FUS1-lacZ::LEU2 STE5-8A ste20∆::kanR this study R (b) PPY2143 MATa FUS1::FUS1-lacZ::LEU2 STE5-8A ste20∆::kan HIS3::2x(PGAL1-CLN2) this study FOA (b) PPY2281 MATa FUS1::FUS1-lacZ::LEU2 fus3::LEU2 kss1::ura3 ste5::ADE2 HIS3::PGAL1-CLN2 this study (b) KBY211 MATα ste20::ADE2 cla4::LEU2 + YCpTRP1-cla4-75ts (6)
* strain background: (a) S288c (his3∆1 leu2∆0 ura3∆0 met15∆0) (b) W303 (ade2-1 his3-11,15 leu2-3,112 trp1-1 ura3-1 can1)
§ source: (1) (Brachmann et al., 1998); (2) (Winzeler et al., 1999); (3) (Pryciak and Huntress, 1998); (4) (Winters et al., 2005); (5) (Strickfaden et al., 2007); (6) (Holly and Blumer, 1999).
Table 2.2. Plasmids used in Chapter II
Plasmids used in this study name alias description ** source § pPP538 pRL116 CEN URA3 PSTE20-GFP-STE20 WT 1 pPP681 pRS316 CEN URA3 vector 2 pPP1843 pUG-GST-GFP 2µm URA3 PGAL1-GST-GFP vector 3 pPP1919 pUG-GST-F20-WT 2µm URA3 PGAL1-GST-GFP-STE20-WT (full-length) this study pPP1927 pT-F3-myc CEN TRP1 FUS3-myc13 TCYC1 this study pPP2036 pUG-GST-F20L 2µm URA3 PGAL1-GST-GFP-ste20(72-333) 4 pPP2037 pUG-GST-F20M 2µm URA3 PGAL1-GST-GFP-ste20(120-333) 4 pPP2038 pUG-GST-F20FM+ 2µm URA3 PGAL1-GST-GFP-ste20(1-254) 4 pPP2040 pUG-GST-F20AM+ 2µm URA3 PGAL1-GST-GFP-ste20(1-333) 4 pPP2041 pUG-GST-F20ABR-M+ 2µm URA3 PGAL1-GST-GFP-ste20(1-333)/BR* 4 pPP2154 pHG-GST CEN HIS3 PGAL1-GST vector this study pPP2163 pHGT-S20A CEN HIS3 PGAL1-GST-ste20(1-333) 4 pPP2177 pEHG-GST 2µm HIS3 PGAL1-GST vector this study pPP2271 pT-F3K42R-myc CEN TRP1 fus3(K42R)-myc13 TCYC1 this study pPP2318 pRL116∆BR CEN URA3 PSTE20-GFP-ste20(∆285-311) 4 pPP2816 pRS413-TEFpr CEN HIS3 PTEF2 vector 5 pPP2927 pRL116myc CEN URA3 PSTE20-myc13-STE20 4 pPP2929 pRL116myc∆BR CEN URA3 PSTE20-myc13-ste20(∆285-311) 4 pPP3066 pRL116-A5N CEN URA3 PSTE20-GFP-[(Ste5 1-85)-(Ste20 312-939)] this study pPP3071 pRL116-XA5N CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3072 pRL116-XA5N8A CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-85/8A)-(Ste20 312-939)] this study pPP3077 pTEFpr-CLN2-myc CEN URA3 PTEF2-CLN2-myc13 TCYC1 this study pPP3102 pRL116-XA5N∆2-72 CEN URA3 PSTE20-GFP-[(Ste20 73-123)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3103 pRL116-XA5N∆87-119 CEN URA3 PSTE20-GFP-[(Ste20 1-86)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3104 pRL116-XA5N-Ala5 CEN URA3 PSTE20-GFP-[(Ste20 1-123/mut3)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3118 pRL116-XB5N CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-125)-(Ste20 312-939)] this study pPP3119 pRL116-XB5N-8A CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-125/8A)-(Ste20 312-939)] this study pPP3120 pRL116-XC5N CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-176)-(Ste20 312-939)] this study pPP3121 pRL116-XC5N-8A CEN URA3 PSTE20-GFP-[(Ste20 1-123)-(Ste5 1-176/8A)-(Ste20 312-939)] this study pPP3125 pRL116myc-XA5N CEN URA3 PSTE20-myc13-[(Ste20 1-123)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3127 pRL116myc-XA5N-8A CEN URA3 PSTE20-myc13-[(Ste20 1-123)-(Ste5 1-85/8A)-(Ste20 312-939)] this study pPP3133 pRL116myc-XA5N-Ala5 CEN URA3 PSTE20-myc13-[(Ste20 1-123/mut3)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3152 pH-TEFpr-CLN2-myc CEN HIS3 PTEF2-CLN2-myc13 TCYC1 this study
91
pPP3153 pCYC1-CLN1-myc CEN URA3 PCYC1-CLN1-myc13 TCYC1 this study pPP3154 pCYC1-CLB5-myc CEN URA3 PCYC1-CLB5-myc13 TCYC1 this study pPP3155 pCYC1-CLB2-myc CEN URA3 PCYC1-CLB2-myc13 TCYC1 this study pPP3203 pCYC1-CLN2-myc CEN URA3 PCYC1-CLN2-myc13 TCYC1 this study pPP3218 pM20-BXA5N-U CEN URA3 PSTE20-myc13-[(Ste20 80-109)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3219 pM20-BXA5N-V CEN URA3 PSTE20-myc13-[(Ste20 80-115)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3239 pRL116myc-NA5N CEN URA3 PSTE20-myc13-[(Ste20 1-284)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3267 pRL116V5 CEN URA3 PSTE20-3xV5-STE20 this study pPP3270 pM20-BXA5N-∆87-119 CEN URA3 PSTE20-myc13-[(Ste20 1-86)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3272 pM20-BXA5N-U-CSM1 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut1)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3273 pM20-BXA5N-U-CSM2 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut2)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3274 pM20-BXA5N-U-CSM3 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut3)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3275 pM20-BXA5N-U-CSM4 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut4)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3276 pM20-BXA5N-U-CSM5 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut5)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3277 pM20-BXA5N-U-CSM6 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut6)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3278 pM20-BXA5N-U-CSM7 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut7)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3279 pM20-BXA5N-U-CSM8 CEN URA3 PSTE20-myc13-[(Ste20 80-109/mut8)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3281 pM20-BXA5N-U-CSM3a CEN URA3 PSTE20-myc13-[(Ste20 80-109/S87A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3301 pM20-BXA5N-U-CSM3b CEN URA3 PSTE20-myc13-[(Ste20 80-109/L88A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3302 pM20-BXA5N-U-CSM3c CEN URA3 PSTE20-myc13-[(Ste20 80-109/D89A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3303 pM20-BXA5N-U-CSM3d CEN URA3 PSTE20-myc13-[(Ste20 80-109/D90A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3304 pM20-BXA5N-U-CSM3e CEN URA3 PSTE20-myc13-[(Ste20 80-109/P91A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3305 pM20-BXA5N-U-CSM4a CEN URA3 PSTE20-myc13-[(Ste20 80-109/I92A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3306 pM20-BXA5N-U-CSM4b CEN URA3 PSTE20-myc13-[(Ste20 80-109/Q93A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3307 pM20-BXA5N-U-CSM4c CEN URA3 PSTE20-myc13-[(Ste20 80-109/F94A)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3311 pM20-BXA5N-∆87-119- CEN URA3 PSTE20-myc13-[(Ste20 1-86)-(Ste5 1-85)-(Ste20-80-115)-(Ste20 this study MCSM 312-939)] pPP3312 pM20-BXA5N-∆87-119- CEN URA3 PSTE20-myc13-[(Ste20 1-86)-(Ste5 1-85)-(Ste20 312-567)-(Ste20- this study SgCSM 80-115)-(Ste20 568-939)] pPP3313 pM20-BXA5N-∆87-119- CEN URA3 PSTE20-(Ste20 80-115)- myc13-[(Ste20 1-86)-(Ste5 1-85)-(Ste20 this study NXCSM 312-939)] pPP3367 pV20-80-590/A13 CEN URA3 PSTE20-3xV5-(Ste20 80-590/CDK*) this study pPP3368 pRL116V5-Ala5 CEN URA3 PSTE20-3xV5-(Ste20 1-939/mut3) this study pPP3369 pRL116V5-Ala13 CEN URA3 PSTE20-3xV5-(Ste20 1-939/CDK*) this study pPP3370 pV20-80-590/WT CEN URA3 PSTE20-3xV5-(Ste20 80-590/wt) this study pPP3373 pM20-BXA5N-5CDS CEN URA3 PSTE20-myc13-[(Ste5 257-335)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3374 pM20-BXA5N-∆87-119- CEN URA3 PSTE20-myc13-[(Ste20 1-86)-(Ste5 1-85)-(Ste5 257-335)-(Ste20 this study M5CDS 312-939)] pPP3415 pS5kHA-1-370 CEN URA3 PSTE5-ste5 1-370- 3xHA TCYC1 this study pPP3433 pS5kHA-1-262 CEN URA3 PSTE5-ste5 1-262- 3xHA TCYC1 this study pPP3434 pS5kHA-1-315 CEN URA3 PSTE5-ste5 1-315- 3xHA TCYC1 this study pPP3435 pS5kHA-1-337 CEN URA3 PSTE5-ste5 1-337- 3xHA TCYC1 this study pPP3454 pS5kHA-1-337-8A CEN URA3 PSTE5-ste5 1-337 (8A)- 3xHA TCYC1 this study pPP3501 pS5kHA-1-283 CEN URA3 PSTE5-ste5 1-283- 3xHA TCYC1 this study pPP3502 pS5kHA-1-300 CEN URA3 PSTE5-ste5 1-300- 3xHA TCYC1 this study pPP3503 pS5kHA-1-260 CEN URA3 PSTE5-ste5 1-260- 3xHA TCYC1 this study pPP3509 pH5n-1-337-wt CEN URA3 PSTE5-ste5 1-337-(wt)- 3xHA TCYC1 this study pPP3510 pH5n-1-337-3AV CEN URA3 PSTE5-ste5 1-337-(4AV)- 3xHA TCYC1 this study pPP3513 pH5n-1-337-ND CEN URA3 PSTE5-ste5 1-337-(ND)- 3xHA TCYC1 this study pPP3546 pH5n-1-337-4E CEN URA3 PSTE5-ste5 1-337-(4E)- 3xHA TCYC1 this study pPP3547 pH5n-1-260-S20CSM CEN URA3 PSTE5-ste5 1-260-(S20 80-115wt)- 3xHA TCYC1 this study pPP3548 pH5n-1-260-S20CSMmut CEN URA3 PSTE5-ste5 1-260-(S20 80-115mut3) -3xHA TCYC1 this study pPP3550 pS5kHA-1-275 CEN URA3 PSTE5-ste5 1-275- 3xHA TCYC1 this study pPP3571 pH5n-1-260-fRXL CEN URA3 PSTE5-ste5 1-260-(Fin1 190-208) -3xHA TCYC1 this study pPP3572 pt-HGT-CLN2-F CEN HIS3 PGAL1-GST-CLN2 TCYC1 this study pPP3610 pS5kHA-1-283-P4 CEN URA3 PSTE5-ste5 1-283-(LLPP)- 3xHA TCYC1 this study pPP3701 pS5kHA-1-337∆RING CEN URA3 PSTE5-ste5 1-337 [∆177-229]- 3xHA TCYC1 this study pPP3702 pS5kHA-1-337∆124-151 CEN URA3 PSTE5-ste5 1-337 [∆124-151]- 3xHA TCYC1 this study pPP3703 pS5kHA-1-337∆152-173 CEN URA3 PSTE5-ste5 1-337 [∆152-173]- 3xHA TCYC1 this study pPP3704 pS5kHA-1-337∆239-256 CEN URA3 PSTE5-ste5 1-337 [∆239-256]- 3xHA TCYC1 this study pPP3714 pH5n-1-337-P4 CEN URA3 PSTE5-ste5 1-337-(LLPP)- 3xHA TCYC1 this study pPP3715 pH5n-1-337-P4,3AV CEN URA3 PSTE5-ste5 1-337-(LLPP/4AV)- 3xHA TCYC1 this study pPP3716 pH5n-1-337-P4,4E CEN URA3 PSTE5-ste5 1-337-(LLPP/4E)- 3xHA TCYC1 this study pPP3717 pH5n-1-337-P4,ND CEN URA3 PSTE5-ste5 1-337-(LLPP/ND)- 3xHA TCYC1 this study pPP3724 pV20-80-590-A5b CEN URA3 PSTE20- 3xV5- (ste20 80-590/mut3) this study pPP3738 pS5kmyc-Nhe-wtb CEN URA3 PSTE5-ste5 full length-(wt)-myc13 TCYC1 this study pPP3739 pS5kmyc-Nhe-P4 CEN URA3 PSTE5-ste5 full length-(LLPP)-myc13 TCYC1 this study pPP3744 pS5kmyc-Nhe-ND CEN URA3 PSTE5-ste5 full length-(ND)-myc13 TCYC1 this study pPP3745 pS5kmyc-Nhe-P4,ND CEN URA3 PSTE5-ste5 full length-(LLPP/ND)-myc13 TCYC1 this study pPP3749 pt-HGT-CLN1 CEN HIS3 PGAL1-GST-CLN1 TCYC1 this study pPP3755 pCYC1-CLN3-10A-myc CEN URA3 PCYC1-CLN3(10A)- myc13 TCYC1 this study pPP3757 pV20-80-500-wt CEN URA3 PSTE20- 3xV5- (ste20 80-500/wt) this study pPP3758 pV20-80-500-A5 CEN URA3 PSTE20- 3xV5- (ste20 80-500/mut3) this study pPP3759 pV20-80-500Ala6 CEN URA3 PSTE20- 3xV5- (ste20 80-500/CDK*) this study pPP3760 pS5kV5-Nhe-wt CEN URA3 PSTE5-STE5 full length-(wt)-3xV5 TCYC1 this study pPP3761 pS5kV5-Nhe-P4 CEN URA3 PSTE5-ste5 full length-(LLPP)-3xV5 TCYC1 this study
92
pPP3771 pUG-GST-F20M-5CSM-wt 2µm URA3 PGAL1-GST-GFP-[(ste5 263-335)-(ste20 120-333)] this study pPP3772 pUG-GST-F20M-5CSM-P4 2µm URA3 PGAL1-GST-GFP-[(ste5 263-335/LLPP)-(ste20 120-333)] this study pPP3802 pH5n-1-260-dSic1 CEN URA3 PSTE5-ste5 1-260-(Sic1 121-150) 3xHA TCYC1 this study pPP3803 pH5n-1-260-dWhi5 CEN URA3 PSTE5-ste5 1-260-(Whi5 121-150) 3xHA TCYC1 this study pPP3804 pH5n-1-260-dSrl3 CEN URA3 PSTE5-ste5 1-260-(Srl3 135-164) 3xHA TCYC1 this study pPP3805 pH5n-1-260-dBem3 CEN URA3 PSTE5-ste5 1-260-(Bem3 98-131) 3xHA TCYC1 this study pPP3806 pH5n-1-260-dTus1 CEN URA3 PSTE5-ste5 1-260-(Tus1 21-50) 3xHA TCYC1 this study pPP3807 pH5n-1-260-dExo84 CEN URA3 PSTE5-ste5 1-260-(Exo84 281-311) 3xHA TCYC1 this study pPP3808 pH5n-1-260-dPea2 CEN URA3 PSTE5-ste5 1-260-(Pea2 187-216) 3xHA TCYC1 this study pPP3809 pM20-BXA5N-dSic1 CEN URA3 PSTE20-myc13-[(Sic1 121-150)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3810 pM20-BXA5N-dWhi5 CEN URA3 PSTE20-myc13-[(Whi5 121-150)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3811 pM20-BXA5N-dSrl3 CEN URA3 PSTE20-myc13-[(Srl3 135-164)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3812 pM20-BXA5N-dTus1 CEN URA3 PSTE20-myc13-[(Tus1 21-50)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3813 pM20-BXA5N-dExo84 CEN URA3 PSTE20-myc13-[(Exo84 281-311)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3814 pM20-BXA5N-dPea2 CEN URA3 PSTE20-myc13-[(Pea2 187-216)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3815 pM20-BXA5N-dBem3 CEN URA3 PSTE20-myc13-[(Bem3 98-131)-(Ste5 1-85)-(Ste20 312-939)] this study pPP3820 pHG-GST-S20L-CSM-wt CEN HIS3 PGAL1-GST-[(ste20 72-118)-(ste20 120-333)] this study pPP3821 pHG-GST-S20L-CSM2 CEN HIS3 PGAL1-GST-[(ste20 72-118/mut2)-(ste20 120-333)] this study pPP3822 pHG-GST-S20L-CSM3 CEN HIS3 PGAL1-GST-[(ste20 72-118/mut3)-(ste20 120-333)] this study pPP3823 pHG-GST-S20L-CSM4 CEN HIS3 PGAL1-GST-[(ste20 72-118/mut4)-(ste20 120-333)] this study pPP3824 pHG-GST-S20L-CSM5 CEN HIS3 PGAL1-GST-[(ste20 72-118/mut5)-(ste20 120-333)] this study pPP3827 pt-HGT-CLN3-10A CEN HIS3 PGAL1-GST-CLN3(10A) TCYC1 this study pPP3828 pt-HGT-CLB5 CEN HIS3 PGAL1-GST-CLB5 TCYC1 this study pPP3829 pt-HGT-CLB2 CEN HIS3 PGAL1-GST-CLB2 TCYC1 this study pPP3853 pEHGT-S20M-5CSM-wt 2µm HIS3 PGAL1-GST-[(ste5 263-335)-(ste20 120-333)] this study pPP3865 pS5kV5-Nhe-ND CEN URA3 PSTE5-ste5 full length-(ND)-3xV5 TCYC1 this study pPP3866 pS5kV5-Nhe-P4,ND CEN URA3 PSTE5-ste5 full length-(LLPP/ND)-3xV5 TCYC1 this study pPP3867 pS5kV5-Nhe-8A CEN URA3 PSTE5-ste5 full length-(8A)-3xV5 TCYC1 this study pPP3871 pS5kmyc-Nhe-8A CEN URA3 PSTE5-ste5 full length-(8A)-myc13 TCYC1 this study
§ Source: (1) (Leberer et al., 1997); (2) (Sikorski and Hieter, 1989); (3) (Winters et al., 2005); (4) (Takahashi and Pryciak, 2007); (5) (Mumberg et al., 1995)
** mutations denoted by abbreviated names:
Ste5 8A: T4A, S11A, T29A, S43A, S69A, S71A, S81A, T102A Ste5 LLPP: L278A, L279A, P280A, P281A Ste5 ND: Q292A, I294A, Y295A, L307A, P310A, N315A Ste5 4AV: T267A, S276A, T287V, S329A Ste5 4E: T267E, S276E, T287E, S329E
Ste20 BR*: K285N, K286N, R287G, K288A, R297A, M298G, K299A, K310N, R311G Ste20 CDK*: T203A, T218A, S269A, S418A, T423A, S492A, S502A, T512A, S517A, S547A, T555A, S562A, T573A Ste20 mut1: D80A, D81A, D82A Ste20 mut2: N83A, N84A, V85A, V86A Ste20 mut3: S87A, L88A, D89A, D90A, P91A Ste20 mut4: I92A, Q93A, F94A Ste20 mut5: T95A, R96A, V97A Ste20 mut6: S98A, S99A, S100A, S101A Ste20 mut7: V102A, I103A, S104A, G105A Ste20 mut8: M106A, S107A, S108A, S109A
Cln3 10A: T420A, S449A, T455A, S462A, S464A, S468A, T478A, S514A, T517A, T520A
93
CHAPTER III
A conserved docking interface in the cyclin Cln2 controls multi- site substrate phosphorylation and ensures timely entry into the
cell cycle
The following Chapter contains the manuscript:
Bhaduri, S., Valk, E., Winters, M.J., Gruessner B., Loog, M., Pryciak, P.M.
(2014). A conserved docking interface in the cyclin Cln2 controls multi-site substrate phosphorylation and ensures timely entry into the cell cycle [Manuscript under preparation]
The study has been devised and results have been interpreted by myself and Dr.
Pryciak. All experiments, except for the ones listed below, have been performed by myself and the manuscript has been prepared by myself and Dr. Pryciak.
Figure 3.5 has been contributed by Brian Gruessner under my guidance.
Figure 3.6 and Figure 3.8D have been contributed by E. Valk and M. Loog.
M.J. Winters has constructed several plasmids used in the study and helped with different experiments.
94
Abstract
Eukaryotic cell division is driven by cyclin-dependent kinases (CDKs). Distinct cyclin-CDK complexes are specialized to drive different cell cycle events, though the molecular bases for these specializations are only partly understood. In budding yeast, the decision to begin a new cell cycle is regulated by three G1 phase (Cln) cyclins. Recent studies revealed that some CDK substrates contain a novel docking motif that is recognized by Cln1 and Cln2 but not by Cln3 or later
S- or M-phase cyclins. Here, to explore the role of this new docking mechanism in the cell cycle, we first show that it is conserved in a distinct cyclin subtype, the fungal Ccn1 group, and then use phylogenetic variation to identify cyclin mutations that disrupt docking. These mutations disrupt binding to multiple substrates as well as the ability to use docking sites to promote efficient, multi- site phosphorylation of substrates in vitro. In cells in which the Cln2 docking function is blocked, we observed reductions in the polarized morphogenesis of daughter buds and reduced ability to fully phosphorylate the G1/S transcriptional repressor Whi5. Furthermore, disruption of Cln2 docking perturbs the coordination between cell size and the G1/S transition such that DNA synthesis and budding are delayed until cells reach a larger size. The findings point to a novel substrate interaction interface on cyclins and indicate that efficient, docking-dependent substrate phosphorylation contributes to punctual cell cycle entry.
95
Introduction
Cyclin-dependent kinases (CDKs) are central regulators of cell division in eukaryotes (Morgan, 2007). The cyclin subunit has a critical role in triggering
CDK kinase activity, but it can also play important regulatory roles by controlling subcellular localization and substrate selection (Bloom and Cross, 2007).
Eukaryotic cells invariably have several distinct cyclin-CDK forms that are specialized for particular cell cycle stages. In yeasts, multiple cyclins associate with a single CDK molecule, whereas animal cells have multiple cyclins as well as multiple CDKs. Generally, these different cyclin-CDK forms fall into two broad functional classes: those that control the biochemical events of DNA synthesis and mitosis (in S and M phases), and those that control the decision to begin a new division cycle (in G1 phase). To understand how sequential cell cycle events are properly orchestrated, it is necessary to determine the molecular mechanisms by which distinct cyclin-CDK forms differ functionally from each other. For example, how do early forms of cyclin-CDK, which act in G1 phase to drive cell cycle entry, trigger some events without triggering other events that should occur later in S and M phases? One general class of explanation is that early cell cycle events may rely on cyclin-CDK complexes with low activity but strong substrate selectivity (Koivomagi et al., 2011b; Levine et al., 1996). This study pursues recent discoveries regarding substrate selection by early cyclins.
96
In the budding yeast S. cerevisiae, S and M phases are driven by six B- type cyclins (Clb1-6), whereas the decision to enter a new cell cycle is controlled by three G1 cyclins, Cln1-3 (Bloom and Cross, 2007; Morgan, 2007). The G1 phase constitutes a critical assessment period in which cells determine whether conditions are appropriate to begin a new round of division, and this decision is responsive to both internal and external cues such as nutrient availability, cell size, and inhibitory signals. Ultimately these signals affect the function of Cln1-3, which then drive the CDK phosphorylation events that commit cells to cell cycle entry in a step known as “Start”, followed by the transition from G1 to S phase
(Cross, 1995b; Johnson and Skotheim, 2013; Jorgensen and Tyers, 2004). Key
CDK substrates in this period are inhibitors of cell cycle entry such as Whi5, a repressor of G1/S transcription (Costanzo et al., 2004; de Bruin et al., 2004), as well as Cdh1 and Sic1, which prevent the expression and activity of Clb cyclins, respectively (Morgan, 2007). Notably, each of these substrates has multiple
CDK phosphorylation sites (Nash et al., 2001; Wagner et al., 2009; Zachariae et al., 1998), which may place unique demands on the cyclin-CDK complex to ensure efficient and complete phosphorylation, and also dictate the threshold
CDK levels required to trigger the regulatory effect (Koivomagi et al., 2013;
Koivomagi et al., 2011a; Nash et al., 2001; Yang et al., 2013).
Despite some functional overlap among Cln1-3 in governing cell cycle entry, these three cyclins have functional distinctions (Bloom and Cross, 2007;
97
Levine et al., 1996) that contribute to a two-stage commitment process: Cln3 plays an early priming role that initiates expression of Cln1 and Cln2, which further promote their own expression via a positive feedback loop, resulting in a sharp increase in Cln1/2 activity that triggers a decisive entry into the cell cycle
(Cross and Tinkelenberg, 1991; Dirick and Nasmyth, 1991; Skotheim et al.,
2008). The distinctions between Cln3 and Cln1/2 include different subcellular distributions (Edgington and Futcher, 2001; Miller and Cross, 2000). In addition, recent studies revealed that the Cln1/2 cyclins recognize specific docking motifs in select CDK substrates (Figure 3.1A). These Cln1/2-specific “LP-type” docking motifs (enriched in Leu and Pro residues) are not recognized by either Cln3 or
Clb1-6, and hence they promote phosphorylation preferentially by Cln1/2-CDK
(Bhaduri and Pryciak, 2011; Koivomagi et al., 2011b). This mechanism is analogous to recognition of RxL motifs by S-phase cyclins such as yeast Clb5 or mammalian CycA (Archambault et al., 2005), but the motifs are unrelated and are not cross-recognized (Bhaduri and Pryciak, 2011; Koivomagi et al., 2011b).
Currently, it is unknown what part of the Cln1/2 protein recognizes the LP motifs, or why other cyclins do not recognize them. It is also unknown what cell cycle events depend on docking by Cln1/2. To address these issues, in this study we identify and characterize a docking-defective Cln2 mutant. Our findings uncover a novel substrate-docking interface that is conserved among distinct cyclin sub- groups, and demonstrate that this docking function promotes multi-site phosphorylation of substrates and punctual entry into the cell cycle.
98
Results
Strategic framework for localizing the docking interface in Cln2
Before screening for a Cln2 mutant that is defective at docking, we needed a strategy to distinguish mutants with specific defects in docking from those with more general defects in CDK activation. Our solution was to compare a CDK substrate harboring a native LP docking site with one that instead uses a leucine zipper to promote cyclin-substrate interaction, expecting that the desired class of mutant would only show defects in phosphorylating the former substrate (Figure
3.1B). Indeed, this predicted behavior is exemplified by Cln3, which can phosphorylate a substrate harboring the leucine zipper but does not recognize
LP docking sites (Figure 3.1C). Hence, in principle we sought a Cln2 mutant that behaves more like Cln3 in this respect.
Because S-phase cyclins recognize RxL docking motifs via a hydrophobic patch (HP) on their surface, we considered a simple model that the different sequence composition of this region in Cln1/2 cyclins might allow them to recognize LP rather than RxL motifs. But mutations in this part of Cln2 did not confer a specific defect in LP docking, and instead they caused a general mild reduction in all phosphorylation activity, including auto-phosphorylation of the
Cln2 C-terminus (Figure 3.1D). Hence, we concluded that LP recognition is encoded elsewhere on Cln2, thus necessitating a broad interrogation of
99
Figure 3.1. Sequence constraints and evolutionary conservation of docking function.
(A) Interaction of Cln1/2 with “LP” docking sites promotes CDK substrate
phosphorylation.
(B) Expected phenotype of a docking-defective Cln1/2 mutant. Defects in
docking vs. CDK activity can be discerned by comparing substrates with a
docking site vs. a leucine zipper.
(C) Cln3 exemplifies non-docking behavior. Cyclins were expressed as fusions to
GST plus a half leucine zipper (GST-[lz]), along with a substrate harboring
either the partner half leucine zipper or an LP docking site (see Figure 3.2A).
Reduced gel mobility indicates substrate phosphorylation.
(D) Mutations in the hydrophobic patch region of Cln2 (hpm1, 3; see Figure 3.2B)
do not confer specific docking defects but rather a mild general reduction in
phosphorylation activity.
(E) The C-terminal tail of Cln2 is dispensable for docking. Full-length Cln2 (1-545)
and truncated forms were tested for substrate phosphorylation (as in C-D).
Truncation endpoints are shown relative to regulatory phosphorylation sites
(P-sites) and tandem cyclin box folds (CBF1, 2) predicted for Cln2 (see Figure
3.2C). Lower abundance was observed consistently for the 1-352 fragment.
(F) Conservation of LP docking in Cln1/2 and Ccn1 cyclins. Top, phylogenetic
tree of six yeasts, and their G1 cyclins. Some species have two Cln1/2
100
paralogs, due to whole genome duplication (WGD); where only one is present, it is denoted as Cln12. The Ccn1 group is related but distinct from
Cln3 and Cln1/2 groups. Bottom, cyclins from different yeasts were tested in
S. cerevisiae as GST-(lz) fusions for substrate phosphorylation in vivo. All cyclins were truncated to remove their C-terminal tails (see Figure 3.2C).
101
Figure 3.1. Sequence constraints and evolutionary conservation of docking
function.
A B C GST-(lz)- D GST-(lz)-
cyclin: Cln2: wt hpm1 hpm3 vector Cln2 Cln1 Cln3 wild docking vector type mutant no phosphorylation substrate w/ dock sites LP dock LP dock Cln1/2-Cdk substrate w/ - +++ leu zipper LP dock leu zipper “LP” +++ +++ docking site Leu zipper GST GST
E F regulatory tail WGD S. cerevisiae Cln3 Cln1, Cln2 C. glabrata Cln3 Cln1, Cln2 CBF1 CBF2 S. kluyveri Cln3 Cln12 Ccn1 K. waltii Cln3 Cln12 Ccn1 Cdk A. gossypii Cln3 Cln12 P-site
332 342 352 362 372 C. albicans Cln3 Hgc1 Ccn1
GST-(lz)- GST-(lz)- Cln2: cyclin: vector Sc Cln3 Ag Cln3 Sc Cln2 Sc Cln1 Cg Cln2 Cg Cln1 Ag Cln12 Sk Cln12 Kw Cln12 Kw Ccn1 Ca Ccn1 vector 1-545 1-372 1-362 1-352 1-342 1-332
no no dock dock
LP LP dock dock
leu leu zipper zipper
GST GST
102
candidate sequences. To help constrain the search, we tested truncations of the
Cln2 C-terminus, and found that we could dispense with roughly one-third of the protein (the C-terminal regulatory tail) and retain LP recognition, whereas truncations that perturb the predicted globular cyclin box fold domains (CBF1, 2) eliminated all activity (Figure 3.1E). Thus, all positions within the roughly 370- residue core of Cln2 remained potential candidates.
The contrasting docking ability of Cln1/2 versus Cln3 must arise from sequence differences, but they were too extensive to explore comprehensively, and chimeras were non-functional and hence uninformative (unpublished observations). Therefore, we devised a strategy to exploit natural sequence variation among fungal G1 cyclins. Namely, by expressing cyclins from other yeasts in S. cerevisiae, we found that recognition of LP docking sites was conserved in other Cln1/2 members and lacking among Cln3 members (Figure
3.1F). Moreover, this led us to test a distinct class of G1 cyclin, the Ccn1 group, which is absent from S. cerevisiae but present in other yeasts such as C. albicans (Figure 3.1F, top), where it promotes hyphal morphogenesis (Loeb et al., 1999). Remarkably, we found that Ccn1 members are proficient at using an
LP docking motif to drive substrate phosphorylation (Figure 3.1F). This revealed that LP docking exists for a class of cyclin other than Cln1/2, and offered a way to further constrain the possible residues involved in docking.
103
Figure 3.2. Leucine zippers, hydrophobic patch, and cyclin domains.
(A) Cln2 was fused to a half leucine zipper (lz) at its N-terminus (lz-Cln2) or C-
teminus (Cln2-lz), or to no zipper (wt). These were co-expressed with a CDK
substrate (Ste5 1-260) harboring no docking site, an LP docking site, or three
variants of the partner half leucine zipper (E34[I], E34[V], or E34[N]) that
range in binding affinity from 6 to 800 nM (Acharya et al., 2002; Bashor et al.,
2008). Reduced gel mobility indicates substrate phosphorylation. The leucine
zipper worked best at the Cln2 N-terminus (lz-Cln2) but did not require strong
affinity. Hence, all further experiments used the weakest affinity version
(E34[N]).
(B) Hydrophobic patch mutations. In S-phase cyclins such as mammalian CycA
or yeast Clb5, recognition of RxL docking motifs is mediated by a hydrophobic
patch (HP) formed largely by helix α1 (the “MRAIL” motif), and mutation of
residues in blue disrupts RxL recognition (Loog and Morgan, 2005; Schulman
et al., 1998; Wilmes et al., 2004). To test if the different helix α1 sequence in
Cln2 leads to recognition of distinct LP-type docking motifs, we mutated the
analogous positions (hpm1) as well as nearby residues (hpm3); see Figure
3.1D. The hpm1 mutations were also tested by other assays in a previous
study (Miller et al., 2005).
(C) Yeast cyclin fragments analyzed in Figure 3.1F. Each diagram shows
predicted α helices (as boxes) and a plot of protein disorder (highest at top),
104
obtained using PSIPRED v3.3 and DISOPRED3, respectively (Buchan et al.,
2013). Truncation endpoints are shown in text and by red arrows. Helix boxes are colored red and blue (as in panel B) to denote regions predicted to correspond to CBF1 and CBF2 globular domains. These general domain boundaries also agree with separate multiple sequence alignments of over 75 fungal G1 cyclins together and with cyclins of known structure (available on request), as well as with 3D structure prediction results for 8 of the 11 cyclins shown here using I-TASSER (Roy et al., 2010).
105
Figure 3.2. Leucine zippers, hydrophobic patch, and cyclin domains
A Cdk C Scer Cln2 1-372 lz-Cln2
Scer Cln1 1-388
LP dock leu zipper
Cgla Cln1 1-362 P -CLN2:
GAL1 wt none lz-Cln2 Cln2-lz
Cgla Cln2 none 1-371
native LP dock Agos Cln12 1-364
leu zipper E34(I) [Kd ~ 6 nM] Sklu Cln12 1-364
leu zipper E34(V) substrate docking motif [Kd ~ 40 nM] Kwal Cln12 1-363 leu zipper E34(N) [Kd ~ 800 nM]
Kwal Ccn1 1-379 B reg. tail S/M cyclins N CBF1 CBF2 C Ca b Ccn1 reg. tail 1-469 Cln1/2/3 N CBF1 CBF2 C
Scer Cln3 1-395 helix α1 human CycA2 SMRAILVDWLVEVGEEY S cer Clb5 SMRTILVDWLVEVHEKF S cer Cln2 wt ETRSNIITFLFELSVVT Agos Cln3 Cln2-hpm1 .A...A..A...... 1-324 Cln2-hpm3 ...... A..A..AA.
106
Identification of a docking defective Cln2 mutant
By performing sequence alignments with multiple members of the Cln1/2, Cln3, and Ccn1 groups, we found that there were many positions where Ccn1 and
Cln3 residues were identical (or nearly so), and hence we excluded these from consideration as key residues in LP docking. Then, we scrutinized those positions that correlated with docking ability; i.e., similar in Cln1/2 and Ccn1, but different in Cln3. Based primarily (though not exclusively) on these considerations, twelve Cln2 mutants were designed (Figures 3.3A, 3.4).
These mutants were tested for their ability to phosphorylate substrates with two distinct LP-type docking sites or the control leucine zipper (Figure 3.3B).
In addition, because they were initially tested in the context of full-length Cln2, we also monitored their ability to auto-phosphorylate the C-terminus. Several mutants (m1, m2, m5, m6, m9) showed non-specific reduction in phosphorylation of all substrates including the leucine zipper control (note the drop in the upper- most forms), while two mutants (m8, m10) had no detectable activity and no auto-phosphorylation, suggesting severe impairment in CDK activity. By contrast, one mutant, cln2-m4, displayed the desired phenotype, as it showed a specific defect with LP-containing substrates but normal phosphorylation of the control substrate (Figure 3.3B). To explore the generality of this phenotype, we compared the analogous m4 mutation in four distinct cyclins – two Cln1/2
107
Figure 3.3. Identification of a docking-defective Cln2 mutant.
(A) Twelve regions of Cln2 were mutated, emphasizing residues conserved in
Cln1/2 and Ccn1 groups but not in Cln3 (see Figure 3.4). One example (m4)
is illustrated by the sequence alignment, with mutated positions marked by
asterisks.
(B) Cln2 mutants were expressed as GST-(lz) fusions to test phosphorylation in
vivo of substrates with either of two LP docking sites (from Ste5 or Ste20) or
the leucine zipper.
(C) Left, the m4 mutation was tested in four different cyclins (two Cln1/2 and two
Ccn1) for effects on docking-dependent phosphorylation. Right, analysis of
single mutations at each of the three residues mutated in the m4 mutant.
108
Figure 3.3. Identification of a docking-defective Cln2 mutant.
A Cln2 CBF1 CBF2
mutant 1 2 3 4 5 6 7 8 9 10 11 12
* ** docking Sc Kw Ag Cln1/2 group + Sk Ag Kw Sc Cln3 group - Cg Ca Dh Kw Ccn1 group + Sk B GST-(lz)- cyclin: vector Cln2 wt m1 m2 m3 m4 m5 m6 m7 m8 m9 m10 m11 m12 Cln3
substrate w/ LPSte5 dock
substrate w/ LPSte20 dock
substrate w/ leu zipper
GST
C Scer Kwal Kwal Calb Scer Cln2 GST-(lz)- Cln2 Cln12 Ccn1 Ccn1 (full length) cyclin: wt wt wt wt wt m4 m4 m4 m4 m4 vector L112A L112A R109A R109A R113A LP dock
leu zipper
GST
109
Figure 3.4. Site-directed mutations in Cln2.
(A) List of specific residue changes in Cln2 mutants m1-m12.
(B) Comparison of Cln1/2, Cln3, and Ccn1 sequences at positions mutated in
cln2 m1-m12. Sequence alignments, created using Clustal Omega (Sievers et
al., 2011), compare representatives of each cyclin group in regions
encompassing the mutated residues, which are marked with asterisks (or by
brackets for large deletions). The top line is S. cerevisiae Cln2. The
mutational strategy prioritized residues conserved in Cln1/2 and Ccn1 groups
but not in Cln3, but also considered some regions where Cln1/2 and Cln3
differ without requiring clear conservation in Ccn1.
110
Figure 3.4. Site-directed mutations in Cln2
A Cln2 CBF1 CBF2
mutant 1 2 3 4 5 6 7 8 9 10 11 12
m1: ∆1-19 m7: V173A D175A M178A m2: Y20A Y21A S25A N26A A27G m8: P197A M198A D201A m3: L61A D63A Q64G m9: N209A M212A Y214A m4: R109A L112A R113A m10: I265K L267G m5: ∆134-152 m11: F300A Q303A D304G m6: E163A V165A H166A m12: L348A P349G E356A L365A Q366A
B m1 m2 m3 ** * ** * ** S cer K wal Cln1/2 A gos S klu A gos K wal Cln3 S cer C gla C alb D han Ccn1 K wal S klu
m4 m5 * ** S cer K wal Cln1/2 A gos S klu A gos K wal Cln3 S cer C gla C alb D han Ccn1 K wal S klu
m6 m7 m8 m9 * ** *** ** * *** S cer K wal Cln1/2 A gos S klu A gos K wal Cln3 S cer C gla C alb D han Ccn1 K wal S klu
m10 m11 m12 ** * ** ** * ** S cer K wal Cln1/2 A gos S klu A gos K wal Cln3 S cer C gla C alb D han Ccn1 K wal S klu
111
members and two Ccn1 members (Figure 3.3C, left). Each showed the same behavior, in which the m4 mutant was defective at using a native LP dock but fully competent to use the leucine zipper. We also tested each of the single residue changes in the original m4 triple mutant, and found that one of the changes, L112A, was largely responsible for the defect (Figure 3.3C, right); however, the L112A single mutant was not quite as defective as the m4 triple mutant. We also observed mild defects in each of the other two single mutants
(R109A and R113A), and hence we used the original m4 triple mutant for further analyses. Collectively, these findings argue that the m4 mutation disrupts a region of the cyclin with a specific role in utilizing LP docking sites.
Cln2 docking function is required for interaction with multiple substrates
To verify that cln2-m4 was defective at docking interactions, we assayed substrate binding. First, we compared several of the initial Cln2 mutants, expressed as GST fusions, for their ability to co-precipitate Ste5, a Cln2 substrate with an LP docking motif (Bhaduri and Pryciak, 2011). As predicted for a docking mutant, cln2-m4 showed reduced binding to Ste5 but normal binding to its partner CDK molecule, Cdc28 (Figure 3.5A). The specific nature of this binding phenotype was reinforced by comparison to other mutants: namely, (i) cln2-m3 showed no binding defects, consistent with it being fully functional in phosphorylation assays; (ii) cln2-m5 showed reduced binding to both Ste5 and
112
Cdc28, suggesting a non-specific general defect that agrees with its reduced activity against all substrates; and, (iii) the cln2-m8 and cln2-m10 mutants were defective at binding Cdc28 but bound Ste5 normally, which agrees with their complete inactivity in phosphorylation assays while separately indicating that binding Cdc28 is not required for binding substrates.
We also conducted reciprocal assays in which GST-substrate fusions were used to co-precipitate V5-tagged Cln2 (Figures 3.5B, C), and found that cln2-m4 showed substantially reduced binding to most substrates tested (i.e.,
Ste20, Ste5, Sic1, Whi5, Rga1, Tus1). The sole exception was Srl3, which binds
Cln2 especially strongly; this might indicate a distinct mode of binding or that the reduction in binding is too mild to register in this assay. As a further control, we tested binding to Grr1, an F-box protein that promotes Cln2 ubiquitination; this binding was unaffected by the m4 mutation (Figure 3.5B), consistent with the fact that Grr1 recognizes the phosphorylated C-terminus of Cln2 rather than the globular CBF domains (Berset et al., 2002; Landry et al., 2012). Finally, we also assayed the effect of the m4 mutation on substrate binding by one of the Ccn1 family members, from K. waltii (Figure 3.5D). This cyclin bound only a subset of the substrates that bind Cln2, indicating some divergence in docking motif recognition (to be pursued as part of a separate study), but each of the detectable interactions was disrupted by the ccn1-m4 mutation.
113
Figure 3.5. Docking-defective Cln2 and Ccn1 mutants shows reduced binding to multiple partners.
(A) Cells (far1∆) co-expressed a galactose-inducible GST-cyclin (or vector) with
V5-tagged Ste5. After galactose induction, GST fusions and co-bound
proteins were captured with glutathione-Sepharose. Bound and input
proteins were analyzed by immunoblots.
(B) The m4 mutation disrupts Cln2 binding to multiple partners. Cells (far1∆)
expressed V5-tagged Cln2 (wt or m4) and galactose-inducible GST fusions to
full-length proteins or N-terminal fragments. Ste5* is a hybrid fragment
(Bhaduri and Pryciak, 2011; Pope et al., 2014), in which the Cln2-docking site
in the Ste20 N-terminus is replaced with one from Ste5. Grr1∆F lacks its F-
box, to prevent it from driving degradation of Cln2 (Landry et al., 2012).
(C) Binding of V5-tagged Cln2 (wt or m4) to GST fusions in a FAR1 strain, in
which binding of Cln2 to some substrates is noticeably weaker than in far1∆
cells (Pope et al., 2014). As in Figure 3.5B, the cln2-m4 mutant shows
reduced binding for some substrates (Ste20 N-terminus and full-length Whi5),
yet Srl3 binding is not detectably altered.
(D) Binding of V5-tagged K. waltii Ccn1 (wt and m4) to the same set of GST
fusion proteins as tested as Figure 3.5B for Cln2 binding. Ccn1 binds only a
subset of the proteins bound by Cln2, but in cases where binding is
detectable it is disrupted by the m4 mutation. Note that these Ccn1
114
fragments (1-379) lack the C-terminal tail and the phosphorylation sites therein, explaining why they do not bind Grr1∆F (Berset et al., 2002; Landry et al., 2012).
115
Figure 3.5. Docking-defective Cln2 and Ccn1 mutants shows reduced binding to multiple partners.
A B GST fusion: none Ste20N Ste5* Sic1N Whi5N Rga1 Srl3 Tus1N Ste5N Grr1∆F GST-cyclin Cln2 wt: + + + + + + + + + + Cln2-m4: + + + + + + + + + +
Cln2 bound vector Cln2 wt Cln3 wt Cln2-m3 Cln2-m4 Cln2-m5 Cln2-m8 Cln2-m10
Ste5 input Cln2 input
Ste5 bound
Cdc28 bound GST bound
GST bound
C D GST fusion: none Ste20N Whi5 Srl3 GST fusion: none Ste20N Ste5* Sic1N Whi5N Rga1 Srl3 Tus1N Ste5N Grr1∆F
Cln2 wt: + + + + Kwal Ccn1 wt: + + + + + + + + + + Cln2-m4: + + + + Kwal Ccn1-m4: + + + + + + + + + +
Cln2 bound Ccn1 bound
Cln2 input Ccn1 input
GST bound GST bound
(strain: FAR1)
116
In vitro kinase assays confirm a specific defect in docking function
To probe the biochemical defects of the cln2-m4 mutant in vitro, we purified wt and m4 versions of the Cln2-Cdc28 complex from yeast cells. cln2-m4 co- purified with normal amounts of Cdc28 and, when using a generic CDK substrate, histone H1, the wt and m4 complexes showed indistinguishable kinase activity. In contrast, however, the cln2-m4 complex showed defects in activity against other substrates in a manner that indicated a specific failure in LP docking function. Namely, for several substrates (Sic1, Sic1∆C, Whi5, Stb1), the activity of the cln2-m4 complex was reduced to a level comparable to that seen when the wt complex was incubated with a competitor LP peptide (Figure 3.6Ai,
3.6B). The competitor peptide had negligible effect on the ability of cln2-m4 complex to phosphorylate docking dependent substrates, indicating that its reduced activity specifically reflects an inability to recognize the LP docking site to enhance phosphorylation. Similarly, mutating the LP docking site on Sic1
(Sic1-vllpp) reduced phosphorylation by the wt complex, but did not affect phosphorylation by the m4 complex (Figure 3.6Ai, 3.6B).
To further assess the defects of the cln2-m4 mutant, the products of these kinase reactions were analyzed on Phos-tag gels, which can resolve substrate isoforms that differ in the number of phosphate groups added. The cln2-m4
117
Figure 3.6. Docking promotes multi-site phosphorylation of substrates in vitro.
(A) Cln2-Cdc28 complexes containing either wt or m4 Cln2 were purified from
yeast cells and assayed for substrate phosphorylation in vitro, both with and
without a competitor LP peptide. (i) Total 32P incorporation into substrates. (ii)
Reaction products were separated on Phos-tag gels to assess the multiplicity
of phosphorylation.
(B) Quantification of 32P incorporation from assays as in panel Ai.
118
Figure 3.6. Docking promotes multi-site phosphorylation of substrates in vitro.
A (i) Cdk substrate: (ii) Cdk substrate: histone H1 Sic1 Sic1 ∆ C Sic1 ∆ C-vllpp GST-Whi5 6xHis-Stb1 histone H1 Sic1 Sic1 ∆ C Sic1 ∆ C-vllpp GST-Whi5 6xHis-Whi5 6xHis-Stb1
Cln2 wt
Cln2 wt + LP peptide
Cln2-m4
Cln2-m4 + LP peptide
B 5 WT 4 WT +LPpep mut4 3 mut4 +LPpep
2
1 phosphoryla)on (rela)ve) 0
Sic1 Sic1∆C histone H1 GST-Whi5 6xHis-Stb1 Sic1∆C-vllpp
119
complex was defective at generating multiply-phosphorylated products of several substrates, and instead yielded products modified on few sites. This behavior is similar to that seen when the competitor LP peptide is included, or when the LP docking site is lacking from the substrate (Figure 3.6Aii). Collectively, these in vitro findings show that the cln2-m4 mutant has a specific defect in utilizing LP docking sites to drive substrate phosphorylation extensively at multiple sites.
Cln2-substrate docking helps coordinate the G1/S transition with cell size
To begin assessing how docking contributes to the cellular functions of Cln2, we first asked if cln2-m4 can support cell growth when expressed from the native
CLN2 promoter. Indeed, the mutant permitted growth when provided as the only
G1 cyclin (Figure 3.7A), as well as under conditions where CLN3 was not sufficient (i.e., cln1∆ cln2∆ pcl1∆ pcl2∆; Figure 3.7B). These results confirm that cln2-m4 remains generally active, and indicate that docking is not the only function that discriminates Cln1/2 from Cln3.
Because G1 phase is a period of growth before division, defects in the control of cell cycle entry can lead to alterations in cell size (Jorgensen and Tyers, 2004;
Turner et al., 2012). When we measured cell volumes in asynchronous cultures
(using cln1∆ strains to eliminate redundancy between Cln1 and Cln2), we found that cln2-m4 cultures were shifted toward mildly larger cells (Figure 3.8A, top &
120
Figure 3.7. Effect of the cln2-m4 mutation on viability and cell size.
(A) Spot growth tests of cyclin plasmids in a cln1∆ cln2∆ cln3∆ background.
Strain PPY2407 (cln1∆ cln2∆ cln3∆ PMET3-CLN2) was transformed with
plasmids expressing the indicated CLN2 alleles from the native CLN2
promoter (or a vector control). Cultures were first kept alive by propagation in
–Met medium to allow expression of the integrated PMET3-CLN2 allele. Then,
serial dilutions were spotted onto medium with or without methionine (to
repress PMET3-CLN2).
(B) Spot growth tests of cyclin plasmids in a cln1∆ cln2∆ pcl1∆ pcl2∆ background.
Strain BY2287A (cln1∆ cln2∆ pcl1∆ PGAL1-PCL2) was transformed with the
indicated CLN2 or CLN3 plasmids, or a vector control. Cultures were first
kept alive by propagation in selective medium with raffinose and galactose.
Then, serial dilutions were spotted onto solid media either with raffinose +
galactose or with glucose (to repress PGAL1-PCL2).
(C) The increases in cell volume caused by the cln2-m4 allele were analyzed as
in Figure 3.8A, but verified in independent strains. Note that all strains are
cln1∆. Solid and dashed lines show mean ± SEM (n = 3, in YPD).
(D) The increases in diameters of mother and unbudded cells caused by the cln2-
m4 allele were analyzed as in Figure 3.8B, but verified using independent
strains (all of which are far1∆ cln1∆). Lines denote the mean ± SD.
121
(E) The cln2-m4 allele does not cause an accumulation of 1C or unbudded cells
in asynchronous, log-phase cultures (grown in YPD). The graphs plot mean ±
SEM (n = 9; left), or mean ± range (n = 2; right).
(F) The cln2-m4 allele and nutrient source affect cell size independently.
Cultures growing in YP or SC media with different carbon source (glucose,
galactose, or raffinose) were analyzed. Graphs plot the mean of duplicate
measurements for each strain and condition.
122
Figure 3.7. Effect of the cln2-m4 mutation on viability and cell size.
A B strain: cln1∆ cln2∆ cln3∆ PMET3-CLN2 strain: cln1∆ cln2∆ pcl1∆ PGAL1-PCL2 plasmid: - methionine + methionine plasmid: galactose glucose vector vector CLN3 CLN2 wt CLN2 wt cln2-m4 cln2-m4
C E 12 FAR1 CLN2 50 60 10 FAR1 cln2-m4 40 8 30 40 6
% 1C 20 4 20 10 2 % unbudded 0 0 0 CLN2: wt m4 wt m4 wt m4 FAR1: FAR1 far1∆ far1∆ % of cells 12 far1∆ CLN2 10 far1∆ cln2-m4 8 6
F YP YP 4 12 Glu Gal 2 10 8 CLN2 0 cln2-m4 0 50 100 150 6
% of cells of % 4 volume (fL) 2 0 D 0 50 100 150 200 250 volume (fL) 8 12 SC SC Glu Raf 6 10 8 CLN2 cln2-m4 4 6
% of cells of % 4 2 -37 -21 diameter ( µ m) p = 10 p = 10 2 0 0 wt m4 wt m4 0 50 100 150 mother cells unbudded cells volume (fL)
123
Figure 3.8. cln2-m4 alters the critical cell size for cell cycle entry.
(A) Cell volume is increased in cln2-m4 strains. Note that all strains are cln1∆.
Solid and dashed lines show mean ± SEM (n = 6, in YPD). Results were
similar in independent strains; see Figure 3.7C.
(B) Increased diameters of mother and unbudded cells in cln2-m4 strains
compared to CLN2-wt, in far1∆ cln1∆ background. Cells were grown in
SC/raffinose. Lines denote mean ± SD. Results were similar in independent
strains; see Figure 3.7D.
(C) cln2-m4 alters critical size. Small G1 daughter cells (in far1∆ cln1∆
background) were isolated by centrifugal elutriation and inoculated in fresh
medium (note, cln2-m4 cells were born larger than wt cells); samples were
collected at 15-min. intervals to assay cell volume, budding, and DNA
replication. For each strain, we assayed two elutriator fractions (denoted by
open and closed symbols) with distinct starting median cell volumes (17 and
23 fL for CLN2 wt, or 27 and 30 fL for cln2-m4), to confirm that the
phenotypes relate to size rather than incubation time. Findings were similar in
independent strains (not shown).
(D) Time-lapse microscopy was used to monitor the size (diameter) of cells at the
times of Whi5 nuclear exit and bud emergence (left), as well as the time
intervals separating Whi5 exit from Sic1 degradation and budding (right).
124
Only the first G1 of newly born daughter cells was monitored. Lines show
mean ± SD.
(E) cln2-m4 does not alter rate of growth. Median cell volumes from experiment
described in Figure 3.8C were plotted against time and slope and R2 values
were calculated for each series.
Cln2-wt: Slope = 0.1129 & 0.1374; cln2-m4: Slope= 0.1665 & 0.1637,
Cln2-wt: R2 = 0.9718 & 0.9944; cln2-m4: R2= 0.9758 & 0.9963.
(F) Summary of phenotypes. In cln2-m4 cells, Whi5 exit is delayed and Start
occurs at a larger cell size. After the delayed Start, subsequent events (DNA
replication, bud emergence) occur with relatively normal timing.
125
Figure 3.8. cln2-m4 alters the critical cell size for cell cycle entry.
A 12 C 75 10 FAR1 CLN2 CLN2 wt 8 50 FAR1 cln2-m4 cln2-m4 6
4
% budded 25 2 0 0 12 60 % of cells 10 far1∆ CLN2 8 CLN2 wt 40 cln2-m4 6 far1∆ cln2-m4
4 % 2C 20 2 0 0 50 100 150 200 0 0 10 20 30 40 50 60 volume (fL) median cell volume (fL)
B D 8 40 80 6 35 60
4 30 40 20 2 25
-31 -24 time (minutes) diameter ( µ m) p = 10 p = 10 0
0 cell diameter (pixels) 20 wt m4 wt m4 wt m4 wt m4 wt m4 wt m4 mother cells unbudded cells Whi5 bud Whi5 Whi5 exit onset to Sic1 to bud
E 60 CLN2 wt F cln2-m4 growth Whi5 exit cell cycle entry 40 (G1) (Start) (S phase)
20 wt
m4
median cell volume ( fL ) 0 0 50 100 150 delayed minutes
126
3.7C top: represents two independently derived strains), consistent with a previously documented role for Cln1/2 in setting critical cell size (Dirick et al.,
1995; Ferrezuelo et al., 2012; Skotheim et al., 2008). Remarkably, this difference between CLN2 and cln2-m4 cultures was amplified in cells lacking the
CDK inhibitor protein Far1 (Figures 3.8A, 3.7C: represents two independently derived strains). We were primed to consider such an effect by our recent finding that Far1 competitively interferes with Cln2-substrate docking (Pope et al., 2014
& Chapter 4). This effect raised the possibility that mutations in the docking interface of Cln2 could simultaneously impair Far1 interaction, so that the resulting defects in positive functions of Cln2 are partly counteracted by reduced inhibition from Far1 (see Discussion). Hence, to avoid differential inhibition, further analysis was conducted using far1∆ strains.
When examined microscopically, mother cells and unbudded cells in cln2- m4 cultures had significantly larger diameters than those in wt cultures (Figures
3.8B, 3.7D: represents two independently derived strains), suggesting that the mutant cells did not begin dividing until they reached a larger size. Indeed, when small daughter G1 cells were isolated by centrifugal elutriation (Figure 3.8C), we observed a clear delay in the G1/S transition such that cln2-m4 cells did not begin budding and DNA synthesis until they reached a roughly one-third greater volume than wt cells (i.e., ~ 40 vs. 30 fL). The m4 cultures started at larger sizes than wt cultures but rate of growth of both wt and m4 cells were very similar
127
(Figure 3.8E). Thus, disruption of the docking function of Cln2 skews the calibration between cell size and cell cycle entry. To pinpoint the defect, we conducted time-lapse microscopy with fluorescent forms of two critical G1/S regulators, the transcriptional repressor Whi5 and the CDK inhibitor Sic1. The cln2-m4 cells delayed the nuclear exit of Whi5 until cells were larger, whereas the subsequent degradation of Sic1 and budding occurred with relatively normal timing thereafter (Figure 3.8D). Thus, the predominant effect of cln2-m4 is to delay Start (Figure 3.8F), which coincides with Whi5 exit and the initiation of
G1/S transcription (Doncic et al., 2011; Skotheim et al., 2008). It is notable that this delay does not cause an accumulation of excess 1C or unbudded cells in asynchronous cultures (Figure 3.7E), likely because cells that bud at a larger size also produce larger daughters (i.e., with a larger birth size), and hence the time from birth to budding remains comparable. The size threshold for division is also regulated by the availability of nutrients such as carbon source (Jorgensen and
Tyers, 2004; Turner et al., 2012), but the cell size effect of the cln2-m4 allele is independent of nutrient regulation, as the mutant cells still shifted to smaller sizes in poor carbon media and were always larger than wt regardless of nutrient conditions (Figure 3.7F). Therefore, nutrient regulation remains intact, but the eventual execution of Start is delayed in cln2-m4 cells.
128
Docking promotes Whi5 phosphorylation and bud polarization
To compare the potency of cyclins at driving Whi5 phosphorylation in vivo, we used conditions in which any delays in achieving critical cell size were first eliminated. For this, we synchronized cells by a prolonged G1 arrest using mating pheromone. Cells arrested in G1 continue to grow (Goranov et al., 2009;
Moore, 1983), and so upon release can begin cell cycle entry without further growth delay (Schwob and Nasmyth, 1993), much as large mother cells do not rely on size and instead use a timer to govern Start (Di Talia et al., 2007). To further equalize initial conditions, and permit comparisons of Cln2 variants both with and without Cln3, we used cells with a separate PMET3-CLN2 construct (Dirick et al., 1995; Skotheim et al., 2008) that was expressed only during initial propagation and then repressed during the experiment.
Using these conditions, we monitored Whi5 gel mobility (Figure 3.9A), which is slowed upon CDK phosphorylation (Costanzo et al., 2004; de Bruin et al., 2004; Wagner et al., 2009). V5-tagged Whi5 was resolved into three species; one in G1 arrested cells, plus two higher forms that appeared after release
(Figure 3.9Ai-ii). Notably, in CLN2-wt cells the highest form eventually became the predominant species, whereas this never occurred in cln2-m4 cells and instead the middle form was predominant. This pattern suggests that cln2-m4 cannot drive Whi5 phosphorylation as extensively as wt, in agreement with the in
129
Figure 3.9. Whi5 phosphorylation and bud polarization depend on Cln2 docking.
(A) CLN3 cln1∆ cln2∆ PMET3-CLN2 and cln3∆ cln1∆ cln2∆ PMET3-CLN2 cells
harbored a CLN2 plasmid (wt or m4; native promoter) or empty vector. Cells
were arrested in G1 phase with α factor (plus methionine to repress PMET3-
CLN2), and then released; aliquots were harvested at times shown. Whi5
phosphorylation was monitored by immunoblotting for Whi5-V5 (i, ii) or Whi5-
GFP (iii); Cln2-V5 levels and a loading control (G6PDH) are shown for set (iii).
(B) mRNAs levels were measured, in the cln3∆ background, using conditions as
in panel (A). Graphs plot mean ± SEM (n = 5), and asterisks indicate p < 0.05
(t-test) for wt vs. m4.
(C) The cln2-m4 protein shows reduced turnover. Cells harboring a CLN2-V5
plasmid (wt or m4; as in panel Diii), growing in +Met medium, were treated
with 50 µg/mL cycloheximide (CHX). Cln2-V5 and G6PDH levels were
measured at times indicated. The graph plots the fraction of protein remaining
(mean ± SD; n = 4) with exponential trendlines; half-lives (t1/2) were calculated
by fitting to an exponential decay (in Prism 7).
(D) cln2-m4 is deficient at driving polarized bud growth. Cells harboring a PGAL1-
CLN2 plasmid (wt or m4) were induced with galactose for 1.5 or 3 hr. Images
are from 1.5 hr. Plots show individual bud lengths with mean ± SD (n > 150);
p = 10-29 (1.5 hr) or 10-33 (3 hr) by two-tailed t-test.
130
(E) Cells harboring PGAL1-CLN2 or PGAL1-CCN1 plasmids (as in Figure 3.3C) were
induced with galactose for 3.5 hr. Plots show bud lengths with mean ± SD (n
> 50); for all pair-wise comparisons of wt versus m4, p < 10-4 (two-tailed t-
test). Also see Figure 3.10B.
131
Figure 3.9. Whi5 phosphorylation and bud polarization depend on Cln2 docking.
A vector CLN2 wt cln2-m4 B CLN2 wt cln2-m4 0 0 0
30 60 90 30 60 90 30 60 90 minutes 15 15 15 45 75 45 75 45 75 vector (i) cln3∆ Whi5- *! strain V5 100 CLB5 (ii) CLN3 Whi5- strain V5 50
(iii) Whi5- CLN3 0 GFP *! strain 0 30 60 90 YOX1120 100 Cln2- V5 50
G6PDH 0 *! 100 C level max.) wt (%of mRNA 0 30 60 90 NRM1120 m4: 1 t1/2 = 11 min. CLN2 wt cln2-m4 50 0 0 0.1 5 5 min. CHX 10 20 30 40 10 20 30 40 wt: 15 15 0.01 t1/2 = 5 min. Cln2-
Cln2(fraction) V5 0 0.001 0 30 60 90 120 0 10 20 30 40 G6PDH minutes minutes in CHX PPY2330 3.5hr 20 D E 3.5 hr )
PGAL1-CLN2: ) 10 15 m ) m µ ( µ m
(
µ h t h t 10 g g n
wt n 5 e l e
l
d d u u
5 b b 0 bud length ( 0 wt m4 wt m4 wt m4 wt m4 m4 wt m4 wt m4 wt-1.5hmut4-1.5hwt-3.5hmut4-3.5h PGAL1-cyclin: Scer Kwal Kwal Calb vector 1.5 hr 3 hr vector Cln2 Cln1/2 Ccn1 Ccn1 Sc-Cln2-wt Sc-cln2-mut4 Ca-CCN1-wt Kw-Cln1/2-wt Kw-CCN1-wt Ca-ccn1-mut4 Kw-ccn1-mut4 Kw-cln1/2-mut4 cyclin
132
vitro assays. GFP-tagged Whi5 was resolved into only two species (Figure
3.9Aiii), but again we observed less of the uppermost form in cln2-m4 cells. This reduced phosphorylation of Whi5 was associated with mildly reduced G1/S transcription (Figure 3.9B) and budding (Figure 3.10A), whereas DNA synthesis was unaffected (Figure 3.10A), consistent with prior findings that Cln1/2 have a more unique role in bud emergence whereas expression of Clb5/6 is sufficient to trigger DNA synthesis (Dirick et al., 1995; Moffat and Andrews, 2004; Schwob and Nasmyth, 1993). Furthermore, it is particularly noteworthy that in the absence of Cln2 (i.e., empty vector), phosphorylation of Whi5 by Cln3 was barely detectable (Figure 3.9Aii-iii), despite prior evidence that Cln3 triggers its initial inactivation (de Bruin et al., 2004; Skotheim et al., 2008). This raises the interesting possibility that Cln3-CDK phosphorylates Whi5 on only a fraction of its twelve CDK sites and that Cln1/2-CDK follow with more complete multi-site phosphorylation (see Discussion). Altogether, these findings indicate that cln2- m4 is not entirely defective but is deficient at driving full modification of substrates.
Interestingly, in these synchronous cultures, the cln2-m4 protein was initially expressed on schedule but then persisted long after the wt protein declined (Figure 3.9Aiii), suggesting that it might have a reduced turnover rate.
Indeed, using a cycloheximide chase assay, the half-life was roughly doubled for the mutant protein (Figure 3.9C). Hence, Cln2 turnover might be governed by
133
docking interactions with specific partner proteins (see Discussion). This stabilization is also noteworthy because the increased protein levels or duration in the mutant might partially counteract its defects.
Finally, we analyzed how docking contributes to function of Cln2 in polarized bud growth. Early in the cell cycle, Cln1 and Cln2 have a special role in driving bud emergence as well as highly polarized apical growth of the new buds, which then shifts to an isotropic pattern as Cln1/2 levels decline and Clb1-6 cyclins take their place (Lew and Reed, 1993). If Cln2 is expressed continuously from a foreign promoter (e.g., PGAL1), it can drive incessant apical growth and lead to hyperpolarized buds (Lew and Reed, 1993). We found that the ability to drive hyperpolarized growth was greatly diminished for the docking mutant, cln2- m4 (Figure 3.9D). Furthermore, the hyperpolarized phenotype was also observed upon expression of other members of the Cln1/2 and Ccn1 subgroups
(Figures 3.9E, 3.10B), and in each case this was disrupted by the m4 mutation.
Thus, docking helps each of these cyclins drive directionally persistent bud growth, which may be of particular importance in fungi that form hyphal filaments
(see Discussion).
134
Figure 3.10. Analysis of synchronous cultures and cell polarization
(A) Budding and DNA replication, in both CLN3 and cln3∆ backgrounds, were
measured following the G1 arrest and release, as in Figure 3.9A. Graphs,
mean ± SEM (n = 3-6).
(B) The effect of m4 mutations on the ability of Cln1/2 and Ccn1 cyclins to
drive polarized bud growth. The same experiment shown in Figure 3.9E
was performed here using only 1.5 hr galactose induction. The graphs plot
individual bud lengths with the mean ± SD (n > 50); p < 10-4, by two-tailed
t-test, for all pair-wise comparisons of wt versus m4.
135
Figure 3.10. Analysis of synchronous cultures and cell polarization
(related to Figure 3.9).
A CLN2 wt cln2-m4 vector CLN3 cells cln3∆ cells 80 60 60 40 40 20 20 budding (%) budding (%) 0 80 600
60 40 40 20 20 DNA rep. (% 2C) DNA rep. (% 2C) DNA 0 0 0 30 60 90 120 0 30 60 90 120 minutes minutes
B 1.5 hr ) 10 m µ (
h t g
n 5 e l
d u b 0 wt m4 wt m4 wt m4 wt m4
PGAL1-cyclin: Scer Kwal Kwal Calb vector Cln2 Cln1/2 Ccn1 Ccn1
136
Discussion
In this study we have identified a mutant form of the yeast cyclin Cln2 that is deficient in recognition of LP-type docking sites on CDK substrates. The detection of key residues in Cln2 was aided by the discovery that recognition of
LP docking motifs is conserved in the distinct Ccn1 group. Mutation of these residues disrupts docking interactions with multiple CDK substrates, and disrupts multi-site phosphorylation of substrates in vitro. In vivo, these defects hamper the ability of Cln2 to drive polarized bud morphogenesis and to fully phosphorylate a key G1/S regulator. Moreover, disruption of docking by Cln2 alters the calibration of Start to cell size, such that cells delay entry into the cell cycle until they are larger than normal.
Conservation of LP docking in both Cln1/2 and Ccn1 groups attests to a selectively advantageous function. Of note, Cln3 and Cln1/2 groups likely diverged from each other after they split from the Ccn1 group (N. Buchler, personal communication), implying that LP docking existed in the prior common ancestor but was then lost in Cln3. Indeed, most non-yeast fungi (dikarya) harbor only one G1 cyclin, and initial studies suggest that they can recognize LP motifs (S. B. and P.M.P., unpublished observations). Still, LP docking may not be identical in each case, as Ccn1 bound some but not all of the same substrates as
Cln1/2 (Figure 3.5D), and we have observed parallel differences in phosphorylation assays (S. B. and P.M.P., unpublished observations). Thus, as
137
the cyclin groups diverged, they may have developed distinct preferences for LP motif composition. Future elucidation of these specificity determinants can illuminate the evolution of these docking networks.
LP docking motifs are functionally distinct from RxL motifs (Bhaduri and
Pryciak, 2011; Koivomagi et al., 2011b), which bind a hydrophobic patch (HP) on
S-phase cyclins (Loog and Morgan, 2005; Schulman et al., 1998; Wilmes et al.,
2004). A comparison of the HP and m4 regions, using bona-fide structures or models, suggests that they are close but separated (Figure 3.11A, B). The m4 residues begin at a ridge bordering the HP cleft and then proceed along the edge of an adjacent plateau. The non-polar Leu112 residue that is most critical in Cln2 is predicted to be solvent-exposed, and thus is well suited to mediate energetically favorable interactions with Leu/Pro-rich LP motifs. Interestingly, although RxL peptides from CDK substrates do not encroach upon the m4 plateau (Cheng et al., 2006; Lowe et al., 2002), the inhibitor protein p27, which binds cyclin A-CDK2 over a broad interface (Russo et al., 1996), does make contacts in this region as it traverses from the HP cleft toward the CDK (Figure
3.11A). Hence, it is conceivable that LP docking originated from an earlier role in assisting contact with CDK inhibitors, and then evolved an independent function.
Indeed, fungal Cln proteins are thought to have evolved from a B-type cyclin precursor (N. Buchler, personal communication). Reconstruction of ancestral
138
Figure 3.11. Docking interfaces and models.
(A) Structures of a mammalian cyclin A-CDK2 complex, with and without the
inhibitor protein p27 (PDB IDs: 1H26, 1JSU), compared to models for S.
cerevisiae Cln2 and K. waltii Ccn1 generated by the I-TASSER algorithm
(Roy et al., 2010). The hydrophobic patch (HP, yellow) and residues altered in
the m4 mutants (red) are highlighted.
(B) Close-up of the boundary between HP and m4 regions in the predicted
models, with mutated residues labeled.
(C) General schematic model for accumulation of Cln1/2-CDK activity and
substrate phosphorylation in late G1 phase. See text for discussion.
(D) Disruption of Cln2 docking may simultaneously disrupt both positive output
and negative regulation. See text for discussion.
139
Figure 3.11. Docking interfaces and models
Cdk cyclin A m4 C HP S. cer. Cln2 model P P P P P P P P substrate:
Cln1/2-Cdk CycA- Cln3-Cdk activity Cdk2
G1 S
K. wal. Ccn1 model Start budding DNA synthesis CycA- Cdk2- p27 D wild type inhibitors B substrate L112 Y100 phosphorylation R109 degradation machinery R97 R113 docking mutant K101 inhibitors substrate degradation phosphorylation machinery S. cer. Cln2 model K. wal. Ccn1 model
140
cyclins might reveal if any intermediate forms recognized both RxL and LP motifs.
In vitro, the docking function of Cln2 was required for the extensive phosphorylation of substrates at multiple sites, which occurs via processive catalysis involving binding of initial phospho-peptides to the Cks1 subunit of the cyclin-CDK-Cks1 complex (Koivomagi et al., 2013; McGrath et al., 2013). Thus, in vivo, cell cycle events that require substrates to become highly phosphorylated are likely to be especially dependent on docking, and this may underlie some functional distinctions between different G1 cyclins. In this regard, the Whi5 phosphorylation behavior that we observed in vivo is especially noteworthy.
Although Cln3 initiates the inactivation of Whi5 (de Bruin et al., 2004; Skotheim et al., 2008), our analysis of Whi5 gel mobility suggests that Cln3 is not as proficient as Cln2 at triggering extensive modification of Whi5 in vivo, and this more potent activity of Cln2 depends at least in part on docking. A superior ability to drive full
Whi5 phosphorylation could explain why Cln1/2 accelerate the pace of Whi5 chromatin dissociation and nuclear exit, after being initiated by Cln3 (de Bruin et al., 2004; Skotheim et al., 2008). A two-stage relay, in which Whi5 is phosphorylated partially by Cln3 and then more completely by Cln1/2, would be remarkably analogous to recent findings on Rb phosphorylation by cyclin D and cyclin E in animal cells (Narasimha et al., 2014), and to the sequential phosphorylation of Sic1 by Cln1/2 and Clb5 in yeast (Koivomagi et al., 2011a;
Yang et al., 2013).
141
We found that substrate docking by Cln2 is important for initiating the cell cycle at the proper size. According to current views on cell size control in yeast,
Cln1/2 are not expected to be involved in the size sensing mechanism per se but rather in the robust execution of molecular events that drive cell cycle entry once the sensing mechanism is satisfied (Jorgensen and Tyers, 2004; Turner et al.,
2012). Thus, the commitment point at Start represents a brief interval in which
Cln1/2-CDK activity rapidly accumulates (Figure 3.11C). Accordingly, the docking function of Cln1/2 likely contributes to a sharp and speedy transition by ensuring that full phosphorylation of substrates occurs promptly once the cyclins start to be expressed. Indeed, many key regulators of the G1/S transition are proteins with multiple CDK sites whose complete phosphorylation would benefit from docking, including not only Whi5 but also Sic1 and Cdh1 (Nash et al., 2001;
Zachariae et al., 1998), whose inactivation permits the rise in Clb-CDK activity needed for DNA synthesis. Notably, the cln2-m4 mutant showed reduced interactions with some of these key regulators (Figure 3.5). Thus, our results support the view that substrate docking by Cln1/2 helps ensure that the commitment step governing cell cycle entry occurs rapidly and decisively.
It is noteworthy that the cln2-m4 phenotypes were subtler in G1 arrest/release experiments than in the first cycle of new daughter cells. A similar phenomenon was observed previously, in which ectopic Clb5 expression
142
triggered S phase much more readily in cells that had undergone prolonged G1 arrest than in early G1 daughters (Schwob and Nasmyth, 1993). Because arrested cells continue to grow, they can be past the critical size at the time of release, and this may alter the threshold level of cyclin-CDK activity required to pass Start (Di Talia et al., 2007).
Our observation that Cln2 docking contributes to bud formation and polarized morphogenesis fits with prior findings that Cln2 substrates include several proteins involved in cell polarization such as GEFs and GAPs for Rho
GTPases (reviewed in (Enserink and Kolodner, 2010; Wang, 2009)), some examples of which (i.e., Rga1, Tus1) showed reduced binding to cln2-m4.
Relatedly, G1 cyclins drive persistent polarized growth in filamentous fungi such as Ashbya gossypii (Hungerbuehler et al., 2007) and Candida albicans (Loeb et al., 1999; Zheng and Wang, 2004), where they phosphorylate secretory proteins and septins (Bishop et al., 2010; Sinha et al., 2007; Zheng et al., 2007).
Substrate docking by the Cln1/2 and Ccn1 groups could help maintain high levels of substrate phosphorylation in a localized subcellular domain, and conceivably could co-localize the cyclin with substrates at sites of polarized growth.
Two sources of indirect evidence suggest that the docking interface on
Cln2 promotes not only positive functions but also regulation by antagonists
(Figure 3.11D). First, the cln2-m4 protein shows reduced turnover, suggesting
143
that the docking interface might interact with degradation machinery. A likely participant in this process is Cdc48, which binds Cln2 and stimulates its turnover
(Archambault et al., 2004); unfortunately, we have not yet obtained sufficiently strong binding with Cdc48 to test if it is disrupted by the m4 mutation. Second, some phenotypic differences between wt and cln2-m4 alleles were greater in far1∆ cells. This raises the possibility that, when comparing Cln2-wt and cln2-m4 in FAR1 cells, the defects in positive functions of cln2-m4 are partly suppressed by reduced inhibition from Far1. Of note, Far1 blocks Cln2-substrate docking
(Pope et al., 2014 & Chapter 4), and hence it may engage the docking interface on Cln2. Indeed, in a recently developed in vitro assay for Far1 inhibition (E.V. and M.L., in preparation), the cln2-m4 mutation increased the Ki of Far1 by roughly ten-fold. There are precedents for a single docking region binding both positive and negative factors, including in cyclin-CDK complexes (Lowe et al.,
2002; Russo et al., 1996; Schulman et al., 1998) and MAP kinases (Remenyi et al., 2005). Competition among substrates and regulators for a common docking interface may provide a simple mechanism to integrate multiple factors.
In conclusion, our findings uncover a novel substrate-docking interface, conserved among distinct G1 cyclin sub-groups, that contributes to efficient, multi-site phosphorylation of substrates and to the punctual entry into the cell cycle. The patterns of conservation among different G1 cyclins could illuminate further studies into the evolution of docking interfaces, and they also raise the
144
question of whether the Cln3 group lacks docking entirely or if it has docking interactions that remain to be discovered. In addition, it will be of interest to study the requirement for LP docking by G1 cyclins in filamentous fungi where polarized growth at hyphal tips shows high directional persistence. Finally, these findings provide a useful launch point for future studies into understanding how robust substrate phosphorylation promoted by cyclin-substrate docking interactions influences cell-to-cell variability of Start (Di Talia et al., 2007;
Ferrezuelo et al., 2012) and the temporal coherence of distinct events at the
G1/S transition (Skotheim et al., 2008).
Acknowledgements
We thank Rick Baker, Amy Gladfelter, Oliver Rando, and Charlie Specht for fungal DNA samples, Jenny Benanti and Jan Skotheim for yeast strains and plasmids, Dan McCollum, Nick Rhind, and Eduardo Torres for use of lab equipment, and Nick Buchler and Jan Skotheim for helpful discussions.
145
Materials and Methods
Yeast Strains and Plasmids
Standard procedures were used for growth and genetic manipulation of yeast
(Rothstein, 1991; Sherman, 2002). Cells were grown at 30°C in yeast extract/peptone medium with 2% glucose (YPD) or galactose (YPGal), or in synthetic (SC) medium with 2% glucose and/or raffinose. Strains and plasmids are listed in the tables below. The cln2-m4 allele was introduced at the native
CLN2 locus by two-step (pop-in/pop-out) allele replacement (Rothstein, 1991), using plasmid pPP4121. PCR-mediated methods (Longtine et al., 1998) were used for gene deletion and tagging endogenous gene loci.
In vivo CDK Phosphorylation Assays
As described previously (Bhaduri and Pryciak, 2011; Pope et al., 2014), cells harboring PGAL1-GST-cyclin constructs and HA-tagged CDK substrates were grown in synthetic raffinose media, and then induced with 2% galactose (for 2.5 hr) to drive cyclin expression; substrates were based on the Ste5 N-terminus, with or without docking sites as indicated. Whole cell extracts were prepared, and substrate phosphorylation was assessed by SDS-PAGE and immunoblotting.
Protein Preparation, Binding, and Immunoblotting
Whole cell extracts were prepared by lysis in trichloroacetic acid as described previously (Pope et al., 2014), using 5 or 2 mL cultures (OD660 ~ 0.6); total
146
protein concentrations were measured by BCA assay, and equal amounts
(usually 20 µg) were loaded per lane.
GST co-precipitation binding assays were performed as described (Pope et al., 2014). Briefly, 10 mL cultures were treated with 2% galactose (1.5 hr) to express GST fusion proteins. Extracts were prepared by glass bead lysis, and
GST fusions and co-bound proteins were collected using glutathione-sepharose beads.
For immunoblotting, proteins were resolved by SDS-PAGE and transferred to PVDF in a submerged tank. Primary antibodies were mouse anti-
V5 (1:5000, Invitrogen #46-0705), anti-HA (1:1000, Covance #MMS101R), anti-
GFP (1:200, Clontech # 632381) or anti-GST (1:1000, Santa Cruz
Biotechnologies #sc-138), rabbit anti-G6PDH (1:1000, Sigma #A9521), and goat anti-Cdc28 (1:200 Santa Cruz #sc-6709). HRP-conjugated secondary antibodies were goat anti-mouse (1:3000, BioRad #170-6516), goat anti-rabbit (1:3000,
Jackson ImmunoResearch #111-035-144), or donkey anti-goat (1:3000 Santa
Cruz #sc-2020). Enhanced chemiluminescent detection used a BioRad Clarity kit
(#170-5060).
Synchronous Cultures
Small G1 cells were purified by centrifugal elutriation as described previously
(Strickfaden et al., 2007). Initial cultures (0.7-1 L) were grown in synthetic
147
raffinose medium. Elutriated cells were resuspended in YPD and then incubated at 30˚C.
For synchronization by G1 arrest/release, CLN3 cln1∆ cln2∆ PMET3-CLN2 and cln3∆ cln1∆ cln2∆ PMET3-CLN2 cells harbored a CLN2 plasmid (wt or m4; native promoter) or empty vector. Cells were grown in –Met medium, then arrested in G1 phase by transfer to +Met medium (to repress PMET3-CLN2) containing α factor (0.1 µM, 150 min), then released by washing twice and incubating in +Met medium without α factor.
Flow Cytometry and Budding Assays
DNA content was measured by flow cytometry using Sytox Green as described previously (Pope and Pryciak, 2013). Budding status was assayed using formaldehyde-fixed cells as described previously (Pope and Pryciak, 2013); 200 cells were counted per condition.
mRNA Preparation and RT-qPCR Analysis
RNA was prepared as described previously (Pope and Pryciak, 2013), and cDNA was synthesized from ~1 µg of RNA with a QuantaBio qScript kit (#95048-025); products were diluted to 5 ng/µL. Quantitative real-time PCR was performed using KAPA Biosystems SYBR FAST qPCR Master Mix (#KK4601). Reaction mixtures (10 µL) contained 5 µL of SYBR Green mix, 1.3 µL of primer mix (0.4
µM each primer), 1 µL of cDNA (5 ng), and 2.7 µL of water. Reactions were
148
performed in 96-well plates, in duplicate, using a BioRad CFX96 instrument;
ACT1 mRNA served as the internal control. Data were normalized to the average maximum wt level.
Cell Size Measurements
Cell volume was measured using a Beckman Coulter Multisizer 3 (Beckman
Coulter). Log-phase cultures were briefly sonicated, and then 10 µL was diluted into 10 mL of Isoton II diluent (Beckman Coulter #8546719), and 30,000 cells were sized per sample. Particles below 3 µm in diameter were excluded to ignore dead cells.
Cell diameters and bud lengths were measured microscopically. Images of multiple fields of live cells were captured, and then all relevant cells were analyzed in Image J software. Mother cell diameter was defined by a line starting at the midpoint of the bud neck, bisecting the mother. Unbudded cells were measured using the longest axis evident. Bud lengths were measured from neck to tip.
In Vitro Kinase Assays
HA3-tagged Cln2-Cdc28 complexes were purified from yeast (PPY2443,
PPY2444) using previous immunoaffinity methods (Koivomagi et al., 2013;
Koivomagi et al., 2011b).
149
Time-Lapse Microscopy
Cells expressing Whi5-mCherry and Sic1-GFP, growing in SC medium, were entrapped in a CellASIC microfluidic device, as in previous studies (Doncic et al.,
2011). Images were acquired every 3 min., and multiple fields were followed simultaneously. Using pre-existing software (Doncic et al., 2011; Yang et al.,
2013), fluorescence data were analyzed to determine the midpoint times of Whi5 nuclear exit and Sic1 degradation. Phase-contrast images were inspected manually to determine the time of bud emergence, and Image J software was used to measure cell diameters at the midpoint of Whi5 exit and the onset of budding.
150
Table 3.1. Yeast strains used in Chapter III
Yeast strains used in this study. Name Background* Relevant Genotype Source†
BY2287 (a) MATa cln1∆::TRP1 cln2Δ::LEU2 pcl1Δ::HIS3 kanMX6-PGAL1-3HA-PCL2 (1) BY4741 (b) MATa (2) PPY2322 (b) MATa bar1∆::hphMX6 (3) PPY2326 (b) MATa bar1∆::hphMX6 far1Δ::kanMX6 (3) PPY2327 (b) MATa bar1∆::hphMX6 STE5-8A far1Δ::kanMX6 (3) PPY2330 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-S87A (3)
PPY2406 (c) MATa bar1∆::hphMX6 TRP1::PMET3-CLN2 WHI5-GFP::kanR HTB2- § mCherry::spHIS5 cln1::HIS3 cln2∆ PPY2407 (c) MATa bar1∆:hphMX6 TRP1::PMET3-CLN2 WHI5-GFP::kanR HTB2- § mCherry::spHIS5 cln1::HIS3 cln2∆ cln3::LEU2 PPY2431 (c) MATa bar1∆::hphMX6 TRP1::PMET3-CLN2 WHI5-3xV5::natMX6 HTB2- § mCherry::spHIS5 cln1::HIS3 cln2∆
PPY2432 (c) MATa bar1∆:hphMX6 TRP1::PMET3-CLN2 WHI5-3xV5::natMX6 HTB2- § mCherry::spHIS5 cln1::HIS3 cln2∆ cln3::LEU2 PPY2433 (c) MATa bar1::hisG SIC1-TAP::HIS3MX6 cln1∆::LEU2Cg ‡ PPY2438 (c) MATa bar1::hisG sic1(vllpp)-TAP::HIS3MX6 cln1∆::LEU2Cg ‡ PPY2443 (c) MATa bar1∆ cln2::TRP1::PGAL1-HA3-CLN2 # PPY2444 (c) MATa bar1∆ cln2::TRP1::PGAL1-HA3-cln2-m4 # PPY2452 (c) MATa bar1::hisG SIC1-TAP::HIS3MX6 cln1∆::LEU2Cg cln2-m4 ‡ PPY2457 (c) MATa bar1::hisG sic1(vllpp)-TAP::HIS3MX6 cln1∆::LEU2Cg cln2-m4 ‡ PPY2472 (c) MATa ADE2 bar1::hisG WHI5-mCherry::HIS3MX6 SIC1-GFP::kanMX6 # cln1∆::LEU2Cg PPY2474 (c) MATa ADE2 bar1::hisG WHI5-mCherry::HIS3MX6 SIC1-GFP::kanMX6 # cln1∆::LEU2Cg cln2-m4 PPY2487 (c) MATa bar1::hisG SIC1-TAP::HIS3MX6 cln1∆::LEU2Cg far1∆::kanMX6 # PPY2488 (c) MATa bar1::hisG SIC1-TAP::HIS3MX6 cln1∆::LEU2Cg cln2-m4 # far1∆::kanMX6 PPY2490 (c) MATa ADE2 bar1::hisG WHI5-mCherry::HIS3MX6 SIC1-GFP::kanMX6 # cln1∆::LEU2Cg far1∆::kanMX6 PPY2492 (c) MATa ADE2 bar1::hisG WHI5-mCherry::HIS3MX6 SIC1-GFP::kanMX6 # cln1∆::LEU2Cg cln2-m4 far1∆::kanMX6
* Strain Background: (a) S288C/BY263 (ade2-107 his3∆200 leu2-3,112 lys2-801 trp1∆63 ura3-52 ssd1-d); (b) BY4741 (his3∆1 leu2∆0 ura3∆0 met15∆0); (c) W303 (ade2-1 his3-11,15 leu2-3,112 trp1-1 ura3-1 can1).
† Source: (1) Moffat/Andrews; (2) Bachman/Boeke; (3) Pope/Bhaduri; (§) this study, derived from JS146-8C and JS146-16C (Doncic et al.); (‡) this study, derived from MK0158 and MK0311 (Koivomagi et al.; Koivomagi et al.); (#) this study.
151
Table 3.2. Plasmids used in Chapter III
Plasmids used in this study Name Alias Description Source pPP681 pRS316 CEN URA3 vector (1) pPP2154 pHG-GST CEN HIS3 PGAL1-GST vector (2) pPP2163 pHGT-S20A CEN HIS3 PGAL1-GST-ste20(1-333) (3) pPP3266 pS5kV5 CEN URA3 STE5-3xV5 TCYC1 (4) pPP3434 pS5kHA-1-315 CEN URA3 ste5 1-315- 3xHA TCYC1 (2) pPP3503 pS5kHA-1-260 CEN URA3 ste5 1-260- 3xHA tag TCYC1 (2) pPP3509 pH5n-1-337-wt CEN URA3 ste5 1-337-(wt)- 3xHA TCYC1 (2) pPP3547 pH5n-1-260-S20CSM CEN URA3 ste5 1-260-(Ste20 80-115wt)- 3xHA TCYC1 (2) pPP3714 pH5n-1-337-P4 CEN URA3 ste5 1-337-(LLPP-AAAA)- 3xHA TCYC1 (2) pPP3807 pH5n-1-260-dExo84 CEN URA3 ste5 1-260-(Exo84 281-311)- 3xHA TCYC1 (2) pPP3825 pHG-GST-S20M-5CSM-wt CEN HIS3 PGAL1-GST-ste5(263-335/WT) + ste20(120-333) (2) pPP3874 pt-HGTB-CLN2-F CEN HIS3 PGAL1-GST-CLN2(1-545) TCYC1 this study pPP3875 pS5kHA-1-260-E34(I) CEN URA3 ste5(1-260)-[E34(I) zipper]- 3xHA TCYC1 this study pPP3876 pS5kHA-1-260-E34(V) CEN URA3 ste5(1-260)-[E34(V) zipper]- 3xHA TCYC1 this study pPP3877 pS5kHA-1-260-E34(N) CEN URA3 ste5(1-260)-[E34(N) zipper]- 3xHA TCYC1 (4) pPP3903 pt-HGTB-CLN2-F-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545) TCYC1 this study pPP3904 pt-HGTB-CLN2-F-R34dn CEN HIS3 PGAL1-GST-CLN2(1-545)-[R34 zipper] TCYC1 this study pPP3916 pt-HGT-CLN2-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-372) TCYC1 (4) pPP3917 pt-HGTB-CLN2-hpm1-Rup CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /hpm1) TCYC1 this study pPP3918 pt-HGTB-CLN2-hpm3-Rupb CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /hpm3) TCYC1 this study pPP3919 pt-HGT-Rup-Sklu-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Sklu CLN1/2(1-364) TCYC1 this study pPP3920 pt-HGT-Rup-Kwal-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CLN1/2(1-363) TCYC1 this study pPP3921 pt-HGT-Rup-Agos-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Agos CLN1/2(1-364) TCYC1 this study pPP3922 pt-HGT-Rup-Cgla-CLN1 CEN HIS3 PGAL1-GST-[R34 zipper]-Cgla CLN1(1-362) TCYC1 this study pPP3923 pt-HGT-Rup-Cgla-CLN2 CEN HIS3 PGAL1-GST-[R34 zipper]-Cgla CLN2(1-371) TCYC1 this study pPP3929 pt-HGT-CLN1-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN1(1-388) TCYC1 (4) pPP3954 pt-HGTE-CLN2-F-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545) TCYC1 this study pPP3957 pt-HGT-Rup-Kwal-CCN1 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CCN1(1-379) TCYC1 this study pPP3959 pt-HGT-Rup-Calb-CCN1-a CEN HIS3 PGAL1-GST-[R34 zipper]-Calb CCN1(1-469) TCYC1 this study pPP3963 pt-HGT-Rup-Agos-CLN3 CEN HIS3 PGAL1-GST-[R34 zipper]-Agos CLN3(1-324) TCYC1 this study pPP3964 pt-HGT-CLN3-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN3(1-395) TCYC1 (4) pPP3965 pt-HGTE-Rup-CLN2-mut1 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m1) TCYC1 this study pPP3966 pt-HGTE-Rup-CLN2-mut2 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m2) TCYC1 this study pPP3967 pt-HGTE-Rup-CLN2-mut3 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m3) TCYC1 this study pPP3968 pt-HGTE-Rup-CLN2-mut4 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m4) TCYC1 this study pPP3969 pt-HGTE-Rup-CLN2-mut5 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m5) TCYC1 this study pPP3970 pt-HGTE-Rup-CLN2-mut6 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m6) TCYC1 this study pPP3971 pt-HGTE-Rup-CLN2-mut7 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m7) TCYC1 this study pPP3972 pt-HGTE-Rup-CLN2-mut8 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m8) TCYC1 this study pPP3973 pt-HGTE-Rup-CLN2-mut9 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m9) TCYC1 this study pPP3974 pt-HGTE-Rup-CLN2-mut10 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m10) TCYC1 this study pPP3975 pt-HGTE-Rup-CLN2-mut11 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m11) TCYC1 this study pPP3976 pt-HGTE-Rup-CLN2-mut12 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /m12) TCYC1 this study pPP4078 pHGT-Rga1-FL CEN HIS3 PGAL1-GST-RGA1 (full length) this study pPP4079 pHGT-Srl3-FL CEN HIS3 PGAL1-GST-SRL3 (full length) this study pPP4080 pHGT-Tus1-1-300 CEN HIS3 PGAL1-GST-tus1(1-300) this study pPP4111 pt-HGT-Rup-CLN2-t-mut4 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-372 /m4) TCYC1 this study pPP4115 pCLN2pr-CLN2-V5-wt CEN URA3 PCLN2-CLN2(1-545 /wt)-3xV5 TCYC1 this study pPP4116 pCLN2pr-CLN2-V5-mut4 CEN URA3 PCLN2-CLN2(1-545 /mut4)-3xV5 TCYC1 this study pPP4117 pCYC1-CLN2-V5-wt CEN URA3 PCYC1-CLN2(1-545 /wt)-3xV5 TCYC1 this study pPP4118 pCYC1-CLN2-V5-mut4 CEN URA3 PCYC1-CLN2(1-545 /mut4)-3xV5 TCYC1 this study pPP4121 pIU-CLN2-mut4 integrating URA3 cln2-mut4 this study pPP4122 pt-HGT-Rup-Kwal-CCN1-mut4 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CCN1(1-379 /m4) TCYC1 this study pPP4123 pt-HGT-Rup-Calb-CCN1-mut4 CEN HIS3 PGAL1-GST-[R34 zipper]-Calb CCN1(1-469 /m4) TCYC1 this study pPP4124 pt-HGT-Rup-Kwal-CLN1/2-mut4 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CLN1/2(1-363 /m4) TCYC1 this study pPP4125 pt-HGTE-Rup-CLN2-mut4f CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /R109A) TCYC1 this study pPP4126 pt-HGTE-Rup-CLN2-mut4g CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /L112A) TCYC1 this study pPP4127 pt-HGTE-Rup-CLN2-mut4h CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-545 /R113A) TCYC1 this study pPP4140 pt-HGT-Rup-CLN2-1-362 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-362) TCYC1 this study pPP4141 pt-HGT-Rup-CLN2-1-352 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-352) TCYC1 this study pPP4142 pt-HGT-Rup-CLN2-1-342 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-342) TCYC1 this study pPP4143 pt-HGT-Rup-CLN2-1-332 CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-332) TCYC1 this study pPP4146 pHGT-Sic1-1-214 CEN HIS3 PGAL1-GST-sic1(1-214) (4) pPP4147 pHGT-Whi5-FL CEN HIS3 PGAL1-GST-WHI5 (full length) (4)
152
pPP4148 pCLN2pr-CLN2-myc-wt CEN URA3 PCLN2-CLN2(1-545 /wt)-myc13 TCYC1 this study pPP4149 pCLN2pr-CLN2-myc-mut4 CEN URA3 PCLN2-CLN2(1-545 /m4)-myc13 TCYC1 this study pPP4152 pt-HGT-Whi5-1-172 CEN HIS3 PGAL1-GST-whi5(1-172) (4) pPP4153 pCYC1-Kw-CCN1-V5-wt CEN URA3 PCYC1-Kwal CCN1(1-379 /wt) 3xV5 TCYC1 this study pPP4154 pCYC1-Kw-CCN1-V5-mut4 CEN URA3 PCYC1-Kwal CCN1(1-379 /m4) 3xV5 TCYC1 this study pPP4157 pt-HGT-GRR1-dF CEN HIS3 PGAL1-GST-grr1(ΔF)-Flag TCYC1 this study pPP4158 pt-HGT-STE5-1-341 CEN HIS3 PGAL1-GST-GFP-ste5(1-341) this study pPP4160 pCYC1-CLN3-t-V5 CEN URA3 PCYC1-CLN3(1-395)-3xV5 TCYC1 this study` * Source: (1) (Sikorski and Hieter, 1989); (2) (Bhaduri and Pryciak, 2011); (3) (Takahashi and Pryciak, 2007); (4) (Pope et al., 2014)
Table 3.3 Oligonucleotide primers used for RT-qPCR analysis in Chapter III
Oligonucleotide primers used for RT-qPCR analysis Primer Name Sequence (5’ to 3’)
ACT1-fw1 TTCCAGCCTTCTACGTTTCC ACT1-rev1 CCAGCGTAAATTGGAACGAC CLB5-up2 GGATCTCCAAGGCAGATGAT CLB5-dn2 CCATTGCGCTTACGGTAGAT YOX1-up1 AAATAGGCGCTCATCCACAC YOX1-dn1 ACGTTTTCACGGGAGTCAAC NRM1-up2 GAAGTTGCAAATTCGTTTAC NRM1-dn2 CGCGACTTTGGAAGGCCTCG
153
CHAPTER IV
Regulation of cyclin-substrate docking by a G1 arrest signaling
pathway and the CDK inhibitor Far1
The following Chapter contains the manuscript:
Pope, P. A.,* Bhaduri, S.,* Pryciak, P. M. (2014). Regulation of cyclin-substrate docking by a G1 arrest signaling pathway and the CDK inhibitor Far1 (* Co-first authors). Current Biology, 24(12), 1390-1396 [PMID 24909323]
The study has been devised by and all results have been interpreted by myself,
Dr. Pope and Dr. Pryciak.
Parts of Figures 4.4, 4.5, 4.6, 4.7 and 4.8 have been contributed by myself.
All other Figures have been contributed by Dr. Pope.
The manuscript had been prepared by myself, Dr. Pope and Dr. Pryciak.
154
Abstract
Eukaryotic cell division is often regulated by extracellular signals. In budding yeast, signaling from mating pheromones arrests the cell cycle in G1 phase
(Bardwell, 2005). This arrest requires the protein Far1 (Chang and Herskowitz,
1990), which is thought to antagonize the G1/S transition by acting as a CDK inhibitor (CKI) (Peter et al., 1993; Peter and Herskowitz, 1994), although the mechanisms remain unresolved (Gartner et al., 1998). Recent studies found that
G1/S cyclins (Cln1 and Cln2) recognize CDK substrates via specific docking motifs, which promote substrate phosphorylation in vivo (Bhaduri and Pryciak,
2011; Koivomagi et al., 2011b). Here, we show that these docking interactions are inhibited by pheromone signaling, and that this inhibition requires Far1.
Moreover, Far1 mutants that cannot inhibit docking are defective at cell cycle arrest. Consistent with this arrest function, Far1 outcompetes substrates for association with G1/S cyclins in vivo, and it is present in large excess over G1/S cyclins during the pre-commitment period where pheromone can impose G1 arrest. Finally, a comparison of substrates that do and do not require docking suggests that Far1 acts as a multi-mode inhibitor that antagonizes both kinase activity and substrate recognition by Cln1/2-CDK complexes. Our findings uncover a novel mechanism of CDK regulation by external signals, and shed new light on Far1 function to provide a revised view of cell cycle arrest in this model system.
155
Background and Results
During cell cycle arrest by pheromone, Far1 is thought to act as a CDK inhibitor
(CKI) that antagonizes cyclin-CDK complexes containing early cyclins (Cln1,
Cln2, Cln3), which function in G1 to drive cell cycle entry (Figure 4.1A). Far1 binds these CDK complexes in vivo (Tyers and Futcher, 1993) and appeared to inhibit Cln2-CDK activity in vitro (Peter and Herskowitz, 1994), but later studies failed to detect this inhibitory effect (Gartner et al., 1998) and others suggested that Far1 might inhibit Cln3-CDK or regulate Cln2 protein levels (Jeoung et al.,
1998; Valdivieso et al., 1993). Consequently, the precise effects of pheromone and Far1 on CDK function in vivo have remained unresolved. Recent studies revealed that some Cln-CDK phosphorylation events require docking interactions between Cln1/Cln2 and specific motifs in substrate proteins, including components of the mating pathway (Ste5, Ste20) and regulators of the G1/S transition (Sic1, Whi5) (Bhaduri and Pryciak, 2011; Koivomagi et al., 2011b).
Therefore, we asked if pheromone signaling and/or Far1 might disrupt these docking interactions, either in addition to or as an alternative to direct inhibition of
CDK activity per se (Figure 4.1B).
To monitor docking, we used an assay in which a GST-substrate fusion and an epitope-tagged cyclin (Cln2) were co-expressed and co-precipitated
(Bhaduri and Pryciak, 2011). (Here, we took steps to prevent CLN2 expression and pheromone signaling from interfering with each other; see Experimental
156
Figure 4.1. Pheromone signaling disrupts Cln2-substrate interactions.
(A) Mating pheromones signal through a MAP kinase cascade, leading to
phosphorylation and increased expression of Far1, which is thought to induce
G1 arrest by inhibiting Cln-CDK complexes.
(B) Far1 could inhibit cyclin-substrate docking (left) or Cln-CDK kinase activity
(right).
(C) Cells harboring Cln2-myc (expressed from the CYC1 promoter; see Figure
4.2) and a galactose-inducible GST fusion to the Ste20 N-terminus (Ste20*)
were induced with galactose with or without pheromone (α factor) for varying
times. Complexes were captured on glutathione-sepharose. Bound and input
samples were analyzed by anti-myc and anti-GST blots.
(D) Binding of Cln2-myc to galactose-inducible GST-Ste20* or GST-Ste5*,
induced with or without pheromone. Note that pheromone disruption of Cln2-
substrate binding was lost in far1∆ cells.
157
Figure 4.1. Pheromone signaling disrupts Cln2-substrate interactions.
A C - α factor + α factor minutes 0 0
galactose: 15 30 60 15 30 60 120 180 120 180
Cln2-myc Ste5 Ste11 bound
Ste7
Fus3 Cln2-myc total FAR1 P mRNA Cdk Far1 PGAL1-GST- inhibitor Ste20*
Cln-Cdk D
PGAL1-GST: vector Ste20* vector Ste5* vector Ste5*
G1 S α factor: - + - + - + - + - + - + Cln2-myc B bound Far1 or Far1 Cln2-myc ? total ?
GST
Cln-Cdk substrate far1∆
158
Figure 4.2. Effects of Cln2 and Far1 on pheromone response.
Pheromone signaling is reduced by deleting FAR1 or expressing CLN2 from foreign, constitutively-active promoters (PCYC1 and PADH1). Strains with the indicated genotypes (PPY640, PPY892, PPY2075, PPY2076) harbored plasmids expressing CLN2 from the indicated promoters or a vector control (pPP681, pPP3203, pPP3079). Cells were treated with α factor (5 µM, 2 hr). Pheromone response was assayed using a transcriptional reporter (FUS1-lacZ); results
(mean ± SD; n = 4) were normalized to the wild-type strain with vector. Note that cells lacking Far1 (far1∆) have reduced signaling, and are sensitive to further reduction by extra CLN2. These features are eliminated by the CDK-resistant
STE5-8A allele (Strickfaden et al., 2007), such that the presence or absence of
Far1 (or excess CLN2) no longer affects pheromone signaling. Thus, by using
STE5-8A strains, it is possible to compare the effect of Far1 on Cln2-substrate interactions without complicating secondary effects on pheromone signaling due to the presence or absence of Far1 and/or Cln2.
159
Figure 4.2. Effects of Cln2 and Far1 on pheromone response.
A
promoter CLN2 ORF myc13 TCYC1
B vector 125 PCYC1-CLN2 PADH1-CLN2 100
75
50
25 pheromoneresponse (%)
0 wild type far1∆ STE5-8A STE5-8A far1∆
160
Procedures and Figure 4.2.) First, we tested a GST fusion to a Cln2-binding fragment of Ste20 (residues 72-333, designated Ste20*)(Bhaduri and Pryciak,
2011), expressed from an inducible promoter (PGAL1). Without pheromone, we observed Cln2-myc binding as soon as GST-Ste20* expression was detected, but binding was strongly inhibited when pheromone was included (Figure 4.1C).
(Note, total Cln2 levels were often reduced by prolonged pheromone treatments, as in earlier studies (Valdivieso et al., 1993), so we used short treatment times where possible to minimize this effect.) Pheromone also inhibited Cln2-myc binding to another, similar GST fusion (GST-Ste5*), in which the Cln2 docking site from Ste20 was replaced with one from Ste5 (Figure 4.1D). Remarkably, this inhibition was not observed in far1∆ cells (Figure 4.1D). Therefore, pheromone signaling can disrupt Cln2-substrate binding interactions in a manner that depends on Far1.
Next, we tested the role of regulatory phosphorylation sites in Far1 (Figure
4.3A): phosphorylation at residue T306 by the MAPK Fus3 promotes Far1 function, whereas phosphorylation at residue S87 by CDK triggers its degradation (Gartner et al., 1998). We introduced non-phosphorylatable Ala mutations at these sites, tested previously in an N-terminal fragment of Far1
(Gartner et al., 1998), into full-length Far1 expressed from the native FAR1 locus.
As expected, the T306A mutant was defective at pheromone arrest whereas the
161
Figure 4.3. Far1 inhibition of docking correlates with G1 arrest ability.
(A) Pheromone triggers phosphorylation of Far1 at T306, which promotes G1
arrest, whereas CDK phosphorylates Far1 at S87, which promotes its
degradation (Gartner et al., 1998).
(B) The indicated FAR1 strains were tested for pheromone arrest. Cell lawns
were overlaid with disks containing 20 µL of α factor (20 or 100 µM), and
incubated at 30˚C for 2 days.
(C, D) Binding of Cln2-myc to GST-Ste20* or GST-Ste5* was analyzed (as in
Figure 4.1) using strains with different FAR1 alleles, in the presence or
absence of pheromone.
(E) Far1 disrupts Cln2 binding to Sic1 and Whi5. Sic1∆C (residues 1-214) lacks
its CDK-inhibitor domain but includes its Cln1/2 docking site (Bhaduri and
Pryciak, 2011; Koivomagi et al., 2011b). Pheromone was omitted from these
assays because it affected GST-Whi5 levels. Also see Figure 4.4A.
(F) Far1 disrupts binding of GST-Cln2 to full-length Ste20. Strains harbored a
PGAL1-GST-CLN2 plasmid or GST vector, plus V5-tagged Ste20. To reduce
effects of pheromone on Cln2 levels, we used a truncated Cln2 (residues 1-
372), which lacks its destabilizing C-terminus (Lanker et al., 1996). Cells
were induced with galactose ± pheromone; bound complexes were captured
and analyzed by anti-V5, anti-GST, and anti-Cdc28 blots. Graphs quantify
relative levels of Ste20 binding (mean ± SEM; n = 3). Also see Figure 4.4B-E.
162
Figure 4.3. Far1 inhibition of docking correlates with G1 arrest ability.
A B E GST GST- GST- far1∆ vector Sic1∆C Whi5
FAR1: ∆ ∆ ∆ WT WT WT WT S87A S87A S87A S87A Ste5 FAR1 Ste11 Cln2-myc Ste7 bound Fus3 S87A Cln2-myc T306 S87 total P P Far1 Far1 Far1 T306A
GST S87A T306A
C GST-Ste20* F PGAL1-GST: vector GST-Cln2 S87A FAR1: WT S87A T306A T306A FAR1: ∆ ∆ WT S87A S87A α factor: -! +! -! +! -! +! -! +! T306A S87A T306A α factor: -!+!-!+!-!+!-!+!-!+!-!+! Cln2-myc bound bound Ste20
Cln2-myc total Ste20 total
D GST-Ste5* GST-Cln2 S87A FAR1: WT S87A T306A T306A bound Cdc28 α factor: -! +! -! +! -! +! -! +! 125 Cln2-myc 100 bound bound Ste20 75 (relative) 50 Cln2-myc 25 total 0
163
S87A mutant remained functional (Figure 4.3B); the S87A T306A double mutant showed an intermediate phenotype, indicating that T306 phosphorylation is not absolutely required if Far1 is stabilized by the S87A mutation. When we tested
Cln2-substrate binding in these strains, we observed several notable features
(Figures 4.3C, 4.3D). First, the T306A mutation blocked the ability of pheromone to disrupt Cln2-substrate interactions, whereas the S87A mutation increased this disruptive effect. Second, this increased potency of the Far1-S87A mutant was evident even in the absence of pheromone. Third, the S87A mutation partially suppressed the defect of the T306A mutation, consistent with the arrest phenotypes. (Note that the effect of pheromone in the S87A T306A double mutant cannot be due to Far1 activation by phosphorylation at T306, and instead it may reflect elevated FAR1 transcription (Chang and Herskowitz, 1990).) The ability of Far1-S87A to reduce Cln2-substrate binding even without pheromone was unanticipated, but it may imply that the unmodified wild-type protein is partially active (rather than inactive) and that this activity becomes more evident in the S87A mutant due to higher protein levels or presence in a greater fraction of cells (see below). Overall, the binding results mirror the G1 arrest phenotypes, implying that interference with Cln2-substrate docking relates to the arrest function of Far1. In further support of this view, we found that Far1 (especially
Far1-S87A) also disrupted binding of Cln2 to the G1/S regulators Sic1 and Whi5
(Figures 4.3E, 4.4A), which are CDK substrates with Cln1/2 docking sites similar to those in Ste5 and Ste20 (Bhaduri and Pryciak, 2011; Koivomagi et al., 2011b).
164
Figure 4.4. Effects of Far1 on Cln2-substrate binding interactions.
(A) Far1 inhibits binding of Cln2 to GST-Whi5 fragments. Strains (PPY2322,
PPY2326, PPY2329) harbored Cln2-myc (pPP3203) plus GST fusions to
Whi5 fragments (pPP4150, pPP4151, pPP4152) or GST alone (pPP2154).
Binding was assayed by glutathione-sepharose capture followed by anti-myc
and anti-GST blots. Note that Far1-S87A inhibits Cln2 binding to all Whi5
fragments, similar to results using full-length Whi5 (Figure 4.3E), and with all
GST-Whi5 fusions a truncated product is also observed (marked by **).
Phosphorylation of Whi5 by Cln2-CDK depends on docking (Koivomagi et al.,
2011b), and it has at least one docking motif in the 121-150 region (Bhaduri
and Pryciak, 2011), but it could also have additional motifs that confer weak
binding to the 1-125 fragment.
(B, C) Binding of GST-Cln2 to full-length substrate proteins requires docking
sites. Galactose-inducible GST or GST-Cln2 (residues 1-372) was co-
expressed in far1∆ cells (PPY2327) with V5-tagged forms of full-length
substrates (Ste20 or Ste5) expressed from their native promoters. Binding
was assayed by glutathione-sepharose capture followed by anti-V5 and anti-
GST blots. In each panel, the WT and mutant substrates were analyzed in
parallel but were separated by additional lanes in the original gels. Panel B
shows binding to full-length Ste20-WT or a docking site mutant (mut3;
(Bhaduri and Pryciak, 2011)). Plasmids were pPP2154, pPP3573, pPP3267,
and pPP3368. Panel C shows binding to full-length Ste5-WT or a docking
165
site mutant (LLPP to AAAA; (Bhaduri and Pryciak, 2011)). Plasmids were
pPP2154, pPP3573, pPP3266, and pPP3761.
(D, E) Far1 inhibits binding of GST-Cln2 to full-length Ste20 and Ste5. Strains
with the indicated FAR1 genotype (PPY2327, PPY2330, PPY2340, PPY2358,
PPY2359) harbored galactose-inducible GST (pPP2154) or GST-Cln2
(pPP3573), plus V5-tagged Ste20 (pPP3267) or Ste5 (pPP3266). Cells were
induced with galactose ± pheromone for 90 minutes, and then bound
complexes were captured and analyzed by anti-V5, anti-GST, and anti-Cdc28
blots. Graphs show the relative level of substrate binding (mean ± SEM) from
three (D) or four (E) experiments. Panel D is identical to Figure 4.3F and is
repeated here for comparison to the other panels.
167
We confirmed these findings via reciprocal assays in which a GST-Cln2 fusion was used to co-precipitate full-length substrates (Ste20 and Ste5). Binding of each substrate to GST-Cln2 required their docking sequences (Figures 4.4B,
4.4C) and was strongest in far1∆ cells, weakest in FAR1-S87A cells, and intermediate in FAR1-WT cells (Figure 4.3F, 4.4). This trend was seen even without pheromone treatment, further reinforcing the notion that unmodified Far1 is partially active. Importantly, Far1 did not affect binding of Cln2 to its partner
CDK molecule, Cdc28 (Figures 4.3F, 4.4E). The effect of pheromone was less evident in these experiments than when using the previous (reverse) procedure, perhaps because chronic Cln2 expression can induce Far1 degradation, counteracting its activation by pheromone. Overall, however, the results confirm the disruptive effect of Far1 and argue that it blocks interactions between intact
Cln2-CDK complexes and their substrates.
Because Far1 binds Cln-CDK complexes (Gartner et al., 1998; Peter et al., 1993; Tyers and Futcher, 1993), we asked if Far1 and substrates bind Cln2 competitively, and if Far1 outcompetes substrates via higher concentration or affinity. First, we compared their concentrations by marking Far1 and substrates with the same epitope tag (3xV5). Far1 levels ranged between those of Ste20 and Ste5, depending on whether it had been induced by pheromone or stabilized by the S87A mutation (Figure 4.5A). Next, we used cells that simultaneously expressed V5-tagged forms of Far1 and Ste20 to compare their binding to Cln2
168
(Figure 4.5B). The results suggest that Far1 binds Cln2 more favorably, as total
Far1-WT was much less abundant than Ste20 and yet it bound Cln2 at equal or greater levels. Similarly, Far1-S87A was comparably abundant to Ste20 yet showed disproportionally greater binding to Cln2. When comparing WT and
S87A forms of Far1, the increased Cln2 binding to the S87A mutant was accompanied by reduced binding to Ste20, implying that Far1 competes with
Ste20. Indeed, pheromone caused increased Cln2-Far1 binding and reduced
Cln2-Ste20 binding. Collectively, these results suggest that Far1 binds Cln2 in a way that is mutually exclusive with Cln2-substrate docking, and that the preferential binding of Far1 allows it to outcompete substrates.
We reasoned that Far1 should be in excess of Cln2 in order to effectively outcompete Cln2-substrate interactions. Therefore, we compared their levels as cells approached the critical point of cell cycle commitment, or “Start”. Using synchronous cultures in which both Far1 and Cln2 had the same epitope tag, we monitored protein levels and the ability of cells to arrest in G1 in response to pheromone (Figures 4.5C, 4.6). Far1 was generally in large excess over Cln2 as cells approached Start, and a sharp increase in Cln2 corresponded to the first appearance of committed cells. It did not seem that Cln2 must reach peak levels or exceed Far1 for cells to pass Start, but rather it only must begin to accumulate. This pattern fits previous findings that Start occurs simultaneous with CLN2 promoter firing (Doncic et al., 2011), and is reminiscent of the
169
Figure 4.5. Far1 outcompetes substrates for binding to Cln2.
(A) Far1, Ste5, and Ste20 were tagged with the identical 3xV5 tag to compare
protein levels. Far1 (WT or S87A) was expressed from its native genomic
locus; Ste5 and Ste20 were expressed from their native promoters on low
copy number plasmids. Whole cell extracts were prepared and equivalent
amounts of total protein were analyzed by SDS-PAGE and anti-V5 blots.
(B) Strains with V5-tagged Far1 or Far1-S87A harbored a V5-Ste20 plasmid plus
galactose-inducible GST-Cln2 or GST vector. Cells were induced with
galactose with or without pheromone, and then binding of Far1 to GST-Cln2
was assayed.
(C) Strains with V5-tagged Far1 and Cln2 were synchronized by arrest in mitosis
(using a cdc15-2 mutant). At various times after release, aliquots were taken
to assess protein levels and then treated with pheromone to assess whether
they could still arrest in G1 or had passed Start (committed). Signal levels in
the two blots are directly comparable, as all steps were performed in parallel
using equal protein loading. Graphs show mean ± SEM (n = 4-6). See
Figure 4.6 for additional tests.
171
Figure 4.6. Far1 vs. Cln2 levels in synchronous cultures.
Using strains in which Far1 and Cln2 are tagged with the identical 3xV5 tag, cells were synchronized by arrest in mitosis (using either cdc15-2 or PGAL1-CDC20), and then released. At various times after release, aliquots were taken to assess protein levels and then were treated with pheromone to assess whether they could still arrest in G1 or had passed Start (committed). In each column the blots are directly comparable, as the experiments were performed in parallel, the individual gels had the same amount of protein loaded per lane, and the blots were processed in parallel and exposed simultaneously to a single film. For the same reasons, the four cdc15-2 blots are also directly comparable to each other.
Results shown are representative of two or more independent experiments.
Graphs show mean ± SEM (n = 4-6; left) or mean ± range (n = 2; middle and right). Note that the degree of delay in commitment caused by the Far1-S87A mutant varied with experimental context; it also varied among independent isolates of BY4741 cdc15-2 strains, and so we combined results from two FAR1- wt strains (PPY2393, PPY2394) and four FAR1-S87A strains (PPY2395,
PPY2396, PPY2425, PPY2426). The data at left are identical to Figure 4.5C and are repeated here to facilitate comparison.
173
mammalian cell restriction point occurring at very low levels of cyclin E (Ekholm et al., 2001; Martinsson et al., 2005). Thus, it may be necessary for Far1 to substantially exceed cyclin levels to prevent Start, whereas cyclin levels may not need to exceed Far1 to pass Start, perhaps because the positive feedback loop governing Cln1/2 expression (Skotheim et al., 2008) makes them destined to overwhelm Far1 once their expression begins. In accord with recent work
(Doncic et al., 2011), the Far1-S87A mutant caused mild delays in commitment and Cln2 expression, though to varying degrees (Figures 4.5C, 4.6). Notably, the Far1-S87A protein was not strongly over-expressed compared to peak levels of Far1-WT, but it was present over a broader range of the cell cycle (Figures
4.5C, 4.6). Hence, the increased inhibitory activity of Far1-S87A seen in preceding experiments (using asynchronous cultures) may primarily reflect an increase in the fraction of cells expressing Far1 rather than in its concentration.
CDK phosphorylation of both Ste20 and Ste5 alters their electrophoretic mobility (Bhaduri and Pryciak, 2011; Oehlen and Cross, 1998; Strickfaden et al.,
2007; Wu et al., 1998). By using extended electrophoresis to better resolve
Ste20 forms, we found that pheromone and Far1 inhibited Cln2-driven phosphorylation (Figures 4.7A, 4.8A). Specifically, Cln2 expression in far1∆ cells converted Ste20 to its slowest mobility, phosphorylated form. Pheromone had no effect in far1∆ cells, but it reduced Ste20 phosphorylation in FAR1-WT cells. In
FAR1-S87A cells, Ste20 phosphorylation was reduced even without pheromone
174
Figure 4.7. Effects of Far1 and pheromone on CDK phosphorylation in vivo using substrates with native and artificial docking interactions.
(A) Extracts of cells harboring V5-Ste20 and galactose-inducible GST-Cln2, as in
Figure 4.3F, were analyzed by extended electrophoresis to resolve the extent
of Ste20 phosphorylation triggered by Cln2 expression. See Figure 4.8A for
replicates.
(B) CDK inhibition alone does not disrupt Cln2-Ste20 binding. Strains with a
drug-sensitive CDK (cdc28-as2) harbored V5-tagged Ste20 plus galactose-
inducible GST-Cln2 or GST vector. Cells were induced with galactose either
with or without the ATP analog 1-NM-PP1 (15 µM), and GST fusions were
captured. Total and bound Ste20 were analyzed by anti-V5 blots.
(C) The indicated FAR1 strains harbored a plasmid expressing GST-Cln2 with an
attached leucine half-zipper (lz), plus a plasmid expressing an HA-tagged
CDK substrate with either the matching half-zipper or an LP-type Cln1/2
docking site (see Figure 4.8Eii). Cultures were pre-incubated for 2 hr ± α
factor (0.1 µM), and then induced with galactose for 2 hr. Substrate
phosphorylation (Bhaduri and Pryciak, 2011) and GST-Cln2 expression was
monitored by anti-HA and anti-GST blots, respectively. Figure 4.8C shows
that leucine zipper binding is resistant to pheromone and Far1.
(D) FAR1-S87A and far1∆ strains co-expressing GST-(lz)-cyclins with an HA-
tagged substrate (Figure 4.8Eii) were induced with galactose for 2.5 hr.
Levels of GST-(lz)-cyclins were monitored in each experiment; one
175
representative anti-GST blot is shown. Note that, aside from effects of Far1,
these results confirm that cyclin docking drives substrate use, because
switching the docking site alters which cyclins are effective, as seen
previously (Bhaduri and Pryciak, 2011).
(E) GST-(lz)-cyclin plasmids were introduced into a strain with V5-tagged Far1-
S87A. Cultures were induced with galactose for 1.5 hr and then association
of Far1 with the GST-tagged cyclin was assayed.
(F) Strains co-expressed GST-(lz)-Cln2 with HA-tagged substrates that each
show only two mobility forms (see Figure 4.8Eiii), which makes it easier to
quantify phosphorylation. Cultures were pre-incubated with α factor (0.1 µM,
30 min.), and then induced with galactose (40 min). Graphs (mean ± SEM, n
= 3-4) show the signal in the upper band as a percentage of the total signal
(% phos.).
177
treatment, and pheromone caused a further reduction. The T306A mutant was ineffectual, while the S87A T306A double mutant showed a result intermediate between the two single mutants. Collectively, these results suggest parallel effects of Far1 on substrate docking and substrate phosphorylation by Cln2-CDK.
Chemical inhibition of CDK activity was not sufficient to reduce Cln2-Ste20 binding, and Far1-S87A was equally disruptive with and without CDK inhibition
(Figure 4.7B), suggesting that reduced binding causes reduced phosphorylation rather than vice-versa. Notably, to our knowledge these results provide the first demonstration that pheromone and Far1 reduce phosphorylation of CDK substrates in vivo (see Discussion). In contrast, we saw no reduction in phosphorylation of the Cln1/2 C-termini (Figure 4.8B) or Far1 itself (Figure 4.5B, top), indicating that Far1 does not inhibit all Cln-CDK phosphorylation events equally.
Finally, we asked if the ability of Far1 to disrupt substrate phosphorylation is due to inhibition of Cln2-substrate docking, or Cln2-CDK kinase activity, or a combination of both. To address this point, we compared CDK substrates with and without Cln2 docking motifs. Using an approach elaborated in Chapter 3, we replaced a native docking interaction with a foreign leucine zipper (Figure 4.8Eii), thereby allowing phosphorylation of a single substrate to be driven by either a native cyclin docking site or an artificial linkage. Then, we analyzed phosphorylation driven by different cyclins, and the effects of Far1. When the
178
substrate harbored a native “LP”-type Cln2 docking site, its phosphorylation was inhibited strongly by Far1-S87A, but when the leucine zipper was used, the degree of inhibition was substantially reduced, though not eliminated (Figures
4.7C, 4.7D). These results imply that Far1 inhibits substrate docking strongly, with a residual effect on some non-docking function such as CDK kinase activity.
This residual effect might also signify a reduction in kinase processivity mediated by the Cks1 subunit of the CDK complex (Koivomagi et al., 2013; McGrath et al.,
2013), though it was still evident when the role of Cks1 was presumably blocked
(by changing threonine phosphorylation sites to serine; Figure 4.8D). It is also notable that this residual effect was only seen with the G1/S cyclins Cln1 and
Cln2 (Figure 4.7D), even though Far1-S87A could bind all cyclins (Figure 4.7E).
Interestingly, however, when the substrate contained an “RxL” docking motif favored by S-phase cyclins such as Clb5 (Bhaduri and Pryciak, 2011; Loog and
Morgan, 2005; Wilmes et al., 2004), Far1- S87A could mildly inhibit Clb5-driven phosphorylation (Figure 4.7D), again suggesting that docking-dependent phosphorylation is more susceptible to inhibition by Far1. To help quantify the extent of phosphorylation, we performed related experiments using a variant substrate with only two electrophoretic mobility forms: unphosphorylated and phosphorylated (Figure 4.7F). Here, pheromone treatment of Far1-S87A cells almost completely reversed phosphorylation driven by the native Cln2 docking site (Figure 4.7F, top), but had only a mild effect when the leucine zipper was used (Figure 4.7F, bottom). Collectively, these results suggest that Far1 can
179
reduce CDK phosphorylation of substrates irrespective of docking, but substrates that require docking are especially sensitive to Far1. Therefore, Far1 may engage cyclin-CDK complexes in a way that simultaneously disrupts both substrate recognition and kinase activity.
180
Figure 4.8. Pheromone/Far1 effects on CDK phosphorylation in vivo.
(A) Far1 and pheromone inhibit Ste20 phosphorylation by Cln2-CDK. Three
repetitions of the experiment in Figure 4.7A are shown to demonstrate
reproducibility of the patterns observed.
(B) Far1 and pheromone do not affect phosphorylation of Cln1/2 tails. Cultures
of far1∆ or FAR1-S87A strains (PPY2327, PPY2330) harboring PGAL1-GST-
cyclin plasmids (pPP3572 or pPP3749) were induced with galactose ± α
factor. Extracts were analyzed by anti-GST blot. Bands indicate the extent of
phosphorylation at CDK sites in the cyclin C-termini.
(C) Far1 and pheromone do not inhibit leucine zipper-mediated binding. Strains
(as in B) expressed GST-(lz)-Cln2 or GST alone, plus a myc-tagged CDK
substrate consisting of a Ste20Ste5PM chimera with either an LP-type docking
site or a leucine half-zipper (panel Ev). Plasmids: pPP2154, pPP3916;
pPP3218, pPP3979. Binding was assayed after induction with galactose ± α
factor.
(D) The ability of Far1-S87A to partially reduce phosphorylation driven by a
leucine zipper was compared for two substrates (see panel Eiv): one with WT
phosphorylation sites (5 SP and 3 TP) and one (“all SP”) in which the 3 TP
sites were converted to SP, to block Cks1 from recognizing phospho-Thr as
priming sites (Koivomagi et al., 2013; McGrath et al., 2013). Strains:
PPY2327, PPY2330. Plasmids: pPP2154, pPP3916; pPP3877, pPP4071.
181
(E) Substrates used in Figures 4.7 and 4.8. (i) CDK phosphorylation sites and the
“LP”-type Cln1/2 docking site in Ste5 (Bhaduri and Pryciak, 2011), from which
other substrates are derived. (ii) Top, substrates used in Figures 4.7C-D.
The native LP docking site in Ste5 is replaced with motifs shown. The
recipient fragment, Ste5 1-260, excludes binding and phosphorylation sites
for the MAPK Fus3 (in Ste5 267-330) (Bhattacharyya et al., 2006), preventing
pheromone-induced phosphorylation from obscuring changes in CDK-
mediated phosphorylation. Bottom, cartoons of cyclin docking. (iii)
Substrates used in Figure 4.7F. Deleting the PM/NLS domain (Winters et al.,
2005) causes the substrate to show only two mobility forms, which simplifies
quantification. The top substrate has an “ND” mutation (Bhattacharyya et al.,
2006) to prevent MAPK binding. (iv) Substrates used in Figure 4.8D. In “all
SP”, the 3 TP (Thr-Pro) sites in the WT Ste5 sequence are changed to SP
(Ser-Pro). (v) Top, Ste20, which is analyzed in Figures 4.7A and 4.8A.
Bottom, binding partners used in Figure 4.8C. A Ste20Ste5PM chimera (Bhaduri
and Pryciak, 2011) acted as recipient for an LP dock or a leucine zipper, to
compare effects of Far1 on binding by each motif. (These chimeras were
used because the phosphorylation substrates analyzed in Figures 4.7C-D
show variable behavior in binding assays.)
183
Discussion
This study addresses long-standing uncertainties about how yeast pheromone signaling and the presumed CKI protein Far1 promote cell cycle arrest. Our findings reveal an unsuspected mode of CDK regulation, in which an extracellular signal stimulates an inhibitory factor, Far1, to disrupt interactions of specific cyclin-CDK complexes with substrates. Far1 appears to disrupt Cln2-substrate docking by binding Cln2 more favorably so that it outcompetes substrates, and mutant analyses suggest that this effect parallels its ability to mediate G1 arrest.
Because Cln1/2 docking enhances substrate phosphorylation (Bhaduri and
Pryciak, 2011; Koivomagi et al., 2011b), inhibition of docking by Far1 should contribute to reduced substrate phosphorylation in vivo, in addition to any effects of Far1 on CDK activity per se. Indeed, our findings suggest that Far1 is a multi- mode inhibitor that separately disrupts both CDK activity and substrate docking.
This combined effect raises the possibility that Far1 has the strongest inhibitory effect on substrates that are most dependent on docking, which might include proteins with inherently poor (e.g., non-consensus) phosphorylation sites or those that must be phosphorylated at multiple positions. Similar themes could also apply to other kinases.
We find that the ability of Cln1/2-CDK to phosphorylate substrates in vivo can be inhibited by pheromone and Far1. Remarkably, to our knowledge this is
184
the first such demonstration. Although there are numerous prior examples in which CDK substrates are unphosphorylated in pheromone-arrested cells, this can be explained by the fact that cyclins are not expressed in G1 phase, and hence it does not necessarily indicate that the kinase activity of cyclin-CDK complexes is reduced. Here, by expressing cyclins independent of cell cycle position, we could detect regulation of phosphorylation by a set amount of
Cln1/2-CDK in vivo. Also, by linking different cyclins to substrates using a common leucine zipper, we could compare their sensitivity to Far1. Of note, compared to Cln1/2-CDK, Cln3-CDK seemed less susceptible to Far1 inhibition, which could underlie different roles for these cyclins in driving cell cycle re-entry after pheromone arrest (Doncic and Skotheim, 2013).
Surprisingly, Far1 could partially interfere with Cln2-substrate binding and phosphorylation even without pheromone treatment. Prior findings implied that
Far1 must be activated, because G1 arrest required pheromone-induced phosphorylation of Far1 at T306 (Gartner et al., 1998) and FAR1 over-expression was not sufficient (Chang and Herskowitz, 1992). We suggest a new interpretation in which unphosphorylated Far1 is partially active but is less potent than when phosphorylated at T306. This view is supported by our binding and phosphorylation data as well as by the partial arrest observed in FAR1-S87A
T306A cells, which shows that T306 phosphorylation is not absolutely essential.
It is also relevant to findings that far1∆ cells show accelerated entry into the cell
185
cycle (Alberghina et al., 2004) and that FAR1-S87A cells show a delay in Start
(Doncic et al., 2011). Because Far1 is expressed only during a narrow pre-Start window of the cell cycle (McKinney et al., 1993), the partially active state would normally be restricted to cells poised for G1 arrest, but detection of this state was enhanced when using the stabilized S87A mutant, which is expressed in a larger fraction of cells. This mutant also revealed that inhibitory effects of Far1 are at least partly independent of T306 phosphorylation. Yet, T306 phosphorylation makes Far1 a more potent inhibitor, likely via enhanced binding to CDK complexes (Gartner et al., 1998) and possibly via engaging the phospho- threonine binding pocket in Cks1 (Koivomagi et al., 2013; McGrath et al., 2013).
The specific mechanism by which Far1 disrupts Cln2 docking is not yet known. Currently, there are no structural data on the Cln2-substrate binding interface, but the short docking motifs (Bhaduri and Pryciak, 2011; Koivomagi et al., 2011b) likely bind a peptide-recognition pocket on the cyclin, as with RxL motif recognition by S-phase cyclins (Lowe et al., 2002). Thus, Far1 could displace substrates either by having a higher affinity docking peptide or by interacting with a broader region of Cln2 in a way that obscures peptide recognition. The latter view may be favored by the fact that two separate parts of
Far1 are required to bind Cln2 (Peter et al., 1993). This view is also reminiscent of mammalian CKI proteins p21 and p27, whose RxL sequences contribute to cyclin binding and CDK inhibition (Adams et al., 1996; Chen et al., 1996;
186
Wohlschlegel et al., 2001), but as only a small part of a much larger binding interface involving both the cyclin and CDK subunits (Russo et al., 1996). In fact, such multipartite interactions may have contributed to confusion about inhibitory mechanisms for both Far1 and p21/p27. Namely, complexes of p21 with cyclin-
CDK sometimes retained kinase activity (Harper et al., 1995; Zhang et al., 1994), leading to speculation that under such conditions the CKI might contact only the cyclin and not the CDK (Morgan, 1996), a notion later supported by p21 mutants that bind only the cyclin (Chen et al., 1996). Analogous heterogeneity of Far1-
Cln-Cdc28 complexes might explain why kinase inhibition was observed in some studies (Peter and Herskowitz, 1994) but not others (Gartner et al., 1998). In addition, the use of generic substrates that do not require docking (e.g., histone
H1) would have bypassed the ability of Far1 to regulate this step in either study.
We suggest that Far1 engages the cyclin-CDK complex in a way that disrupts multiple distinct functions, including both substrate docking and kinase activity but perhaps also others such as Cks1-mediated processivity (Koivomagi et al., 2013; McGrath et al., 2013). Multiple concerted effects may help ensure maximal inhibition. Thus, in future studies using in vitro assays, it will be important to compare substrates with a range of requirements, in order to dissect the effect of Far1 on total kinase activity, utilization of docking sites, kinase processivity, and multi-site phosphorylation. Investigation of these issues will further illuminate how differential regulation of distinct mechanistic steps in
187
substrate phosphorylation can provide additional layers of control that fine-tune protein kinase networks.
Acknowledgements
We thank Gustav Ammerer, Alejandro Colman-Lerner and Jan Skotheim for plasmids, Matt Winters for technical assistance, and Dan McCollum for helpful discussions.
188
Materials and Methods
Yeast Strains and Plasmids
Standard procedures were used for growth and genetic manipulation of yeast
(Rothstein, 1991; Sherman, 2002). Yeast cultures were grown at 30˚C except as indicated otherwise. Strains and plasmids are listed in tables below. A two-step
(pop-in/pop-out) allele replacement method (Rothstein, 1991) was used to introduce the following mutant alleles at their native genomic loci: STE5-8A,
FAR1-S87A, FAR1-T306A, FAR1-S87A T306A, cdc15-2, and cdc28-as2. For
Cdc28 inhibition we used the Cdc28-as2 [F88A] mutant (Colman-Lerner et al.,
2005) because in our strains the more severe mutant Cdc28-as1 [F88G] (Bishop et al., 2000) caused slow growth and cell shape defects. PCR-mediated gene deletion and tagging used methods described previously (Longtine et al., 1998).
To add epitope tags at endogenous FAR1 and CLN2 loci, a PCR-generated cassette containing the 3xV5 tag and an antibiotic resistance gene (kanMX6 or natMX6) was integrated downstream of the coding sequence. To construct
PGAL1-CDC20 strains, the promoter of the essential cell cycle gene CDC20 was replaced with a regulated promoter (PGAL1) using a PCR-generated cassette marked with the K. lactis URA3 gene (URA3Kl). To promote cyclin interaction with substrates that lack native docking sites, we used a weak leucine zipper (Kd
~ 800 nM) (Acharya et al., 2002; Bashor et al., 2008), wherein two hetero- dimerizing sequences called R34 and E34(N) (Bashor et al., 2008) were fused to
189
the cyclin and substrate, respectively; further details will be described elsewhere
(S.B. and P.M.P., in preparation).
GST Co-precipitation Binding Assays
Cultures (25 mL) were grown in synthetic media with 2% raffinose. Expression of
GST fusion proteins from PGAL1-GST plasmids was induced with 2% galactose, with or without 10 nM α factor, for 1.5 to 3 hours. For experiments using the cdc28-as2 allele, cultures were also treated with 15 µM 1-NM-PP1. Cells were harvested and stored at -80˚C, then lysed by glass bead beating using a Fast-
Prep apparatus (20 sec. at 4 m/s) and a non-ionic detergent buffer described previously (Lamson et al., 2002). Aliquots were removed to provide input controls, and then GST fusions and co-bound proteins were collected using glutathione-sepharose beads (GE Healthcare #17-0756-01).
For experiments in which we wished to examine the effects of pheromone signaling on Cln2 binding interactions, one complexity arises from the fact that the mating pathway and Cln1/2-CDK activity are mutually antagonistic. That is, pheromone-arrested cells do not express the CLN1/CLN2 genes and hence lack
Cln1/Cln2 proteins (Wittenberg et al., 1990), whereas Cln1/2-expressing cells inhibit pheromone signaling and degrade Far1 (Henchoz et al., 1997; McKinney et al., 1993; Oehlen and Cross, 1994). Therefore, to allow us to vary experimental conditions without affecting protein levels and signaling responses, we circumvented these antagonistic effects as follows: (i) CLN2 was expressed
190
from a constitutively-active promoter (PCYC1 or PTEF1); (ii) the ability of Cln2 to inhibit pheromone signaling (see Figure 4.2) was prevented by using strains with the STE5-8A allele (Strickfaden et al., 2007), which encodes a CDK-resistant form of the pathway scaffold protein, Ste5; and (iii) our initial experiments used strains with the FAR1-S87A allele (Gartner et al., 1998), which is resistant to
CDK-triggered degradation. Subsequent experiments probed the role of Far1 by using strains with far1∆ and other FAR1 alleles.
Synchronous Culture Experiments
For experiments in PGAL1-CDC20 strains, cells were grown in liquid YPGal medium (containing 2% galactose) and then arrested in M phase by pelleting, resuspending in YPD medium (2% glucose), and incubating for 3 hr. Cultures were released by two rounds of pelleting and washing in YPGal, followed by final resuspension in YPGal. At 10-minute intervals, aliquots were removed to prepare protein samples and test cell cycle commitment. At each time point, 2 mL was pelleted and immediately frozen in liquid nitrogen (and whole cell extracts were prepared later); a separate 3 mL aliquot was treated with α factor
(0.2 µM) and incubated at 30˚C, and then at 120 minutes after release all treated aliquots were fixed by adding formaldehyde to 3.7%. Cell cycle commitment was scored as the percentage of cells (n = 200) that failed to arrest in G1 (i.e., as unbudded cells) after the pheromone treatment.
191
For experiments in cdc15-2 strains, cultures were grown at 25°C, arrested at 37°C for 3 hr, then released by transfer to 25°C (using shaking water baths).
Aliquots were taken at 10-min intervals to prepare protein samples and test cell cycle commitment as described above, except that 10 µM α factor was used for the BAR1 strains in the W303 background.
Whole Cell Extracts
Whole cell extracts were prepared by a modified version of a previous protocol
(Lee and Dohlman, 2008). Here, 300 µL of trichloroacetic acid (TCA) buffer (10 mM Tris-HCl, pH 8.0, 10% TCA, 25 mM ammonium acetate, 1 mM Na2EDTA) was added directly to frozen cell pellets (usually from 2 mL culture), and incubated on ice for 10 minutes. Samples were pelleted in a microcentrifuge for
10 min at 4˚C. The pellet was resuspended in 75 µL Resuspension Buffer (0.1 M
Tris.HCl, pH 11.0, 3% SDS), boiled for 5 min, allowed to cool at room temperature for 5 minutes, then re-centrifuged for 30 sec. The supernatant (60
µL) was transferred to a new tube, 10 µL was reserved to assay protein concentration by a Pierce BCA Protein Assay Kit (#23225), and then 50 µL of 2x
SDS Sample Buffer was added to the remainder. Equivalent amounts of total protein (generally 20 µg) were loaded in each lane.
192
Immunoblotting
Protein samples were analyzed by SDS-PAGE, and transferred to PVDF using a submerged tank device. Myc-tagged proteins were detected with rabbit anti-myc
(1:200 Santa Cruz Biotechnologies #sc-789) and HRP-conjugated goat anti- rabbit (1:3000, Jackson ImmunoResearch #111-035-144) antibodies. V5-tagged,
HA-tagged, or GST-tagged proteins were detected with mouse anti-V5 (1:5000,
Invitrogen #46-0705), anti-HA (1:1000, Covance #MMS101R), or anti-GST
(1:1000, Santa Cruz Biotechnologies #sc-138) antibodies, followed by HRP- conjugated goat anti-mouse (1:3000, BioRad #170-6516) antibodies. Cdc28 was detected with goat anti-Cdc28 (1:200 Santa Cruz Biotechnologies #sc-6709) and
HRP-conjugated donkey anti-goat (1:3000 Santa Cruz Biotechnologies #sc-
2020) antibodies. Enhanced chemiluminescent detection used a Pierce
SuperSignal West Pico kit (#34080).
Cyclin-CDK Phosphorylation Assays
Following methods established in a previous study (Bhaduri and Pryciak, 2011), cells harboring PGAL1-GST-cyclin constructs and HA-tagged CDK substrates were grown in selective media with 2% raffinose and then induced with 2% galactose
(for 40 min. to 2.5 hr) to drive cyclin expression. Where indicated, cultures were pre-treated with pheromone prior to galactose addition. Then, whole cell extracts were prepared, and substrate phosphorylation was assessed by SDS-PAGE and immunoblotting. CDK substrates are diagrammed in Figure 4.8E. Note that
193
most substrate fragments contain an NLS, and similar fragments localize to both nucleus and cytoplasm (Strickfaden et al., 2007; Winters et al., 2005), so in principle they should be accessible to both nuclear and cytoplasmic kinases.
Also note that, in order to help express different cyclins at comparable levels, all cyclins in the PGAL1-GST-cyclin constructs were truncated to remove destabilizing motifs (see the Plasmids Table for precise boundaries). These truncations remove NLS motifs in some cyclins such as Cln3 (Miller and Cross, 2001b) and
Clb2 (Hahn et al., 2008; Hood et al., 2001), but the pattern of substrate specificity seen with these truncated cyclins is the same as that seen earlier with full-length cyclins (Bhaduri and Pryciak, 2011).
194
Table 4.1. Yeast strains used in Chapter IV
Yeast strains used in this study. Name Strain Relevant Genotype Background* PPY640 (a) MATa FUS1::FUS1-lacZ::LEU2 PPY892 (a) MATa FUS1::FUS1-lacZ::LEU2 far1::ADE2 PPY2075 (a) MATa FUS1::FUS1-lacZ::LEU2 STE5-8A PPY2076 (a) MATa FUS1::FUS1-lacZ::LEU2 STE5-8A far1::ADE2 PPY2268 (b) MATa far1∆::kanMX6 PPY2296 (b) MATa STE5-8A FAR1-S87A PPY2322 (b) MATa bar1∆::hphMX6 PPY2326 (b) MATa bar1∆::hphMX6 far1∆::kanMX6 PPY2327 (b) MATa bar1∆::hphMX6 STE5-8A far1∆::kanMX6 PPY2329 (b) MATa bar1∆::hphMX6 FAR1-S87A PPY2330 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-S87A PPY2340 (b) MATa bar1∆::hphMX6 STE5-8A PPY2354 (b) MATa bar1∆::hphMX6 FAR1-T306A PPY2356 (b) MATa bar1∆::hphMX6 FAR1-S87A,T306A PPY2358 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-T306A PPY2359 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-S87A,T306A PPY2369 (b) MATa bar1∆::hphMX6 STE5-8A far1∆::kanMX6 cdc28-as2 PPY2371 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-S87A cdc28-as2 PPY2377 (b) MATa bar1∆::hphMX6 STE5-8A FAR1-3xV5::kanMX6 PPY2380 (b) MATa bar1∆::hphMX6 STE5-8A FAR1(S87A)-3xV5::kanMX6 PPY2384 (a) MATa ade1 CLN2-3xV5::kanR FAR1-3xV5::natMX6 cdc15-2 Kl PPY2391 (b) MATa bar1∆::hphMX6 CLN2-3xV5::kanMX6 FAR1-3xV5::natMX6 PGAL1-CDC20::URA3 PPY2392 (b) MATa bar1∆::hphMX6 CLN2-3xV5::kanMX6 FAR1(S87A)-3xV5::natMX6 PGAL1- CDC20::URA3Kl PPY2393 (b) MATa bar1∆::hphMX6 CLN2-3xV5::kanMX6 FAR1-3xV5::natMX6 cdc15-2 PPY2395 (b) MATa bar1∆::hphMX6 CLN2-3xV5::kanMX6 FAR1(S87A)-3xV5::natMX6 cdc15-2 PPY2397 (a) MATa ade1 CLN2-3xV5::kanMX6 FAR1(S87A)-3xV5::natMX6 cdc15-2
* Background: (a) W303 (ade2-1 his3-11,15 leu2-3,112 trp1-1 ura3-1 can1); (b) BY4741 (his3∆1 leu2∆0 ura3∆0 met15∆0).
195
Table 4.2. Plasmids used in Chapter IV
Plasmids used in this study. Name Alias Description Source * pPP681 pRS316 CEN URA3 vector 1 pPP1843 pUG-GST-GFP 2µm URA3 PGAL1-GST-GFP vector 2 pPP2154 pHG-GST CEN HIS3 PGAL1-GST vector 3 pPP2155 pHG-GST-GFP CEN HIS3 PGAL1-GST-GFP vector this study pPP2163 pHGT-S20A CEN HIS3 PGAL1-GST-ste20(1-333) 4 pPP2330 p306-S5-8A integrating URA3 STE5-8A 5 Kl pPP3025 pFA6a-KlacURA3-PGAL1 PCR template for URA3 -PGAL1 promoter insertion this study pPP3079 pADH1-CLN2-myc CEN URA3 PADH1-CLN2-myc13 TCYC1 this study pPP3152 pH-TEFpr-CLN2-myc CEN HIS3 PTEF1-CLN2-myc13 TCYC1 3 pPP3203 pCYC1-CLN2-myc CEN URA3 PCYC1-CLN2-myc13 TCYC1 3 pPP3218 pM20-BXA5N-U CEN URA3 myc13-[(Ste20 80-109)-(Ste5 1-85)-(Ste20 312-939)] 3 pPP3266 pS5kV5 CEN URA3 STE5-3xV5 TCYC1 this study pPP3267 pRL116V5 CEN URA3 3xV5-STE20 3 pPP3368 pRL116V5-Ala5 CEN URA3 3xV5-STE20(mut3 = docking site mutant) 3 pPP3369 pRL116V5-Ala13 CEN URA3 3xV5-STE20(Ala13 = CDK site mutant) 3 pPP3508 pH5n-1-337∆NLS-ND CEN URA3 PSTE5-(Ste5 1-337[∆NLS, ND])-3xHA TCYC1 this study pPP3571 pH5n-1-260-fRXL CEN URA3 PSTE5-(Ste5 1-260)-(Fin1 190-208)-3xHA TCYC1 3 pPP3572 pt-HGT-CLN2-F CEN HIS3 PGAL1-GST-CLN2(full length) TCYC1 3 pPP3573 pt-HGT-CLN2-t CEN HIS3 PGAL1-GST-CLN2(1-372) TCYC1 this study pPP3630 pACL437 integrating URA3 cdc28-as2 6 pPP3640 pJS21 integrating URA3 FAR1-S87A 7 pPP3749 pt-HGT-CLN1 CEN HIS3 PGAL1-GST-CLN1(full length) TCYC1 3 pPP3766 pUG-GST-F20L-wt 2µm URA3 PGAL1-GST-GFP-[ste20(72-118) + ste20(120-333)] this study pPP3761 pS5kV5-Nhe-P4 CEN URA3 ste5(LLPP-AAAA)-3xV5 TCYC1 3 pPP3771 pUG-GST-F20M-5CSM-wt 2µm URA3 PGAL1-GST-GFP-[ste5(263-335) + ste20(120-333)] 3 pPP3807 pH5n-1-260-dExo84 CEN URA3 PSTE5-(Ste5 1-260)-(Exo84 281-311)-3xHA TCYC1 3 pPP3825 pHG-GST-S20M-5CSM-WT CEN HIS3 PGAL1-GST-[ste5(263-335) + ste20(120-333)] this study pPP3877 pS5kHA-1-260-E34(N) CEN URA3 PSTE5-(Ste5 1-260)-(E34[N] zipper)-3xHA TCYC1 this study pPP3916 pt-HGT-CLN2-t-R34up CEN HIS3 PGAL1-GST-(R34 zipper)-CLN2(1-372) TCYC1 this study pPP3929 pt-HGT-CLN1-t-R34up CEN HIS3 PGAL1-GST-(R34 zipper)-CLN1(1-388) TCYC1 this study pPP3955 pt-HGT-Rup-CLB5-t CEN HIS3 PGAL1-GST-(R34 zipper)-CLB5(133-435) TCYC1 this study pPP3956 pt-HGT-Rup-CLB2-t CEN HIS3 PGAL1-GST-(R34 zipper)-CLB2(198-491) TCYC1 this study pPP3962 pS5kHA-1-260∆NLS-E34N CEN URA3 PSTE5-(Ste5 1-260[∆NLS])-(E34[N] zipper)-3xHA TCYC1 this study pPP3964 pt-HGT-CLN3-t-R34up CEN HIS3 PGAL1-GST-(R34 zipper)-CLN3(1-395) TCYC1 this study pPP3979 pM20-BXA5N-E34N CEN URA3 myc13-[(E34[N] zipper)-(Ste5 1-85)-(Ste20 312-939)] this study pPP4032 pIU-FAR1-T306A integrating URA3 FAR1-T306A this study pPP4033 pIU-FAR1-S87A,T306A integrating URA3 FAR1-S87A,T306A this study pPP3265 pFA6a-3xV5-kanMX6 3xV5::kanMX6 C-terminal tagging cassette 8 pPP4011 p2275 integrating URA3 cdc15-2 (= G206D) 9 pPP4034 pFA6a-3xV5-natMX6 3xV5::natMX6 C-terminal tagging cassette this study pPP4071 pS5kHA-1-260-E34N-3sp pPP3877 w/ Ste5 T4S,T29S,T102S this study pPP4146 pHGT-SIC1-1-214 CEN HIS3 PGAL1-GST-Sic1 (1-214) this study pPP4147 pHGT-WHI5-FL CEN HIS3 PGAL1-GST-Whi5 (full length) this study pPP4150 pHGT-WHI5 1-125 CEN HIS3 PGAL1-GST-Whi5 (1-125) this study pPP4151 pHGT-WHI5 1-150 CEN HIS3 PGAL1-GST-Whi5 (1-150) this study pPP4152 pHGT-WHI5 1-172 CEN HIS3 PGAL1-GST-Whi5 (1-172) this study
* Source: (1) (S korski and Hieter, 1989); (2) (Winters et al., 2005); (3) (Bhaduri and Pryciak, 2011); (4) (Takahashi and Pryciak, 2007); (5) (Strickfaden et al., 2007); (6) (Colman-Lerner et al., 2005); (7) (Doncic et al., 2011); (8) (Lu et al., 2012); (9) Alejandro Colman-Lerner lab.
196
CHAPTER V
Conservation of LP recognition in fungal G1 cyclins
and unusual hyper-potency in some cyclins
The study has been devised and results have been interpreted by myself and Dr.
Pryciak. All experiments have been performed by myself.
197
Introduction:
In Chapters 2 and 3 of this dissertation, we investigated the molecular mechanisms behind the highly specific interactions between yeast G1/S cyclins and their substrates. We found that small hydrophobic motifs in substrates can interact with a distinct region on S. cerevisiae Cln2 and some G1 cyclins from other yeasts. Many fungi that separated from S. cerevisiae before the Whole-
Genome-Duplication (WGD) have only one G1/S cyclin often known as Cln12 and one G1 cyclin, Cln3. In many fungi the distinction between G1 and G1/S cyclins are not very clear and they are referred to as G1 cyclins in general. Some yeasts like Candida albicans carry additional G1 cyclins (Figure 5.1 A). Many of these fungal G1 cyclins are important for polarized morphogenesis, which, in some pathogenic species, is linked to virulence. In Ashbya gossypii, deletion of
G1 cyclin Cln12 leads to severe morphological defects (Hungerbuehler et al.,
2007) with swollen hyphae displaying aberrant branching patterns. The AgCln12 localizes to the hyphal tips (Gladfelter et al., 2006), which is consistent with their potential role in polarity control. In contrast, deletion of AgCln3 does not cause any morphological defect. In the pathogenic yeast Candida albicans, not one but three G1 cyclins have been shown to be important for filamentous hyphal growth, which contribute to its virulence. Apart from the usual G1 cyclin CaCln3 there are two other G1 cyclins, namely Hgc1, which is homologous to S. cerevisiae Cln1 and Cln2, and another cyclin named Ccn1. Deletion of all of these has been
198
associated with defective hyphal morphogenesis and reduced virulence (Bishop et al., 2010; Chapa y Lazo et al., 2005; Loeb et al., 1999; Zheng and Wang,
2004; Zheng et al., 2007).
Further separated from budding yeast, the fission yeasts Schizosaccharomyces pombe and Schizosaccharomyces japonicus each have one G1 cyclin known as
Puc1 which is a close relative of budding yeast Clns. Deletion of S. pombe Puc1 increases the length of G1 and causes cells to undergo S phase at greater cell size than wt cells (quite akin to how cln2-m4 pushes cells to larger cell size at the time of Start). This delay is completely abolished, however, when the Sic1 equivalent CKI in fission yeast, Rum1, is deleted (Martin-Castellanos et al.,
2000). Filamentous growth is also common in bread molds like Neurospora crassa although very little is known about the involvement of its only G1 cyclin
NcCln1 in its polarized hyphal morphogenesis.
All of these above fungi belong to the phylum of Ascomycota (Figure 5.2 A), which forms the largest phylum of fungi with over 64000 species. The fungal phyla Basidiomycota, which had separated from the Ascomycota about 400 million years ago, contains sexually and asexually reproducing filamentous fungi including mushrooms like Coprinopsis cinerea, economically important smut
Ustilago maydis (pathogenic to maize) and pathogenic yeasts like Cryptococcus neoformans. Several of these organisms simply contain one G1 cyclin. In U.
199
maydis, the sole G1 cyclin UmCln1 has been shown to play an important role in hyphal morphogenesis and mating, which is important for the shift from asexual to sexual reproduction under nutritional stress (the first step in infection) (Castillo-
Lluva and Perez-Martin, 2005). In the pathogenic fungus Cryptococcus neoformans, which reproduces asexually by budding, deletion of the only G1 cyclin CnCln1 results in significant increase in cell size at the time of the initiation of DNA replication and budding (quite similar to cln2-m4 case in Chapter 3), thus suggesting a key role of G1 cyclins in the cell cycle of this organism (Virtudazo et al., 2010).
Based on all of the above observations, it is clear that in many different fungi separated over large evolutionary distances, G1 cyclin-CDK complexes generally play similar roles of controlling polarized morphogenesis of buds or filaments and commitment to cell cycle entry. Our results in the budding yeast model system suggest a role of LP-type docking motifs in Cln2-CDK’s ability to drive polarized growth during budding (Chapter 3). This prompted us to investigate whether the
G1 cyclins from different close and distant relatives of S. cerevisiae use similar molecular mechanisms to identify their substrates. More specifically, we were interested in knowing whether G1 cyclins from various fungi can use the “LP” type of substrate docking motifs we earlier characterized in Chapter 2. Our initial observations (Chapter 3) indicated that indeed a number of these G1 cyclins from a variety of yeasts are able to use the LP docking motif for substrate
200
phosphorylation and in fact “m4”-like mutations in those cyclins abrogated this recognition ability but not cyclin function. In this Chapter, we present evidence that not only different ascomycetes yeast, but also different basidiomycetes fungi have G1 cyclins that recognize the LP docking motif. However, there may be additional sequence features necessary for some other G1 cyclins. One remarkable observation that emerged out of these experiments was the hyper- potency of some cyclins belonging to different organisms. They may provide clues to the mechanisms of atypical cell cycle regulation in some yeast like the fission yeast S. pombe (Fisher and Nurse, 1996).
201
Results and Discussions
Conservation of “LP” recognition in foreign G1 cyclins:
In order to investigate whether “LP” recognition is conserved in G1 cyclins across fungal evolution, we expressed several foreign cyclins from yeasts belonging to the Saccharomyces clade and the Candida clade in budding yeast as leucine- zipper fusion proteins (Chapter 3) and tested their ability to phosphorylate substrates containing either “LP” type or leucine-zipper docking sites. Apart from having Cln1/2- and Cln3- like G1 cyclins, some of these yeasts like Candida albicans have other G1 specific cyclins known as Ccn1 and Hgc1 (Figure 5.1 A).
We tested Ccn1 cyclins from three different yeasts along with one Hgc1 candidate. All of these cyclins were expressed without the region that controls their stability so as to minimize differences arising from differential control by the proteasomal machinery. The boundaries were decided based on fungal alignments, which showed variable regions rich in CDK phosphorylation sites (for an example of the strategy, see Figure 3.2C). These cyclins were tested for their ability to phosphorylate substrates containing either a native “LP” docking site from Ste5 and Ste20 or a leucine-zipper docking site, which provided for an in vivo control of the activity of these foreign cyclins when expressed in the budding yeast host (Figure 5.1 B). Almost all of these cyclins, with the exception of
CaHgc1, were expressed comparably to budding yeast G1 cyclins and they were
202
Figure 5.1. G1 cyclins from related yeasts have similar docking preferences
(A) Homology tree of fungal (Sachharomycetales) G1 and B-type cyclins. Some species have additional G1 cyclins called Ccn1. The Ccn1 group is related but distinct from Cln3 and Cln1/2 groups. Adapted from Figure 1 of (Ofir and
Kornitzer, 2010)
(B) G1 cyclins from a variety of yeasts were expressed as GST-(lz) fusions to test in vivo phosphorylation of substrates with either a defective docking site or two LP docking sites (from Ste5 or Ste20) or the leucine zipper. All cyclins were truncated to remove their C-terminal tails, which control their stability.
Abbreviations: Sc = Saccharomyces cerevisiae; Sk = Saccharomyces kluyveri;
Kw = Kluyveromyces waltii; Ag = Ashbya gossypii; Ca = Candida albicans.
204
functionally active as displayed by the phosphorylation of the zippered substrate.
In general most cyclins were not able to phosphorylate the substrate when there was no functional docking site present. All Cln1/2 and Ccn1 cyclins were able to use both the Ste5 and the Ste20 docking sites to phosphorylate the CDK sites derived from Ste5 native sequence. It is important to note here that the docking site from Ste5 (LLPP) is slightly different in composition from the Ste20 docking site (SLDDPIQF) but in each case, hydrophobic residues like L and F seemed to be key. However, the two Cln3 cyclins tested here were not able to phosphorylate these substrates in spite of being very potent on the zipper- docking substrate. CaHgc1 was consistently expressed very weakly as compared to the other substrates. As a result, it is not clear whether its inability to phosphorylate native-dock substrates stems from its low expression or true lack of “LP” recognition, although it was able to phosphorylate the zipper-dock substrate somewhat efficiently. One very interesting thing that emerged from this experiment is the hyperpotency of S. kluyveri Ccn1 cyclin. Although all others were unable to phosphorylate a substrate lacking a functional dock, SkCcn1 was able to robustly phosphorylate it and continued to display stronger and more complete phosphorylation on substrates containing both native and zipper-docks, in spite of being expressed at the same levels as other cyclins. This surprising observation suggested that SkCcn1 might have the ability to activate budding yeast CDK1 so strongly that it can phosphorylate minimal consensus CDK sites without the help of any docking motif. This hyperpotency phenotype will be
205
further explored later in this Chapter. Overall, these observations clearly showed that LP recognition property is well conserved in a wide variety of G1 cyclins which suggests conservation of function in related yeasts
We wanted to further explore the conservation of “LP” recognition in G1 cyclins of more distantly related fungi. Both fission yeasts and molds are a considerable evolutionary distance away from budding yeasts and their immediate relatives, which are known as Hemiascomycetes (Figure 5.2 A) but still within the larger phylum of Ascomycetes (note, G1 cyclins from different members of
Hemiascomycetes were tested in Figure 5.1 B). Outside of this phylum, there is another phylum named Basidiomycetes (Figure 5.2 A), which separated from
Ascomycetes about 400 million years ago when plants invaded the earth.
Members of Basiodiomycetes include mushrooms, rusts, smuts and additional pathogenic budding yeasts. In an experiment very similar to the one described in
Figure 5.1 B, we tested several different G1 cyclins belonging to various groups:
Puc1s from fission yeasts Schizosaccharomyces pombe and
Schizosaccharomyces japonicus; Cln1s from molds Neurospora crassa and
Blastomyces dermatitidis; Cln1s from several Basidiomycetes species (smut:
Ustilago maydis, mushroom: Coprinopsis cinerea, budding yeast like:
Cryptococcus neoformans) (Figure 5.2 A). Each cyclin was expressed as a leucine-zipper fusion protein and tested against substrates containing wt or
206
Figure 5.2. G1 cyclins from distant fungi recognize LP-type docking motifs
(A) Expected Phylogenetic tree of fungi, showing two major phyla Ascomycetes and Basidiomycetes and sub-classes within Ascomycetes. (Adapted from Figure
2 of Hellborg et al., 2008)
(B) G1 cyclins from a variety of distant fungi were expressed as GST-(lz) fusions along with S. cerevisiae Cln2 and Cln3 to compare in vivo phosphorylation of substrates with either a defective docking site or an LP docking site from Ste5 or the leucine zipper. All cyclins were truncated to remove their C or N-terminal regions that control their stability.
Abbreviations: Sc = Saccharomyces cerevisiae; Sp = Schizosaccharomyces pombe; Sj = Schizosaccharomyces japonicus; Um = Ustilago maydis;
Cc = Coprinopsis cinerea; Cn = Cryptococcus neoformans ; Nc = Neurospora crassa; Bd = Blastomyces dermatitidis.
208
mutant native docks from Ste5 or a zipper-dock. Apart from S. pombe Puc1, which was consistently poorly expressed, most cyclins were fully functional in vivo and remarkably were able to phosphorylate a native Ste5 substrate in a docking dependent manner (Figure 5.2 B) whereas ScCLN3 and SjPuc1 were not. This clearly showed that “LP” recognition is highly conserved across large evolutionary distance amongst fungi, raising the possibility that a functional role for this type of docking has also been conserved across fungal evolution. It might be interesting to explore whether this recognition has an in vivo role in these fungi. Since all of these cyclins are involved in polarized morphogenesis in these fungi, “LP” recognition could play a role in the phosphorylation of polarity related proteins by G1 cyclins. A similar role of “LP” recognition was uncovered in budding yeast (Chapter 3). However, none of these new cyclins displayed hyperpotency in substrate phosphorylation. Our results demonstrated that G1 cyclins from fungi which are separated by large evolutionary distance form S. cerevisiae still maintained LP recognition. This argues strongly for the conservation of a functional role of LP recognition in these fungi.
Differences in sequence requirements between Cln1/2s and Ccn1s
While we were comparing different classes of G1 cyclins for their ability to use
“LP” type docking motifs, we noticed that Ccn1s needed additional sequence features apart from the core “LP” motif which possibly let to somewhat different
209
Figure 5.3. Clns and Ccn1s have subtly different sequence requirements for docking
Representative cyclins from the Cln1/2 group and the Ccn1 group from different yeasts were expressed as GST-(lz) fusions and compared for their ability to phosphorylate in vivo substrates with either two docking sites from Ste5, different in length or docking sites from Exo84 or Sic1.
Abbreviations: Sc = Saccharomyces cerevisiae; Kw = Kluyveromyces waltii;
Ca = Candida albicans.
210
Figure 5.3. Clns and Ccn1s have subtly different sequence requirements for docking
211
binding preferences as well (Figure 3.5). We tested “LP” type motifs from three different substrates previously used in Chapter 2, namely from Ste5, Exo84 and
Sic1. One of the Ste5 substrates, the Ste5-1-283 contains an intact LLPP motif followed by only two native residues. When we compared two Cln1/2s from twodifferent yeasts with two Ccn1s from two different yeasts, we found that while
Cln1/2s recognized all the different docks, Ccn1s only recognized the Ste5 dock but not the docks from Exo84 or Sic1 (Figure 5.3). Ccn1s were able to recognize the truncated Ste5 (1-283) protein, thus suggesting that whatever additional sequence features are required lies within this 1-283 region of Ste5. It cannot be, however, that Ccn1s are using an entirely different sequence for phosphorylating
Ste5, because Ccn1s can use a “LP” type docking motif from Ste20 (Figure
5.1B). This brings out subtle differences in substrate recognition between the two classes of G1 cyclins and suggests that in spite of some overlap, these two distinct classes of cyclins probably are able to target different substrates in vivo.
This difference further suggests that the Cln1/2 group may have somewhat different functions from the Ccn1 group during cell cycle, with one more suited for a certain role than the other and vice-versa.
Hyperpotency of some cyclin-CDK complexes in vivo
Our simple in vivo shift-based phosphorylation assay using a standard substrate
-/+ a docking site helped us compare the relative strengths of different cyclin-
212
Figure 5.4. Hyper-potent cyclins – S. pombe Cdc13 & S. kluyveri Ccn1
(A) S. cerevisiae G1 or B-type cyclins were expressed as GST-(lz) fusions and compared for their ability to phosphorylate in vivo, substrates with either an LP docking site from Ste5 or the leucine zipper. All cyclins were truncated to remove their C or N-terminal regions that control their stability.
(B) Full length S. cerevisiae G1 cyclin Cln2 and S. pombe mitotic cyclin Cdc13 were expressed as GST- fusions and compared for their ability to phosphorylate in vivo, substrates with either a wild-type or a mutant LP docking site from Ste5.
(C) S. cerevisiae Cln2 and Cln3, S. Kluyveri Ccn1 and S. pombe Cdc13 were expressed as GST- fusions and compared for their ability to phosphorylate in vivo, substrates with either no docking site or an LP docking site from Ste5 or
Ste20. Apart from S. pombe Cdc13, all other cyclins were truncated to remove their C-terminal regions that control their stability.
Abbreviations: Sk = Saccharomyces kluyveri; Sp = Schizosaccharomyces pombe.
213
Figure 5.4. Hyper-potent cyclins – S. pombe Cdc13 & S. kluyveri Ccn1
A B
C
214
CDK1 complexes. Most CDK complexes were not able to phosphorylate a substrate without the help of a docking site. However, two complexes were able to, thus exhibiting exceptional potency. In general, although the budding yeast mitotic cyclin Clb2-CDK1 complex showed higher potency than other budding yeast cyclin-CDK complexes on a zipper-dock substrate (evidenced by more complete conversion to the fully phosphorylated form), it was still unable to phosphorylate the substrate in the absence of a functional docking motif (Figure
5.4 A). In contrast, the S. pombe mitotic cyclin, Cdc13, in complex with the budding yeast CDK1, was able to phosphorylate the same substrate even in the absence of a functional docking site (Figure 5.4 B). This hyperpotent behavior was also seen in the case of S. kluyveri G1 cyclin Ccn1, in complex with the budding yeast CDK1 in an earlier experiment (Figure 5.1 B). One question that arises is whether these hyperpotent cyclins still use the native docking motif in spite of being able to phosphorylate without it. So we compared the SkCcn1 and
SpCdc13 side by side with ScCln2 and ScCln3 against substrates containing either no functional docking site or docking sites from Ste5 or Ste20 (Figure 5.4
C). Both SkCcn1 and SpCdc13 were able to phosphorylate the substrate that lacked docking, whereas ScCln2 and ScCln3 were not. However, although
SpCdc13 was not able to phosphorylate the two +dock substrates any better than
ScCln2, SkCcn1 was able to phosphorylate both these substrates more completely with the help of docking sites. This demonstrated that SkCcn1 was still using the “LP” type docking motifs in spite of probably activating the CDK to a
215
greater extent than other cyclins. However, SpCdc13 did not seem to recognize these LP-type docking motifs. As expected, ScCln3 was unable to use any of these three substrates. Overall, these results clearly point to the fact that different cyclins have the ability to activate the CDK to different extents, which might have interesting consequences for the cell cycle.
The hyperpotency of SpCdc13 is especially interesting because early cell cycle work in S. pombe showed that Cdc13-CDK1 complex was enough to take the cell through all stages of cell cycle (Start-DNA replication-mitosis) (Fisher and Nurse,
1996) in the absence of G1 and S phase cyclins. This helped fuel the idea of the quantitative model for the cell cycle where substrate specificity stemmed from different levels of activity of the CDK complex at the early part versus the later part of the cell cycle and robust oscillations of activity of a single cyclin-CDK module was deemed enough to generate these temporally separated periods of low and high CDK activity. On the contrary, in other eukaryotes including budding yeast, the cell cycle could not be entirely driven by any one type of cyclin-CDK complexes (Table 5.1). To our knowledge, a minimum cyclin-CDK module has not been identified for budding yeast but based on evidences it seems likely that a budding yeast cell cycle can be driven by a combination of one of the three G1 cyclins and an ectopically expressed mitotic cyclin (Clb1 or Clb2)
216
Table 5.1: Cyclin gene deletion and their phenotypes
genotype phenotype rescue references budding yeast (Epstein and Cross, 1992; Richardson et al., 1989; Schwob sic1Δ, and Nasmyth, 1993; cln1 cln2 cln3Δ unviable, arrest in G1 ectopicCLB5 Tyers, 1996) (Hu and Aparicio, CLB5promoter- 2005; Schwob and clb5 clb6Δ viable, delayed S phase CLB2and swe1Δ Nasmyth, 1993) clb3 clb4 clb1 clb2Δ unviable (Fitch et al., 1992) clb5 clb6 clb3 clb4 (Schwob et al., clb1Δ clb2tsGAL-CLB5 unviable, arrest in G2 1994) clb5 clb6 clb3 clb4 (Haase and Reed, clb1 clb2ΔGAL-CLB1 viable 1999) fission yeast (Martin-Castellanos puc1 cig1 cig2Δ viable, delay in G1 rum1Δ et al., 2000) cdc13Δ unviable (Hagan et al., 1988) mouse embryos grow but die at mid/late gestation with haematopoietic defects, MEFs cycD1−/−D2−/− D3−/− are viable (Kozar et al., 2004) death in late embryogenesis, wt placenta failure of trophoblast giant cell rescues endoreplication, MEFs are embryonic cycE1−/−E2−/− viable development (Geng et al., 2003) cycA1−/− viable, male infertile (Liu et al., 1998) death after day 5.5 (Kalaszczynska et p.c.,cycA1−/− A2−/− MEFs are al., 2009; Murphy et cycA2−/− viable al., 1997) (Brandeis et al., cycB1−/− death in early embryogenesis 1998) (Brandeis et al., cycB2−/− viable and fertile 1998)
Reproduced from (Uhlmann et al., 2011)
217
(Epstein and Cross, 1992; Fitch et al., 1992; Haase and Reed, 1999; Hu and
Aparicio, 2005; Richardson et al., 1989; Schwob et al., 1994; Schwob and
Nasmyth, 1993; Tyers, 1996). Although the requirement for G1 cyclins can be bypassed by certain genetic manipulations, these modified cells often lack the fitness of wild type cells (Schwob and Nasmyth, 1993; Skotheim et al., 2008;
Tyers, 1996).
The current model for cell cycle regulation says that early events in the cell cycle, like Start and DNA replication, are fueled by a less active but highly specific form of the CDK whereas later events like mitosis are fueled by a highly active form of the CDK which does not have high substrate specificity (Koivomagi et al.,
2011b). Our in vivo results with SpCdc13 hints at the possibility that its hyperpotency makes it suitable to drive the cell cycle in a different way than most other cyclin-CDK modules found in other organisms.
In budding yeast, S phase (DNA replication) is normally driven by Clb5/6-CDK1 complexes whereas Mitosis requires mainly Clb1/2-CDK1. Although all of these are B-type cyclins and at least in some cases they can substitute for each other, several differences exist between these two groups such that not all roles of
Clb5/6 in the cell cycle are redundant with Clb1/2 and vice versa (reviewed in
Chapter 1).
218
Mechanistically, there are two main differences between these two groups of cyclins. Recent studies have demonstrated the Clb2-CDK1 is a more potent enzyme than Clb5-CDK1, which allows it to have a wider range of substrates
(Koivomagi et al., 2011b; Loog and Morgan, 2005). However, some substrates are still more sensitive towards Clb5 because Clb5 can target those substrates through its hydrophobic patch (hp) region whereas Clb2 is not as efficient in this hp-mediated targeting of those substrates (Bhaduri and Pryciak, 2011; Loog and
Morgan, 2005). An alignment of different B-type cyclins from a variety of yeasts pointed out that the hp region in the Clb1/2 group from the Saccharomyces clade has evolved quite differently from the classical MRAIL like hp of the Clb5/6s, which target RxL type docking sites in substrates(Archambault et al., 2005). It raises the possibility that the hp region in Clb1/2 has evolved to have different functions – it could bind to a different kind of sequence, it could affect the localization of the cyclin or both. Indeed, there is evidence for both roles of the atypical hp region in Clb2 (Bailly et al., 2003; Hu et al., 2008).
One interesting question here is whether a functionally different hydrophobic patch is a specialty of the mitotic cyclins from the Saccharomyces clade or all mitotic B-type cyclins in fungi have an altered role for their hp region. Organisms further away from this clade, those belonging to the Basidiomycetes phylum, have only one mitotic cyclin. Future work will aim to investigate whether B-type cyclins from these simpler systems can recognize RxL motifs in substrates.
219
Another interesting thing that would be looked at in future studies is if other cyclins display hyperpotent behavior. A likely candidate that will be tested along with others is the Cdc13 cyclin from another fission yeast, S. japonicas. Also it will be important to test whether this hyperpotent phenotype applies to other CDK phosphorylation sites, for examples, the ones present in Ste20 or Whi5. Currently our observations only pertain to CDK sites in Ste5.
Finally, based on above results, it is clear that “LP” recognition is a highly favored method of substrate selection by fungal G1 cyclins. It will be interesting to know whether this method has an in vivo role in these organisms. In C. albicans, The
Ccn1 cyclin has been shown to be involved in polarized morphogenesis, which is important for its pathogenicity. Future work would aim to address if “LP” recognition is necessary for this role of CaCcn1. Our preliminary results showed that mutating the substrate-binding groove in CaCcn1 significantly reduced its ability to promote hyperpolarized growth when overexpressed in S. cerevisiae.
Acknowledgements
We thank Rick Baker, Amy Gladfelter, Oliver Rando, and Charlie Specht for fungal DNA samples, Nick Buchler for helpful discussions and Matt Winters for technical assistance.
220
Materials and Methods
Yeast Strains and Plasmids
Standard procedures were used for growth and genetic manipulation of yeast
(Rothstein, 1991; Sherman, 2002). Cells were grown at 30°C in synthetic (SC) medium with 2% glucose and/or raffinose. Strains and plasmids are listed in tables below.
In vivo CDK Phosphorylation Assays
As described previously (Bhaduri and Pryciak, 2011; Pope et al., 2014), cells harboring PGAL1-GST-cyclin constructs and HA-tagged CDK substrates were grown in synthetic raffinose media, and then induced with 2% galactose (for 2.5 hr) to drive cyclin expression; substrates were based on the Ste5 N-terminus, with or without docking sites as indicated. Whole cell extracts were prepared, and substrate phosphorylation was assessed by SDS-PAGE and immunoblotting.
Whole Cell Extracts
Whole cell extracts (5ml cultures, Od660=0.6) were prepared by a modified version of a previous protocol (Lee and Dohlman, 2008). Here, 300 µL of trichloroacetic acid (TCA) buffer (10 mM Tris-HCl, pH 8.0, 10% TCA, 25 mM ammonium acetate, 1 mM Na2EDTA) was added directly to frozen cell pellets
(usually from 2 mL culture), and incubated on ice for 10 minutes. Samples were
221
pelleted in a microcentrifuge for 10 min at 4˚C. The pellet was resuspended in
150 µL Resuspension Buffer (0.1 M Tris.HCl, pH 11.0, 3% SDS), boiled for 5 min, allowed to cool at room temperature for 5 minutes, then re-centrifuged for 30 sec. The supernatant (120 µL) was transferred to a new tube, 20 µL was reserved to assay protein concentration by a Pierce BCA Protein Assay Kit
(#23225), and then 100 µL of 2x SDS Sample Buffer was added to the remainder. Equivalent amounts of total protein (generally 20 µg) were loaded in each lane.
Immunoblotting
Protein samples were analyzed by SDS-PAGE and transferred to PVDF using a submerged tank device. HA-tagged or GST-tagged proteins were detected with mouse anti-HA (1:1000, Covance #MMS101R) or anti-GST (1:1000, Santa Cruz
Biotechnologies #sc-138) antibodies, followed by HRP-conjugated goat anti- mouse (1:3000, BioRad #170-6516) antibodies. Enhanced chemiluminescent detection used a Biorad Clarity kit (#170-5060).
222
Table 5.2 : Yeast strains used in Chapter V Name Background* Relevant Genotype Source†
BY4741 (S288c) MATa his3∆1 leu2∆0 ura3∆0 met15∆0 Bachman/Boeke
Table 5.3 : Plasmids used in Chapter V Name Alias Description Source pPP2154 pHG-GST CEN HIS3 PGAL1-GST vector (1) pPP3501 pS5kHA-1-283 CEN URA3 ste5 1-283- 3xHA TCYC1 this study pPP3509 pH5n-1-337-wt CEN URA3 ste5 1-337-(wt)- 3xHA TCYC1 (1) pPP3547 pH5n-1-260-S20CSM CEN URA3 ste5 1-260-(Ste20 80-115wt)- 3xHA TCYC1 (1) pPP3572 pt-HGT-CLN2-F CEN HIS3 GAL-GST-CLN2 full length TCYC1 (1) pPP3714 pH5n-1-337-P4 CEN URA3 ste5 1-337-(LLPP-AAAA)- 3xHA TCYC1 (1) pPP3737 pt-HGT-Cdc13 CEN HIS3 GAL-GST-S. pombe Cyclin Cdc13 full length TCYC1 this study pPP3802 pH5n-1-260-dSic1 CEN URA3 ste5 1-260-(Sic1 121-150)- 3xHA TCYC1 (1) pPP3807 pH5n-1-260-dExo84 CEN URA3 ste5 1-260-(Exo84 281-311)- 3xHA TCYC1 (1) pPP3877 pS5kHA-1-260-E34(N) CEN URA3 ste5(1-260)-[E34(N) zipper]- 3xHA TCYC1 (2) pPP3916 pt-HGT-CLN2-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN2(1-372) TCYC1 (2) pPP3919 pt-HGT-Rup-Sklu-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Sklu CLN1/2(1-364) TCYC1 this study pPP3920 pt-HGT-Rup-Kwal-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CLN1/2(1-363) TCYC1 this study pPP3921 pt-HGT-Rup-Agos-CLN1/2 CEN HIS3 PGAL1-GST-[R34 zipper]-Agos CLN1/2(1-364) TCYC1 this study pPP3929 pt-HGT-CLN1-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN1(1-388) TCYC1 (2) pPP3955 pt-HGT-Rup-CLB5-t CEN HIS3 GAL1pr-GST-[R34 zipper]-CLB5(133-435) TCYC1 this study pPP3956 pt-HGT-Rup-CLB2-t CEN HIS3 GAL1pr-GST-[R34 zipper]-CLB2(198-491) TCYC1 this study pPP3957 pt-HGT-Rup-Kwal-CCN1 CEN HIS3 PGAL1-GST-[R34 zipper]-Kwal CCN1(1-379) TCYC1 this study pPP3958 pt-HGT-Rup-Sklu-CCN1 CEN HIS3 GAL1pr-GST-[R34 zipper]-SkluCCN1(1-405) TCYC1 this study pPP3959 pt-HGT-Rup-Calb-CCN1-a CEN HIS3 PGAL1-GST-[R34 zipper]-Calb CCN1(1-469) TCYC1 this study pPP3961 pt-HGT-Rup-Calb-HGC1 CEN HIS3 GAL1pr-GST-[R34 zipper]-CalbHGC1(1-406) TCYC1 this study pPP3963 pt-HGT-Rup-Agos-CLN3 CEN HIS3 PGAL1-GST-[R34 zipper]-Agos CLN3(1-324) TCYC1 this study pPP3964 pt-HGT-CLN3-t-R34up CEN HIS3 PGAL1-GST-[R34 zipper]-CLN3(1-395) TCYC1 (2) pPP4128 pt-HGT-Rup-Sj-Puc1 CEN HIS3 GAL1pr-GST-[R34 zipper]-SjapPUC1(FL) TCYC1 this study pPP4130 pt-HGT-Rup-Cc-CLN-t CEN HIS3 GAL1pr-GST-[R34 zipper]-CcinCLN(1-359 w/ exon fusion) TCYC1 this study pPP4131 pt-HGT-Rup-Nc-CLN-t CEN HIS3 GAL1pr-GST-[R34 zipper]-NcraCLN(1-309 w/ exon fusion) TCYC1 this study pPP4132 pt-HGT-Rup-Bd-CLN-t CEN HIS3 GAL1pr-GST-[R34 zipper]-BderCLN(1-313 w/ exon fusion) TCYC1 this study pPP4137 pt-HGT-Rup-Sp-Puc1 CEN HIS3 GAL1pr-GST-[R34 zipper]-SpomPUC1(FL) TCYC1 this study pPP4144 pt-HGT-Rup-UmCLN102-374 CEN HIS3 GAL1pr-GST-[R34 zipper]-UmayCLN(102-374) TCYC1 this study pPP4145 pt-HGT-Rup-CneoCLN-t CEN HIS3 GAL1pr-GST-[R34 zipper]-CneoCLN(1-332 w/ exon fusion) TCYC1 this study * Source: (1) (Bhaduri and Pryciak, 2011); (2) (Pope et al., 2014)
223
CHAPTER VI
Concluding remarks
Purpose and main outcomes:
Several cell cycle events require specific forms of the cyclin-CDK complexes. It has been known for some time that cyclins not only contribute to cell cycle progression by activating the CDK but also by choosing substrates and/or specifying the location of the CDK holoenzyme. There are several examples of
B-type cyclins identifying certain peptide motifs in their specific substrates through a conserved region in their structure. However, such interactions were not known for the G1 class of cyclins, which are instrumental in helping the cell decide whether or not to commit to a new cell cycle, a function that is non- redundant with B-type cylins in budding yeast (reviewed extensively in Chapter
1). In Chapter 2 of this dissertation we have presented evidences that some G1 cyclins in budding yeast, Cln1 and Cln2, identify specific substrates by interacting with a particular type of substrate patch. This interaction is mediated by a conserved region of the cyclins’ structure, and both this region and the substrate patch differ from those used by B-type cyclins. In Chapter 3, we have further shown that the substrate-binding region in Cln1/2 is highly conserved amongst a variety of fungal G1, thus suggesting a conserved function. We discovered that the main effect of disrupting this interaction is to delay cell cycle entry in budding
224
yeast, possibly resulting from incomplete multi-site phosphorylation of substrates.
Also, interestingly, in Chapter 4, we found that a CDK inhibitor can regulate the cyclin-CDK complex by inhibiting cyclin-substrate interaction. In Chapter 5, apart from finding that G1 cyclins from many distant fungi, such as molds and mushrooms, have maintained this substrate interaction function, we discovered that some cyclins have the ability to make the CDK hyperpotent in activity, thus suggesting additional roles for such complexes.
Salient features of the study and future directions:
In Chapter 2, we identified short hydrophobic (Leucine and Proline rich) docking sites in several CDK substrates, which specifically bind to budding yeast G1/S cyclins Cln1/2 and enhance phosphorylation of CDK substrates in a cyclin- specific manner in vivo. These docking sites are modular in that they can promote phosphorylation from a variety of distances and positions relative to the
CDK sites. Furthermore, cyclin specificity of the same phosphorylation sites can be switched simply by exchanging docking sites among different substrates. It was surprising how easily we identified similar “LP” type docking motifs from several CDK substrates suggesting that this type of interaction may be very commonly used by the G1/S cyclin-CDKs in yeast to target their substrates.
Subsequent studies from Mart Loog and colleagues have also shown the use of these docking motifs in phosphorylation of CDK substrates by G1/S cyclin-CDKs.
Collectively, these findings suggest that docking interactions play a prevalent but
225
previously unappreciated role in driving phosphorylation of G1/S CDK substrates.
Docking motifs, in principle, are capable of affecting substrate phosphorylation in a number of ways: determining cyclin specificity without any contribution from the
CDK sites themselves; promoting phosphorylation of suboptimal CDK sites, which are poorly phosphorylated by most forms of the CDK but form an overwhelming majority of all phosphorylated CDK sites in yeast (Holt et al.,
2009); promoting multi-site phosphorylation of substrates in a processive manner
(Koivomagi et al., 2013); and introducing additional regulation by interacting with regulators like phosphatases (Malleshaiah et al., 2010).
One key question that arose was how important are these substrate specific docking interactions with G1/S cyclin-CDK for the progression of the cell cycle.
The best way to ask this question was to mutate the substrate-binding region in
Cln2 and look for cell cycle phenotypes. However, unlike in the substrates where the docking motif occurred in largely unstructured areas, the binding site in the cyclin was envisioned to be a part of highly structured cyclin box folds. Any tampering in this region had the potential to interfere with the function of the cyclin. In the absence of an actual structure of Cln2 with a docking peptide, it was very difficult to predict where in Cln2 one can find the docking region and some initial attempts using targeted or unbiased large-scale mutational approaches failed. So in Chapter 3, we employed a strategy to not only identify different regions to mutate but also to control for any loss of activity upon mutation in vivo
226
(detailed in Chapter 3). Through these efforts, we were able to find a Cln2 mutant
(m4) that was specifically defective in phosphorylating docking-dependent (“LP” type) substrates but otherwise fully functional. The residues making up this substrate-binding region describe a mild depression near the hp cleft in models of Cln2. A comparison with a bona-fide structure of a B-type cyclin revealed that the m4 region was close to but separate from the well-characterized hp region on
B-type cyclins. This m4 mutation caused Cln2 to lose its in vivo interactions with several substrates and also rendered it incapable of promoting multi-site phosphorylation in vitro.
Although the m4 mutations caused disruption of docking dependent binding and phosphorylation, it cannot be ruled out that m4 mutations might not disrupt the actual binding interface in Cln2, instead it might cause a conformation change in
Cln2 which masks the actual binding interface. Such possibilities can only be distinguished by solving the crystal structure of Cln2 with a LP peptide.
In vivo, this mutant Cln2 was defective in fully phosphorylating Whi5 after release from pheromone arrest in G1 and also failed to promote robust transcription of several genes. These mechanistic insights were translated into a cell cycle phenotype when we observed that if cells had to rely on this mutant Cln2, they could not start a new cell cycle (budding and DNA replication) until they were substantially bigger in size. One of the roles that Cln2 has always been
227
associated with is bud morphogenesis (Cvrckova and Nasmyth, 1993). After release from a pheromone arrest in G1, mutant Cln2 was delayed in budding.
Also, while overexpressed wild type Cln2 promoted hyperpolarized bud growth, m4 failed to do that as robustly. Interestingly, we mutated the same region in a few other G1 cyclins from neighboring yeasts and in each case the mutant cyclin showed a reduced ability to promote polarized bud morphogenesis. Overall, it appears that docking ability of Cln2 is especially important for the robust execution of several molecular events leading to the commitment point at Start.
In this short interval, docking helps promote sharp and full phosphorylation of the early substrates of the CDK, several of which require phosphorylation at multiple
CDK sites for their regulation. Therefore our results say that substrate docking of
Cln2 is very important for a rapid and decisive commitment to cell cycle entry.
Some phenotypes of m4 were not very pronounced, especially when cells were released from a prolonged pheromone arrest, which helps cells overcome the cell size threshold at cell cycle entry. We hypothesize that inhibitors and negative regulators, which probably make use of the m4 region, cannot inhibit the cln2-m4 allele as strongly they can inhibit the wt allele of Cln2. This difference may lead to attenuation of some of m4 phenotypes. Our hypothesis is based on observations such as the aggravation of m4 phenotypes in the absence of CKI Far1 and the doubling of cln2-m4 half-life when compared to Cln2-wt. The latter observation may indicate that the proteasomal machinery also uses the docking interaction to
228
identify Cln2 but alternatively the m4 mutations can render Cln2 more stable by some other means, for example, by creaking a more stable folding which is harder to degrade (Nick Pace et al., 2014).
The docking site in Cln2 could also be multipurpose just like the docking sites in its substrates (see above), such that it may also bind not only substrates but also regulators like CDK inhibitors and members of the proteolytic machinery. Indeed two observations indirectly suggest this possibility – one being the increased half- life of cln2-m4 and the other being the mitigation of some m4 phenotypes (like overall increase in cell size) in the absence of the CDK inhibitor Far1. In fact,
Far1 does inhibit substrate binding by Cln2, as shown in Chapter 4. Once stimulated by pheromone, Far1 is able to specifically inhibit Cln2-CDK’s interaction with its substrates as well as its ability to phosphorylate docking dependent substrates in vivo. Far1 can competitively inhibit this substrate interaction because it can bind Cln2 more strongly than substrates. A mutant
Far1, which fails to inhibit Cln2’s substrate binding, also fails to promote pheromone arrest. Interestingly, Far1 also separately inhibits another function of the Cln2-CDK complex, most likely CDK activity. Based on our observations, it seems likely that Far1 mediated inhibition is most effective on substrates that will critically depend on docking. Such substrates could contain inherently poor or suboptimal phosphorylation sites and/or might need to be phosphorylated at multiple positions. Another interesting thing that emerged is the specificity of Far1
229
mediated inhibition of CDK activity – only Cln1/2-CDK complexes were inhibited while Cln3, Clb5 and Clb2-CDK complexes were not affected even though Far1 could bind all cyclins equally well. Currently it is not known whether Far1 has a
LP docking motif but two independent regions in Far1 have been shown to bind
Cln2 (Peter et al., 1993) thus suggesting that Far1 may employ a larger interface to interact with Cln2.
Finally, in Chapter 5, we have shown that this substrate binding function is conserved in G1 cyclins of both yeasts and non-yeast fungi like mushrooms and molds which shared the last common ancestor with yeasts about 400 million years ago. This strongly suggests that there is a functional relevance for this specific docking interaction in these fungi. Quite like budding yeast, in several of these fungi, G1 cyclins are entrusted with the job of promoting polarized hyphal morphogenesis, which is a critical requirement for virulence in some of the pathogenic fungi. It’s likely that similar to budding yeast, this same type of docking interaction is involved in promoting polarized growth in these other fungi.
Some of these exogenous cyclins demonstrated hyperpotency in activity. Such hyperpotency likely results from the ability of these cyclins to activate the CDK to a higher degree, although alternate explanations cannot be ruled out. For example, these cyclins may change the conformation of the CDK in such a way that it can bind Cks1 (phosphor-adapter subunit of cyclin-CDK complexes) better
230
and thus promote more efficient use of phosphorylation sites. Or even, these cyclins could make the cyclin-CDK complex resistant to the CKI Far1.
This hyperpotent behavior also has important implications for cyclin evolution.
These hyperpotent cyclins may represent an ancestral form of cyclins, which may have been designed to drive a basic eukaryotic cell cycle completely on their own. But subsequent increase in complications in that basic cell cycle might have fueled the need to generate more specialized cyclin-CDK modules in order to temporally and spatially separate distinct events during the cell cycle. So the modern low-activity but high-specificity cyclins may have evolved from these apparently hyperpotent ancestral cyclins.
Collectively, we have uncovered a novel type of substrate interaction between budding yeast G1/S cyclins and several early substrates of the CDK. This interaction is specific to this type of cyclin and involves a conserved interface on the cyclin, which binds to short leucine-proline rich patches on the substrates.
These docking sequences also allow for other regulatory inputs by interacting with inhibitors and regulators, both at the level of the cyclin and the substrates.
Our observations lead to several possibilities that warrant future studies. For example, future studies may address how these two different classes of docking interactions evolved, for instance, whether they were both present in some ancient cyclin and diverged into two specific groups at a later time. Also, another
231
obvious question that arises is whether the Cln3 group has yet another type of docking interaction. Another interesting question is to investigate the role of “LP” docking in polarized growth and virulence in a pathogenic fungus like Candida albicans, where the G1 cyclin Ccn1 has been shown to be involved in hyphal growth critical for virulence. Our results in Chapter 3 show that an m4 like mutation in CaCcn1 reduces its ability to promote hyperpolarized bud growth in budding yeast.
232
CHAPTER VII
Appendix
233
Figure A1. Phosphorylation of Ste5 N-terminal by Cln2 is reversed by phosphatase treatment
A HA-tagged Ste5 N-terminal fragment, which lacks the NLS domain, resolves into two bands (faster: unphosphorylated; slower: terminally phosphorylated. The
HA-tagged Ste5 1-315∆NLS fragment expressed from its native promoter, was monitored in time course after galactose-induced expression of GST-tagged
Cln2. Reduced electrophoretic mobility signifies phosphorylation. The maximally phosphorylated 180m sample was treated with either Calf-intestine Alkaline phosphatase (CIP: NEB # M0290S) (180+CIP) or water (180+mock) for 1 hr.
Phosphorylation of the 180m sample is fully reversed by treatment with CIP.
234
Figure A1. Phosphorylation of Ste5 N-terminal by Cln2 is reversed by phosphatase treatment
time after galactose induction (min.) 0 5 10 15 30 45 60 75 90 105 120 180 180+CIP 180+mock
Ste5 1-315ΔNLS
Strain: MAPK∆; + PGAL1-CLN2
235
Figure A2. Cyclin specific phosphorylation of Ste20 regulatory domains in the absence of B-type cyclin-CDK inhibitor Sic1
In a strain lacking B-type cyclin-CDK inhibitor Sic1, a V5-tagged Ste20 fragment, expressed from its native promoter, was monitored after galactose-induced expression of GST-tagged cyclins. Reduced electrophoretic mobility signifies phosphorylation. A variant of Cln3 lacking ten CDK sites (Cln310A) was used to increase its stability. Absence of Sic1 did not alter cyclin specificity of the Ste20 fragment. Results from two independent experiments are shown.
237
Figure A3. The Cln2 docking site in Ste20 enhances phosphorylation of a
Ste20 80-333 N-terminal fragment
PGAL1-Cln2-induced phosphorylation was assayed for a V5-tagged form of Ste20
N-terminal fragment (80-333), with or without mutations in the docking site (mut3) or the 13 confirmed CDK sites (CDK*). Results from two independent experiments are shown.
239
References
Acharya, A., Ruvinov, S.B., Gal, J., Moll, J.R., and Vinson, C. (2002). A heterodimerizing leucine zipper coiled coil system for examining the specificity of a position interactions: amino acids I, V, L, N, A, and K. Biochemistry 41, 14122- 14131.
Adams, A.E., Johnson, D.I., Longnecker, R.M., Sloat, B.F., and Pringle, J.R. (1990). CDC42 and CDC43, two additional genes involved in budding and the establishment of cell polarity in the yeast Saccharomyces cerevisiae. The Journal of cell biology 111, 131-142.
Adams, P.D., Sellers, W.R., Sharma, S.K., Wu, A.D., Nalin, C.M., and Kaelin, W.G., Jr. (1996). Identification of a cyclin-cdk2 recognition motif present in substrates and p21-like cyclin-dependent kinase inhibitors. Mol Cell Biol 16, 6623-6633.
Alberghina, L., Rossi, R.L., Querin, L., Wanke, V., and Vanoni, M. (2004). A cell sizer network involving Cln3 and Far1 controls entrance into S phase in the mitotic cycle of budding yeast. The Journal of cell biology 167, 433-443.
Amon, A., Surana, U., Muroff, I., and Nasmyth, K. (1992). Regulation of p34CDC28 tyrosine phosphorylation is not required for entry into mitosis in S. cerevisiae. Nature 355, 368-371.
Amon, A., Tyers, M., Futcher, B., and Nasmyth, K. (1993). Mechanisms that help the yeast cell cycle clock tick: G2 cyclins transcriptionally activate G2 cyclins and repress G1 cyclins. Cell 74, 993-1007.
Archambault, V., Buchler, N.E., Wilmes, G.M., Jacobson, M.D., and Cross, F.R. (2005). Two-faced cyclins with eyes on the targets. Cell Cycle 4, 125-130.
Archambault, V., Chang, E.J., Drapkin, B.J., Cross, F.R., Chait, B.T., and Rout, M.P. (2004). Targeted proteomic study of the cyclin-Cdk module. Mol Cell 14, 699-711.
Archambault, V., Li, C.X., Tackett, A.J., Wasch, R., Chait, B.T., Rout, M.P., and Cross, F.R. (2003). Genetic and biochemical evaluation of the importance of Cdc6 in regulating mitotic exit. Mol Biol Cell 14, 4592-4604.
Asano, S., Park, J.E., Sakchaisri, K., Yu, L.R., Song, S., Supavilai, P., Veenstra, T.D., and Lee, K.S. (2005). Concerted mechanism of Swe1/Wee1 regulation by multiple kinases in budding yeast. EMBO J 24, 2194-2204.
240
Bailly, E., Cabantous, S., Sondaz, D., Bernadac, A., and Simon, M.N. (2003). Differential cellular localization among mitotic cyclins from Saccharomyces cerevisiae: a new role for the axial budding protein Bud3 in targeting Clb2 to the mother-bud neck. Journal of cell science 116, 4119-4130.
Baldin, V., Lukas, J., Marcote, M.J., Pagano, M., and Draetta, G. (1993). Cyclin D1 is a nuclear protein required for cell cycle progression in G1. Genes Dev 7, 812-821.
Bardin, A.J., and Amon, A. (2001). Men and sin: what's the difference? Nat Rev Mol Cell Biol 2, 815-826.
Bardwell, L. (2005). A walk-through of the yeast mating pheromone response pathway. Peptides 26, 339-350.
Barral, Y., Jentsch, S., and Mann, C. (1995). G1 cyclin turnover and nutrient uptake are controlled by a common pathway in yeast. Genes Dev 9, 399-409.
Bashor, C.J., Helman, N.C., Yan, S., and Lim, W.A. (2008). Using engineered scaffold interactions to reshape MAP kinase pathway signaling dynamics. Science 319, 1539-1543.
Baumer, M., Braus, G.H., and Irniger, S. (2000). Two different modes of cyclin clb2 proteolysis during mitosis in Saccharomyces cerevisiae. FEBS letters 468, 142-148.
Beaudette, K.N., Lew, J., and Wang, J.H. (1993). Substrate specificity characterization of a cdc2-like protein kinase purified from bovine brain. The Journal of biological chemistry 268, 20825-20830.
Benton, B.K., Tinkelenberg, A.H., Jean, D., Plump, S.D., and Cross, F.R. (1993). Genetic analysis of Cln/Cdc28 regulation of cell morphogenesis in budding yeast. EMBO J 12, 5267-5275.
Berset, C., Griac, P., Tempel, R., La Rue, J., Wittenberg, C., and Lanker, S. (2002). Transferable domain in the G(1) cyclin Cln2 sufficient to switch degradation of Sic1 from the E3 ubiquitin ligase SCF(Cdc4) to SCF(Grr1). Mol Cell Biol 22, 4463-4476.
Bhaduri, S., and Pryciak, P.M. (2011). Cyclin-specific docking motifs promote phosphorylation of yeast signaling proteins by G1/S Cdk complexes. Curr Biol 21, 1615-1623.
241
Bhattacharyya, R.P., Remenyi, A., Good, M.C., Bashor, C.J., Falick, A.M., and Lim, W.A. (2006). The Ste5 scaffold allosterically modulates signaling output of the yeast mating pathway. Science 311, 822-826.
Bishop, A., Lane, R., Beniston, R., Chapa-y-Lazo, B., Smythe, C., and Sudbery, P. (2010). Hyphal growth in Candida albicans requires the phosphorylation of Sec2 by the Cdc28-Ccn1/Hgc1 kinase. EMBO J 29, 2930-2942.
Bishop, A.C., Ubersax, J.A., Petsch, D.T., Matheos, D.P., Gray, N.S., Blethrow, J., Shimizu, E., Tsien, J.Z., Schultz, P.G., Rose, M.D., et al. (2000). A chemical switch for inhibitor-sensitive alleles of any protein kinase. Nature 407, 395-401.
Blethrow, J.D., Glavy, J.S., Morgan, D.O., and Shokat, K.M. (2008). Covalent capture of kinase-specific phosphopeptides reveals Cdk1-cyclin B substrates. Proceedings of the National Academy of Sciences of the United States of America 105, 1442-1447.
Bloom, J., and Cross, F.R. (2007). Multiple levels of cyclin specificity in cell-cycle control. Nat Rev Mol Cell Biol 8, 149-160.
Brachmann, C.B., Davies, A., Cost, G.J., Caputo, E., Li, J., Hieter, P., and Boeke, J.D. (1998). Designer deletion strains derived from Saccharomyces cerevisiae S288C: a useful set of strains and plasmids for PCR-mediated gene disruption and other applications. Yeast 14, 115-132.
Brandeis, M., Rosewell, I., Carrington, M., Crompton, T., Jacobs, M.A., Kirk, J., Gannon, J., and Hunt, T. (1998). Cyclin B2-null mice develop normally and are fertile whereas cyclin B1-null mice die in utero. Proceedings of the National Academy of Sciences of the United States of America 95, 4344-4349.
Breeden, L.L. (2003). Periodic transcription: a cycle within a cycle. Curr Biol 13, R31-38.
Breitkreutz, A., Choi, H., Sharom, J.R., Boucher, L., Neduva, V., Larsen, B., Lin, Z.Y., Breitkreutz, B.J., Stark, C., Liu, G., et al. (2010). A global protein kinase and phosphatase interaction network in yeast. Science 328, 1043-1046.
Brotherton, D.H., Dhanaraj, V., Wick, S., Brizuela, L., Domaille, P.J., Volyanik, E., Xu, X., Parisini, E., Smith, B.O., Archer, S.J., et al. (1998). Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d. Nature 395, 244-250.
Brown, N.R., Lowe, E.D., Petri, E., Skamnaki, V., Antrobus, R., and Johnson, L.N. (2007). Cyclin B and cyclin A confer different substrate recognition properties on CDK2. Cell Cycle 6, 1350-1359.
242
Brown, N.R., Noble, M.E., Endicott, J.A., and Johnson, L.N. (1999). The structural basis for specificity of substrate and recruitment peptides for cyclin- dependent kinases. Nat Cell Biol 1, 438-443.
Buchan, D.W., Minneci, F., Nugent, T.C., Bryson, K., and Jones, D.T. (2013). Scalable web services for the PSIPRED Protein Analysis Workbench. Nucleic Acids Res 41, W349-357.
Bueno, A., and Russell, P. (1992). Dual functions of CDC6: a yeast protein required for DNA replication also inhibits nuclear division. EMBO J 11, 2167- 2176.
Butty, A.C., Perrinjaquet, N., Petit, A., Jaquenoud, M., Segall, J.E., Hofmann, K., Zwahlen, C., and Peter, M. (2002). A positive feedback loop stabilizes the guanine-nucleotide exchange factor Cdc24 at sites of polarization. EMBO J 21, 1565-1576.
Calzada, A., Sacristan, M., Sanchez, E., and Bueno, A. (2001). Cdc6 cooperates with Sic1 and Hct1 to inactivate mitotic cyclin-dependent kinases. Nature 412, 355-358.
Cardoso, M.C., Leonhardt, H., and Nadal-Ginard, B. (1993). Reversal of terminal differentiation and control of DNA replication: cyclin A and Cdk2 specifically localize at subnuclear sites of DNA replication. Cell 74, 979-992.
Castillo-Lluva, S., and Perez-Martin, J. (2005). The induction of the mating program in the phytopathogen Ustilago maydis is controlled by a G1 cyclin. The Plant cell 17, 3544-3560.
Chang, E.J., Begum, R., Chait, B.T., and Gaasterland, T. (2007). Prediction of cyclin-dependent kinase phosphorylation substrates. PloS one 2, e656.
Chang, F., and Herskowitz, I. (1990). Identification of a gene necessary for cell cycle arrest by a negative growth factor of yeast: FAR1 is an inhibitor of a G1 cyclin, CLN2. Cell 63, 999-1011.
Chang, F., and Herskowitz, I. (1992). Phosphorylation of FAR1 in response to alpha-factor: a possible requirement for cell-cycle arrest. Mol Biol Cell 3, 445- 450.
Chapa y Lazo, B., Bates, S., and Sudbery, P. (2005). The G1 cyclin Cln3 regulates morphogenesis in Candida albicans. Eukaryot Cell 4, 90-94.
243
Charrier-Savournin, F.B., Chateau, M.T., Gire, V., Sedivy, J., Piette, J., and Dulic, V. (2004). p21-Mediated nuclear retention of cyclin B1-Cdk1 in response to genotoxic stress. Mol Biol Cell 15, 3965-3976.
Charvin, G., Oikonomou, C., Siggia, E.D., and Cross, F.R. (2010). Origin of irreversibility of cell cycle start in budding yeast. PLoS Biol 8, e1000284.
Chen, J., Jackson, P.K., Kirschner, M.W., and Dutta, A. (1995). Separate domains of p21 involved in the inhibition of Cdk kinase and PCNA. Nature 374, 386-388.
Chen, J., Saha, P., Kornbluth, S., Dynlacht, B.D., and Dutta, A. (1996). Cyclin- binding motifs are essential for the function of p21CIP1. Mol Cell Biol 16, 4673- 4682.
Cheng, K.Y., Noble, M.E., Skamnaki, V., Brown, N.R., Lowe, E.D., Kontogiannis, L., Shen, K., Cole, P.A., Siligardi, G., and Johnson, L.N. (2006). The role of the phospho-CDK2/cyclin A recruitment site in substrate recognition. The Journal of biological chemistry 281, 23167-23179.
Chi, Y., Welcker, M., Hizli, A.A., Posakony, J.J., Aebersold, R., and Clurman, B.E. (2008). Identification of CDK2 substrates in human cell lysates. Genome biology 9, R149.
Colman-Lerner, A., Gordon, A., Serra, E., Chin, T., Resnekov, O., Endy, D., Pesce, C.G., and Brent, R. (2005). Regulated cell-to-cell variation in a cell-fate decision system. Nature 437, 699-706.
Costanzo, M., Nishikawa, J.L., Tang, X., Millman, J.S., Schub, O., Breitkreuz, K., Dewar, D., Rupes, I., Andrews, B., and Tyers, M. (2004). CDK activity antagonizes Whi5, an inhibitor of G1/S transcription in yeast. Cell 117, 899-913.
Coudreuse, D., and Nurse, P. (2010). Driving the cell cycle with a minimal CDK control network. Nature 468, 1074-1079.
Cross, F. (1995a). Transcriptional regulation by a cyclin-cdk. Trends in genetics : TIG 11, 209-211.
Cross, F.R. (1988). DAF1, a mutant gene affecting size control, pheromone arrest, and cell cycle kinetics of Saccharomyces cerevisiae. Mol Cell Biol 8, 4675-4684.
Cross, F.R. (1990). Cell cycle arrest caused by CLN gene deficiency in Saccharomyces cerevisiae resembles START-I arrest and is independent of the mating-pheromone signalling pathway. Mol Cell Biol 10, 6482-6490.
244
Cross, F.R. (1995b). Starting the cell cycle: what's the point? Curr Opin Cell Biol 7, 790-797.
Cross, F.R., Archambault, V., Miller, M., and Klovstad, M. (2002). Testing a mathematical model of the yeast cell cycle. Mol Biol Cell 13, 52-70.
Cross, F.R., and Jacobson, M.D. (2000). Conservation and function of a potential substrate-binding domain in the yeast Clb5 B-type cyclin. Mol Cell Biol 20, 4782- 4790.
Cross, F.R., and Tinkelenberg, A.H. (1991). A potential positive feedback loop controlling CLN1 and CLN2 gene expression at the start of the yeast cell cycle. Cell 65, 875-883.
Cross, F.R., Yuste-Rojas, M., Gray, S., and Jacobson, M.D. (1999). Specialization and targeting of B-type cyclins. Mol Cell 4, 11-19.
Culotti, J., and Hartwell, L.H. (1971). Genetic control of the cell division cycle in yeast. 3. Seven genes controlling nuclear division. Experimental cell research 67, 389-401.
Cvrckova, F., and Nasmyth, K. (1993). Yeast G1 cyclins CLN1 and CLN2 and a GAP-like protein have a role in bud formation. EMBO J 12, 5277-5286.
De Bondt, H.L., Rosenblatt, J., Jancarik, J., Jones, H.D., Morgant, D.O., and Kim, S.-H. (1993). Crystal structure of cyclin-dependent kinase 2. Nature 363, 595- 602. de Bruin, R.A., McDonald, W.H., Kalashnikova, T.I., Yates, J., 3rd, and Wittenberg, C. (2004). Cln3 activates G1-specific transcription via phosphorylation of the SBF bound repressor Whi5. Cell 117, 887-898.
Deibler, R.W., and Kirschner, M.W. (2010). Quantitative reconstitution of mitotic CDK1 activation in somatic cell extracts. Mol Cell 37, 753-767.
Deshaies, R.J., Chau, V., and Kirschner, M. (1995). Ubiquitination of the G1 cyclin Cln2p by a Cdc34p-dependent pathway. EMBO J 14, 303-312.
Di Talia, S., Skotheim, J.M., Bean, J.M., Siggia, E.D., and Cross, F.R. (2007). The effects of molecular noise and size control on variability in the budding yeast cell cycle. Nature 448, 947-951.
Diehl, J.A., and Sherr, C.J. (1997). A dominant-negative cyclin D1 mutant prevents nuclear import of cyclin-dependent kinase 4 (CDK4) and its phosphorylation by CDK-activating kinase. Mol Cell Biol 17, 7362-7374.
245
Dirick, L., Bohm, T., and Nasmyth, K. (1995). Roles and regulation of Cln-Cdc28 kinases at the start of the cell cycle of Saccharomyces cerevisiae. EMBO J 14, 4803-4813.
Dirick, L., and Nasmyth, K. (1991). Positive feedback in the activation of G1 cyclins in yeast. Nature 351, 754-757.
Dohlman, H.G., and Thorner, J.W. (2001). Regulation of G protein-initiated signal transduction in yeast: paradigms and principles. Annu Rev Biochem 70, 703-754.
Doncic, A., Falleur-Fettig, M., and Skotheim, J.M. (2011). Distinct interactions select and maintain a specific cell fate. Mol Cell 43, 528-539.
Doncic, A., and Skotheim, J.M. (2013). Feedforward regulation ensures stability and rapid reversibility of a cellular state. Mol Cell 50, 856-868.
Dowdy, S.F., Hinds, P.W., Louie, K., Reed, S.I., Arnold, A., and Weinberg, R.A. (1993). Physical interaction of the retinoblastoma protein with human D cyclins. Cell 73, 499-511.
Draviam, V.M., Orrechia, S., Lowe, M., Pardi, R., and Pines, J. (2001). The localization of human cyclins B1 and B2 determines CDK1 substrate specificity and neither enzyme requires MEK to disassemble the Golgi apparatus. The Journal of cell biology 152, 945-958.
Edgington, N.P., and Futcher, B. (2001). Relationship between the function and the location of G1 cyclins in S. cerevisiae. Journal of cell science 114, 4599- 4611.
Ekholm, S.V., Zickert, P., Reed, S.I., and Zetterberg, A. (2001). Accumulation of cyclin E is not a prerequisite for passage through the restriction point. Mol Cell Biol 21, 3256-3265. el-Deiry, W.S., Harper, J.W., O'Connor, P.M., Velculescu, V.E., Canman, C.E., Jackman, J., Pietenpol, J.A., Burrell, M., Hill, D.E., Wang, Y., et al. (1994). WAF1/CIP1 is induced in p53-mediated G1 arrest and apoptosis. Cancer research 54, 1169-1174.
Elsasser, S., Lou, F., Wang, B., Campbell, J.L., and Jong, A. (1996). Interaction between yeast Cdc6 protein and B-type cyclin/Cdc28 kinases. Mol Biol Cell 7, 1723-1735.
Enserink, J.M., and Kolodner, R.D. (2010). An overview of Cdk1-controlled targets and processes. Cell Div 5, 11.
246
Epstein, C.B., and Cross, F.R. (1992). CLB5: a novel B cyclin from budding yeast with a role in S phase. Genes Dev 6, 1695-1706.
Errico, A., Deshmukh, K., Tanaka, Y., Pozniakovsky, A., and Hunt, T. (2010). Identification of substrates for cyclin dependent kinases. Advances in enzyme regulation 50, 375-399.
Eser, U., Falleur-Fettig, M., Johnson, A., and Skotheim, J.M. (2011). Commitment to a cellular transition precedes genome-wide transcriptional change. Mol Cell 43, 515-527.
Espinoza, F.H., Farrell, A., Erdjument-Bromage, H., Tempst, P., and Morgan, D.O. (1996). A cyclin-dependent kinase-activating kinase (CAK) in budding yeast unrelated to vertebrate CAK. Science 273, 1714-1717.
Evans, T., Rosenthal, E.T., Youngblom, J., Distel, D., and Hunt, T. (1983). Cyclin: a protein specified by maternal mRNA in sea urchin eggs that is destroyed at each cleavage division. Cell 33, 389-396.
Feldman, R.M., Correll, C.C., Kaplan, K.B., and Deshaies, R.J. (1997). A complex of Cdc4p, Skp1p, and Cdc53p/cullin catalyzes ubiquitination of the phosphorylated CDK inhibitor Sic1p. Cell 91, 221-230.
Ferrell, J.E., Jr. Feedback regulation of opposing enzymes generates robust, all- or-none bistable responses. Current Biology 18, R244-R245.
Ferrell, J.E., Jr., and Machleder, E.M. (1998). The biochemical basis of an all-or- none cell fate switch in Xenopus oocytes. Science 280, 895-898.
Ferrezuelo, F., Colomina, N., Palmisano, A., Gari, E., Gallego, C., Csikasz-Nagy, A., and Aldea, M. (2012). The critical size is set at a single-cell level by growth rate to attain homeostasis and adaptation. Nat Commun 3, 1012.
Fisher, D., Krasinska, L., Coudreuse, D., and Novak, B. (2012). Phosphorylation network dynamics in the control of cell cycle transitions. Journal of cell science 125, 4703-4711.
Fisher, D.L., and Nurse, P. (1996). A single fission yeast mitotic cyclin B p34cdc2 kinase promotes both S-phase and mitosis in the absence of G1 cyclins. EMBO J 15, 850-860.
Fitch, I., Dahmann, C., Surana, U., Amon, A., Nasmyth, K., Goetsch, L., Byers, B., and Futcher, B. (1992). Characterization of four B-type cyclin genes of the budding yeast Saccharomyces cerevisiae. Mol Biol Cell 3, 805-818.
247
Forsburg, S.L., and Nurse, P. (1991). Identification of a G1-type cyclin puc1+ in the fission yeast Schizosaccharomyces pombe. Nature 351, 245-248.
Futcher, B. (2002). Transcriptional regulatory networks and the yeast cell cycle. Curr Opin Cell Biol 14, 676-683.
Gartner, A., Jovanovic, A., Jeoung, D.I., Bourlat, S., Cross, F.R., and Ammerer, G. (1998). Pheromone-dependent G1 cell cycle arrest requires Far1 phosphorylation, but may not involve inhibition of Cdc28-Cln2 kinase, in vivo. Mol Cell Biol 18, 3681-3691.
Gavet, O., and Pines, J. (2010). Activation of cyclin B1-Cdk1 synchronizes events in the nucleus and the cytoplasm at mitosis. The Journal of cell biology 189, 247-259.
Geng, Y., Whoriskey, W., Park, M.Y., Bronson, R.T., Medema, R.H., Li, T., Weinberg, R.A., and Sicinski, P. (1999). Rescue of cyclin D1 deficiency by knockin cyclin E. Cell 97, 767-777.
Geng, Y., Yu, Q., Sicinska, E., Das, M., Schneider, J.E., Bhattacharya, S., Rideout, W.M., Bronson, R.T., Gardner, H., and Sicinski, P. (2003). Cyclin E ablation in the mouse. Cell 114, 431-443.
Gladfelter, A.S., Hungerbuehler, A.K., and Philippsen, P. (2006). Asynchronous nuclear division cycles in multinucleated cells. The Journal of cell biology 172, 347-362.
Glotzer, M., Murray, A.W., and Kirschner, M.W. (1991). Cyclin is degraded by the ubiquitin pathway. Nature 349, 132-138.
Goranov, A.I., Cook, M., Ricicova, M., Ben-Ari, G., Gonzalez, C., Hansen, C., Tyers, M., and Amon, A. (2009). The rate of cell growth is governed by cell cycle stage. Genes Dev 23, 1408-1422.
Gould, K.L., and Nurse, P. (1989). Tyrosine phosphorylation of the fission yeast cdc2+ protein kinase regulates entry into mitosis. Nature 342, 39-45.
Gross, T., Lutzelberger, M., Weigmann, H., Klingenhoff, A., Shenoy, S., and Kaufer, N.F. (1997). Functional analysis of the fission yeast Prp4 protein kinase involved in pre-mRNA splicing and isolation of a putative mammalian homologue. Nucleic Acids Res 25, 1028-1035.
Guan, K.L., Jenkins, C.W., Li, Y., Nichols, M.A., Wu, X., O'Keefe, C.L., Matera, A.G., and Xiong, Y. (1994). Growth suppression by p18, a p16INK4/MTS1- and
248
p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function. Genes Dev 8, 2939-2952.
Gulli, M.P., Jaquenoud, M., Shimada, Y., Niederhauser, G., Wiget, P., and Peter, M. (2000). Phosphorylation of the Cdc42 exchange factor Cdc24 by the PAK-like kinase Cla4 may regulate polarized growth in yeast. Mol Cell 6, 1155-1167.
Haase, S.B., and Reed, S.I. (1999). Evidence that a free-running oscillator drives G1 events in the budding yeast cell cycle. Nature 401, 394-397.
Hagan, I., Hayles, J., and Nurse, P. (1988). Cloning and sequencing of the cyclin-related cdc13+ gene and a cytological study of its role in fission yeast mitosis. Journal of cell science 91 ( Pt 4), 587-595.
Hagting, A., Karlsson, C., Clute, P., Jackman, M., and Pines, J. (1998). MPF localization is controlled by nuclear export. EMBO J 17, 4127-4138.
Hahn, S., Maurer, P., Caesar, S., and Schlenstedt, G. (2008). Classical NLS proteins from Saccharomyces cerevisiae. J Mol Biol 379, 678-694.
Hannon, G.J., and Beach, D. (1994). p15INK4B is a potential effector of TGF- beta-induced cell cycle arrest. Nature 371, 257-261.
Harper, J.W., Adami, G.R., Wei, N., Keyomarsi, K., and Elledge, S.J. (1993). The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases. Cell 75, 805-816.
Harper, J.W., Elledge, S.J., Keyomarsi, K., Dynlacht, B., Tsai, L.H., Zhang, P., Dobrowolski, S., Bai, C., Connell-Crowley, L., Swindell, E., et al. (1995). Inhibition of cyclin-dependent kinases by p21. Mol Biol Cell 6, 387-400.
Hartwell, L.H. (1974). Saccharomyces cerevisiae cell cycle. Bacteriological reviews 38, 164-198.
Hartwell, L.H., Culotti, J., Pringle, J.R., and Reid, B.J. (1974). Genetic control of the cell division cycle in yeast. Science 183, 46-51.
Hartwell, L.H., Mortimer, R.K., Culotti, J., and Culotti, M. (1973). Genetic Control of the Cell Division Cycle in Yeast: V. Genetic Analysis of cdc Mutants. Genetics 74, 267-286.
Harvey, S.L., Charlet, A., Haas, W., Gygi, S.P., and Kellogg, D.R. (2005). Cdk1- dependent regulation of the mitotic inhibitor Wee1. Cell 122, 407-420.
Hasan, M.M., Brocca, S., Sacco, E., Spinelli, M., Papaleo, E., Lambrughi, M., Alberghina, L., and Vanoni, M. (2013). A comparative study of Whi5 and
249
retinoblastoma proteins: from sequence and structure analysis to intracellular networks. Frontiers in physiology 4, 315.
Hellborg, L., Woolfit, M., Arthursson-Hellborg, M., and Piskur, J. (2008). Complex evolution of the DAL5 transporter family. BMC genomics 9, 164.
Henchoz, S., Chi, Y., Catarin, B., Herskowitz, I., Deshaies, R.J., and Peter, M. (1997). Phosphorylation- and ubiquitin-dependent degradation of the cyclin- dependent kinase inhibitor Far1p in budding yeast. Genes Dev 11, 3046-3060.
Hirai, H., Roussel, M.F., Kato, J.Y., Ashmun, R.A., and Sherr, C.J. (1995). Novel INK4 proteins, p19 and p18, are specific inhibitors of the cyclin D-dependent kinases CDK4 and CDK6. Mol Cell Biol 15, 2672-2681.
Hirschi, A., Cecchini, M., Steinhardt, R.C., Schamber, M.R., Dick, F.A., and Rubin, S.M. (2010). An overlapping kinase and phosphatase docking site regulates activity of the retinoblastoma protein. Nat Struct Mol Biol 17, 1051- 1057.
Holly, S.P., and Blumer, K.J. (1999). PAK-family kinases regulate cell and actin polarization throughout the cell cycle of Saccharomyces cerevisiae. The Journal of cell biology 147, 845-856.
Holt, L.J., Tuch, B.B., Villen, J., Johnson, A.D., Gygi, S.P., and Morgan, D.O. (2009). Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution. Science 325, 1682-1686.
Hood, J.K., Hwang, W.W., and Silver, P.A. (2001). The Saccharomyces cerevisiae cyclin Clb2p is targeted to multiple subcellular locations by cis- and trans-acting determinants. Journal of cell science 114, 589-597.
Hu, F., and Aparicio, O.M. (2005). Swe1 regulation and transcriptional control restrict the activity of mitotic cyclins toward replication proteins in Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences of the United States of America 102, 8910-8915.
Hu, F., Gan, Y., and Aparicio, O.M. (2008). Identification of Clb2 residues required for Swe1 regulation of Clb2-Cdc28 in Saccharomyces cerevisiae. Genetics 179, 863-874.
Hungerbuehler, A.K., Philippsen, P., and Gladfelter, A.S. (2007). Limited functional redundancy and oscillation of cyclins in multinucleated Ashbya gossypii fungal cells. Eukaryot Cell 6, 473-486.
250
Jackson, L.P., Reed, S.I., and Haase, S.B. (2006). Distinct mechanisms control the stability of the related S-phase cyclins Clb5 and Clb6. Mol Cell Biol 26, 2456- 2466.
Jacobson, M.D., Gray, S., Yuste-Rojas, M., and Cross, F.R. (2000). Testing cyclin specificity in the exit from mitosis. Mol Cell Biol 20, 4483-4493.
Jaspersen, S.L., Charles, J.F., and Morgan, D.O. (1999). Inhibitory phosphorylation of the APC regulator Hct1 is controlled by the kinase Cdc28 and the phosphatase Cdc14. Curr Biol 9, 227-236.
Jeffrey, P.D., Russo, A.A., Polyak, K., Gibbs, E., Hurwitz, J., Massague, J., and Pavletich, N.P. (1995). Mechanism of CDK activation revealed by the structure of a cyclinA-CDK2 complex. Nature 376, 313-320.
Jeoung, D.I., Oehlen, L.J., and Cross, F.R. (1998). Cln3-associated kinase activity in Saccharomyces cerevisiae is regulated by the mating factor pathway. Mol Cell Biol 18, 433-441.
Johnson, A., and Skotheim, J.M. (2013). Start and the restriction point. Curr Opin Cell Biol 25, 717-723.
Johnston, G.C., Pringle, J.R., and Hartwell, L.H. (1977). Coordination of growth with cell division in the yeast Saccharomyces cerevisiae. Experimental cell research 105, 79-98.
Jorgensen, P., and Tyers, M. (2004). How cells coordinate growth and division. Curr Biol 14, R1014-1027.
Kalaszczynska, I., Geng, Y., Iino, T., Mizuno, S., Choi, Y., Kondratiuk, I., Silver, D.P., Wolgemuth, D.J., Akashi, K., and Sicinski, P. (2009). Cyclin A is redundant in fibroblasts but essential in hematopoietic and embryonic stem cells. Cell 138, 352-365.
Kato, J.Y., and Sherr, C.J. (1993). Inhibition of granulocyte differentiation by G1 cyclins D2 and D3 but not D1. Proceedings of the National Academy of Sciences of the United States of America 90, 11513-11517.
Keaton, M.A., Bardes, E.S., Marquitz, A.R., Freel, C.D., Zyla, T.R., Rudolph, J., and Lew, D.J. (2007). Differential susceptibility of yeast S and M phase CDK complexes to inhibitory tyrosine phosphorylation. Curr Biol 17, 1181-1189.
Kelly, B.L., Wolfe, K.G., and Roberts, J.M. (1998). Identification of a substrate- targeting domain in cyclin E necessary for phosphorylation of the retinoblastoma
251
protein. Proceedings of the National Academy of Sciences of the United States of America 95, 2535-2540.
Kipreos, E.T., Lander, L.E., Wing, J.P., He, W.W., and Hedgecock, E.M. (1996). cul-1 is required for cell cycle exit in C. elegans and identifies a novel gene family. Cell 85, 829-839.
Knaus, M., Pelli-Gulli, M.P., van Drogen, F., Springer, S., Jaquenoud, M., and Peter, M. (2007). Phosphorylation of Bem2p and Bem3p may contribute to local activation of Cdc42p at bud emergence. EMBO J 26, 4501-4513.
Knoblich, J.A., Sauer, K., Jones, L., Richardson, H., Saint, R., and Lehner, C.F. (1994). Cyclin E controls S phase progression and its down-regulation during Drosophila embryogenesis is required for the arrest of cell proliferation. Cell 77, 107-120.
Kobayashi, H., Stewart, E., Poon, R., Adamczewski, J.P., Gannon, J., and Hunt, T. (1992). Identification of the domains in cyclin A required for binding to, and activation of, p34cdc2 and p32cdk2 protein kinase subunits. Mol Biol Cell 3, 1279-1294.
Kobayashi, H., Stewart, E., Poon, R.Y., and Hunt, T. (1994). Cyclin A and cyclin B dissociate from p34cdc2 with half-times of 4 and 15 h, respectively, regardless of the phase of the cell cycle. The Journal of biological chemistry 269, 29153- 29160.
Koch, C., and Nasmyth, K. (1994). Cell cycle regulated transcription in yeast. Curr Opin Cell Biol 6, 451-459.
Koepp, D.M., Harper, J.W., and Elledge, S.J. (1999). How the cyclin became a cyclin: regulated proteolysis in the cell cycle. Cell 97, 431-434.
Koivomagi, M., Ord, M., Iofik, A., Valk, E., Venta, R., Faustova, I., Kivi, R., Balog, E.R., Rubin, S.M., and Loog, M. (2013). Multisite phosphorylation networks as signal processors for Cdk1. Nat Struct Mol Biol 20, 1415-1424.
Koivomagi, M., Valk, E., Venta, R., Iofik, A., Lepiku, M., Balog, E.R., Rubin, S.M., Morgan, D.O., and Loog, M. (2011a). Cascades of multisite phosphorylation control Sic1 destruction at the onset of S phase. Nature 480, 128-131.
Koivomagi, M., Valk, E., Venta, R., Iofik, A., Lepiku, M., Morgan, D.O., and Loog, M. (2011b). Dynamics of Cdk1 Substrate Specificity during the Cell Cycle. Mol Cell 42, 610-623.
252
Kono, K., Nogami, S., Abe, M., Nishizawa, M., Morishita, S., Pellman, D., and Ohya, Y. (2008). G1/S cyclin-dependent kinase regulates small GTPase Rho1p through phosphorylation of RhoGEF Tus1p in Saccharomyces cerevisiae. Mol Biol Cell 19, 1763-1771.
Kozar, K., Ciemerych, M.A., Rebel, V.I., Shigematsu, H., Zagozdzon, A., Sicinska, E., Geng, Y., Yu, Q., Bhattacharya, S., Bronson, R.T., et al. (2004). Mouse development and cell proliferation in the absence of D-cyclins. Cell 118, 477-491.
Kramer, E.R., Scheuringer, N., Podtelejnikov, A.V., Mann, M., and Peters, J.M. (2000). Mitotic regulation of the APC activator proteins CDC20 and CDH1. Mol Biol Cell 11, 1555-1569.
Lamson, R.E., Winters, M.J., and Pryciak, P.M. (2002). Cdc42 regulation of kinase activity and signaling by the yeast p21-activated kinase Ste20. Mol Cell Biol 22, 2939-2951.
Landry, B.D., Doyle, J.P., Toczyski, D.P., and Benanti, J.A. (2012). F-box protein specificity for g1 cyclins is dictated by subcellular localization. PLoS Genet 8, e1002851.
Langan, T.A., Gautier, J., Lohka, M., Hollingsworth, R., Moreno, S., Nurse, P., Maller, J., and Sclafani, R.A. (1989). Mammalian growth-associated H1 histone kinase: a homolog of cdc2+/CDC28 protein kinases controlling mitotic entry in yeast and frog cells. Mol Cell Biol 9, 3860-3868.
Lanker, S., Valdivieso, M.H., and Wittenberg, C. (1996). Rapid degradation of the G1 cyclin Cln2 induced by CDK-dependent phosphorylation. Science 271, 1597- 1601.
Leberer, E., Wu, C., Leeuw, T., Fourest-Lieuvin, A., Segall, J.E., and Thomas, D.Y. (1997). Functional characterization of the Cdc42p binding domain of yeast Ste20p protein kinase. EMBO J 16, 83-97.
Lee, M.J., and Dohlman, H.G. (2008). Coactivation of G protein signaling by cell- surface receptors and an intracellular exchange factor. Curr Biol 18, 211-215.
Lengronne, A., and Schwob, E. (2002). The yeast CDK inhibitor Sic1 prevents genomic instability by promoting replication origin licensing in late G(1). Mol Cell 9, 1067-1078.
Levine, K., Huang, K., and Cross, F.R. (1996). Saccharomyces cerevisiae G1 cyclins differ in their intrinsic functional specificities. Mol Cell Biol 16, 6794-6803.
253
Lew, D.J., and Reed, S.I. (1993). Morphogenesis in the yeast cell cycle: regulation by Cdc28 and cyclins. The Journal of cell biology 120, 1305-1320.
Lim, W.A. (2010). Designing customized cell signalling circuits. Nat Rev Mol Cell Biol 11, 393-403.
Liu, D., Matzuk, M.M., Sung, W.K., Guo, Q., Wang, P., and Wolgemuth, D.J. (1998). Cyclin A1 is required for meiosis in the male mouse. Nature genetics 20, 377-380.
Loeb, J.D., Sepulveda-Becerra, M., Hazan, I., and Liu, H. (1999). A G1 cyclin is necessary for maintenance of filamentous growth in Candida albicans. Mol Cell Biol 19, 4019-4027.
Longtine, M.S., McKenzie, A., 3rd, Demarini, D.J., Shah, N.G., Wach, A., Brachat, A., Philippsen, P., and Pringle, J.R. (1998). Additional modules for versatile and economical PCR-based gene deletion and modification in Saccharomyces cerevisiae. Yeast 14, 953-961.
Loog, M., and Morgan, D.O. (2005). Cyclin specificity in the phosphorylation of cyclin-dependent kinase substrates. Nature 434, 104-108.
Lowe, E.D., Tews, I., Cheng, K.Y., Brown, N.R., Gul, S., Noble, M.E., Gamblin, S.J., and Johnson, L.N. (2002). Specificity determinants of recruitment peptides bound to phospho-CDK2/cyclin A. Biochemistry 41, 15625-15634.
Lu, L.X., Domingo-Sananes, M.R., Huzarska, M., Novak, B., and Gould, K.L. (2012). Multisite phosphoregulation of Cdc25 activity refines the mitotic entrance and exit switches. Proceedings of the National Academy of Sciences of the United States of America 109, 9899-9904.
Lukas, J., Pagano, M., Staskova, Z., Draetta, G., and Bartek, J. (1994). Cyclin D1 protein oscillates and is essential for cell cycle progression in human tumour cell lines. Oncogene 9, 707-718.
Luo, Y., Hurwitz, J., and Massague, J. (1995). Cell-cycle inhibition by independent CDK and PCNA binding domains in p21Cip1. Nature 375, 159-161.
MacKay, V.L., Mai, B., Waters, L., and Breeden, L.L. (2001). Early cell cycle box- mediated transcription of CLN3 and SWI4 contributes to the proper timing of the G(1)-to-S transition in budding yeast. Mol Cell Biol 21, 4140-4148.
Malleshaiah, M.K., Shahrezaei, V., Swain, P.S., and Michnick, S.W. (2010). The scaffold protein Ste5 directly controls a switch-like mating decision in yeast. Nature 465, 101-105.
254
Maridor, G., Gallant, P., Golsteyn, R., and Nigg, E.A. (1993). Nuclear localization of vertebrate cyclin A correlates with its ability to form complexes with cdk catalytic subunits. Journal of cell science 106 ( Pt 2), 535-544.
Martin-Castellanos, C., Blanco, M.A., de Prada, J.M., and Moreno, S. (2000). The puc1 cyclin regulates the G1 phase of the fission yeast cell cycle in response to cell size. Mol Biol Cell 11, 543-554.
Martinsson, H.S., Starborg, M., Erlandsson, F., and Zetterberg, A. (2005). Single cell analysis of G1 check points-the relationship between the restriction point and phosphorylation of pRb. Experimental cell research 305, 383-391.
McCusker, D., Denison, C., Anderson, S., Egelhofer, T.A., Yates, J.R., 3rd, Gygi, S.P., and Kellogg, D.R. (2007). Cdk1 coordinates cell-surface growth with the cell cycle. Nat Cell Biol 9, 506-515.
McGrath, D.A., Balog, E.R., Koivomagi, M., Lucena, R., Mai, M.V., Hirschi, A., Kellogg, D.R., Loog, M., and Rubin, S.M. (2013). Cks confers specificity to phosphorylation-dependent CDK signaling pathways. Nat Struct Mol Biol 20, 1407-1414.
McInerny, C.J., Partridge, J.F., Mikesell, G.E., Creemer, D.P., and Breeden, L.L. (1997). A novel Mcm1-dependent element in the SWI4, CLN3, CDC6, and CDC47 promoters activates M/G1-specific transcription. Genes Dev 11, 1277- 1288.
McKinney, J.D., Chang, F., Heintz, N., and Cross, F.R. (1993). Negative regulation of FAR1 at the Start of the yeast cell cycle. Genes Dev 7, 833-843.
Mendenhall, M.D., and Hodge, A.E. (1998). Regulation of Cdc28 cyclin- dependent protein kinase activity during the cell cycle of the yeast Saccharomyces cerevisiae. Microbiology and molecular biology reviews : MMBR 62, 1191-1243.
Mendenhall, M.D., Jones, C.A., and Reed, S.I. (1987). Dual regulation of the yeast CDC28-p40 protein kinase complex: cell cycle, pheromone, and nutrient limitation effects. Cell 50, 927-935.
Miller, M.E., and Cross, F.R. (2000). Distinct subcellular localization patterns contribute to functional specificity of the Cln2 and Cln3 cyclins of Saccharomyces cerevisiae. Mol Cell Biol 20, 542-555.
Miller, M.E., and Cross, F.R. (2001a). Cyclin specificity: how many wheels do you need on a unicycle? Journal of cell science 114, 1811-1820.
255
Miller, M.E., and Cross, F.R. (2001b). Mechanisms controlling subcellular localization of the G(1) cyclins Cln2p and Cln3p in budding yeast. Mol Cell Biol 21, 6292-6311.
Miller, M.E., Cross, F.R., Groeger, A.L., and Jameson, K.L. (2005). Identification of novel and conserved functional and structural elements of the G1 cyclin Cln3 important for interactions with the CDK Cdc28 in Saccharomyces cerevisiae. Yeast 22, 1021-1036.
Moffat, J., and Andrews, B. (2004). Late-G1 cyclin-CDK activity is essential for control of cell morphogenesis in budding yeast. Nat Cell Biol 6, 59-66.
Mok, J., Kim, P.M., Lam, H.Y., Piccirillo, S., Zhou, X., Jeschke, G.R., Sheridan, D.L., Parker, S.A., Desai, V., Jwa, M., et al. (2010). Deciphering protein kinase specificity through large-scale analysis of yeast phosphorylation site motifs. Sci Signal 3, ra12.
Moore, S.A. (1983). Comparison of dose-response curves for alpha factor- induced cell division arrest, agglutination, and projection formation of yeast cells. Implication for the mechanism of alpha factor action. The Journal of biological chemistry 258, 13849-13856.
Morgan, D.O. (1995). Principles of CDK regulation. Nature 374, 131-134.
Morgan, D.O. (1996). Under arrest at atomic resolution. Nature 382, 295-296.
Morgan, D.O. (1997). Cyclin-dependent kinases: engines, clocks, and microprocessors. Annual review of cell and developmental biology 13, 261-291.
Morgan, D.O. (1999). Regulation of the APC and the exit from mitosis. Nat Cell Biol 1, E47-E53.
Morgan, D.O. (2007). The Cell Cycle: Principles of Control (London: New Science Press).
Moses, A.M., Heriche, J.K., and Durbin, R. (2007a). Clustering of phosphorylation site recognition motifs can be exploited to predict the targets of cyclin-dependent kinase. Genome biology 8, R23.
Moses, A.M., Liku, M.E., Li, J.J., and Durbin, R. (2007b). Regulatory evolution in proteins by turnover and lineage-specific changes of cyclin-dependent kinase consensus sites. Proceedings of the National Academy of Sciences of the United States of America 104, 17713-17718.
256
Mumberg, D., Muller, R., and Funk, M. (1995). Yeast vectors for the controlled expression of heterologous proteins in different genetic backgrounds. Gene 156, 119-122.
Murphy, M., Stinnakre, M.G., Senamaud-Beaufort, C., Winston, N.J., Sweeney, C., Kubelka, M., Carrington, M., Brechot, C., and Sobczak-Thepot, J. (1997). Delayed early embryonic lethality following disruption of the murine cyclin A2 gene. Nature genetics 15, 83-86.
Murray, A. (1995). Cyclin ubiquitination: the destructive end of mitosis. Cell 81, 149-152.
Murray, A.W. (2004). Recycling the cell cycle: cyclins revisited. Cell 116, 221- 234.
Murray, A.W., and Kirschner, M.W. (1989). Cyclin synthesis drives the early embryonic cell cycle. Nature 339, 275-280.
Nakanishi, M., Robetorye, R.S., Adami, G.R., Pereira-Smith, O.M., and Smith, J.R. (1995). Identification of the active region of the DNA synthesis inhibitory gene p21Sdi1/CIP1/WAF1. EMBO J 14, 555-563.
Narasimha, A.M., Kaulich, M., Shapiro, G.S., Choi, Y.J., Sicinski, P., and Dowdy, S.F. (2014). Cyclin D activates the Rb tumor suppressor by mono- phosphorylation. Elife, e02872.
Nash, P., Tang, X., Orlicky, S., Chen, Q., Gertler, F.B., Mendenhall, M.D., Sicheri, F., Pawson, T., and Tyers, M. (2001). Multisite phosphorylation of a CDK inhibitor sets a threshold for the onset of DNA replication. Nature 414, 514-521.
Nash, R., Tokiwa, G., Anand, S., Erickson, K., and Futcher, A.B. (1988). The WHI1+ gene of Saccharomyces cerevisiae tethers cell division to cell size and is a cyclin homolog. EMBO J 7, 4335-4346.
Nasmyth, K. (1993). Control of the yeast cell cycle by the Cdc28 protein kinase. Curr Opin Cell Biol 5, 166-179.
Nasmyth, K. (1996). At the heart of the budding yeast cell cycle. Trends in genetics : TIG 12, 405-412.
Nasmyth, K., and Dirick, L. (1991). The role of SWI4 and SWI6 in the activity of G1 cyclins in yeast. Cell 66, 995-1013.
Nick Pace, C., Scholtz, J.M., and Grimsley, G.R. (2014). Forces stabilizing proteins. FEBS letters 588, 2177-2184.
257
Nigg, E.A. (1993a). Cellular substrates of p34(cdc2) and its companion cyclin- dependent kinases. Trends in cell biology 3, 296-301.
Nigg, E.A. (1993b). Targets of cyclin-dependent protein kinases. Curr Opin Cell Biol 5, 187-193.
Nigg, E.A. (1995). Cyclin-dependent protein kinases: key regulators of the eukaryotic cell cycle. BioEssays : news and reviews in molecular, cellular and developmental biology 17, 471-480.
Novak, B., Tyson, J.J., Gyorffy, B., and Csikasz-Nagy, A. (2007). Irreversible cell- cycle transitions are due to systems-level feedback. Nat Cell Biol 9, 724-728.
Oda, Y., Huang, K., Cross, F.R., Cowburn, D., and Chait, B.T. (1999). Accurate quantitation of protein expression and site-specific phosphorylation. Proceedings of the National Academy of Sciences of the United States of America 96, 6591- 6596.
Oehlen, L.J., and Cross, F.R. (1994). G1 cyclins CLN1 and CLN2 repress the mating factor response pathway at Start in the yeast cell cycle. Genes Dev 8, 1058-1070.
Oehlen, L.J., and Cross, F.R. (1998). Potential regulation of Ste20 function by the Cln1-Cdc28 and Cln2-Cdc28 cyclin-dependent protein kinases. The Journal of biological chemistry 273, 25089-25097.
Oehlen, L.J., Jeoung, D.I., and Cross, F.R. (1998). Cyclin-specific START events and the G1-phase specificity of arrest by mating factor in budding yeast. Molecular & general genetics : MGG 258, 183-198.
Ofir, A., and Kornitzer, D. (2010). Candida albicans cyclin Clb4 carries S-phase cyclin activity. Eukaryot Cell 9, 1311-1319.
Ohtsubo, M., Theodoras, A.M., Schumacher, J., Roberts, J.M., and Pagano, M. (1995). Human cyclin E, a nuclear protein essential for the G1-to-S phase transition. Mol Cell Biol 15, 2612-2624.
Oikonomou, C., and Cross, F.R. (2011). Rising cyclin-CDK levels order cell cycle events. PloS one 6, e20788.
Orlando, D.A., Lin, C.Y., Bernard, A., Wang, J.Y., Socolar, J.E., Iversen, E.S., Hartemink, A.J., and Haase, S.B. (2008). Global control of cell-cycle transcription by coupled CDK and network oscillators. Nature 453, 944-947.
258
Pascreau, G., Churchill, M.E., and Maller, J.L. (2011). Centrosomal localization of cyclins E and A: structural similarities and functional differences. Cell Cycle 10, 199-205.
Peter, M., Gartner, A., Horecka, J., Ammerer, G., and Herskowitz, I. (1993). FAR1 links the signal transduction pathway to the cell cycle machinery in yeast. Cell 73, 747-760.
Peter, M., and Herskowitz, I. (1994). Direct inhibition of the yeast cyclin- dependent kinase Cdc28-Cln by Far1. Science 265, 1228-1231.
Peter, M., Neiman, A.M., Park, H.O., van Lohuizen, M., and Herskowitz, I. (1996). Functional analysis of the interaction between the small GTP binding protein Cdc42 and the Ste20 protein kinase in yeast. EMBO J 15, 7046-7059.
Pines, J. (1995). Cyclins and cyclin-dependent kinases: theme and variations. Advances in cancer research 66, 181-212.
Pines, J. (1999). Cell cycle. Checkpoint on the nuclear frontier. Nature 397, 104- 105.
Pines, J., and Hunter, T. (1991). Human cyclins A and B1 are differentially located in the cell and undergo cell cycle-dependent nuclear transport. The Journal of cell biology 115, 1-17.
Polyak, K., Kato, J.Y., Solomon, M.J., Sherr, C.J., Massague, J., Roberts, J.M., and Koff, A. (1994a). p27Kip1, a cyclin-Cdk inhibitor, links transforming growth factor-beta and contact inhibition to cell cycle arrest. Genes Dev 8, 9-22.
Polyak, K., Lee, M.H., Erdjument-Bromage, H., Koff, A., Roberts, J.M., Tempst, P., and Massague, J. (1994b). Cloning of p27Kip1, a cyclin-dependent kinase inhibitor and a potential mediator of extracellular antimitogenic signals. Cell 78, 59-66.
Pope, P.A., Bhaduri, S., and Pryciak, P.M. (2014). Regulation of cyclin-substrate docking by a G1 arrest signaling pathway and the Cdk inhibitor Far1. Curr Biol 24, 1390-1396.
Pope, P.A., and Pryciak, P.M. (2013). Functional overlap among distinct G1/S inhibitory pathways allows robust G1 arrest by yeast mating pheromones. Mol Biol Cell 24, 3675-3688.
Potapova, T.A., Sivakumar, S., Flynn, J.N., Li, R., and Gorbsky, G.J. (2011). Mitotic progression becomes irreversible in prometaphase and collapses when Wee1 and Cdc25 are inhibited. Molecular Biology of the Cell 22, 1191-1206.
259
Pryciak, P.M. (2009). Designing new cellular signaling pathways. Chem Biol 16, 249-254.
Pryciak, P.M., and Huntress, F.A. (1998). Membrane recruitment of the kinase cascade scaffold protein Ste5 by the Gbetagamma complex underlies activation of the yeast pheromone response pathway. Genes Dev 12, 2684-2697.
Queralt, E., and Igual, J.C. (2004). Functional distinction between Cln1p and Cln2p cyclins in the control of the Saccharomyces cerevisiae mitotic cycle. Genetics 168, 129-140.
Remenyi, A., Good, M.C., Bhattacharyya, R.P., and Lim, W.A. (2005). The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network. Mol Cell 20, 951-962.
Reynolds, D., Shi, B.J., McLean, C., Katsis, F., Kemp, B., and Dalton, S. (2003). Recruitment of Thr 319-phosphorylated Ndd1p to the FHA domain of Fkh2p requires Clb kinase activity: a mechanism for CLB cluster gene activation. Genes Dev 17, 1789-1802.
Richardson, H.E., Wittenberg, C., Cross, F., and Reed, S.I. (1989). An essential G1 function for cyclin-like proteins in yeast. Cell 59, 1127-1133.
Roberts, J.M. (1999). Evolving ideas about cyclins. Cell 98, 129-132.
Ross, K.E., Kaldis, P., and Solomon, M.J. (2000). Activating phosphorylation of the Saccharomyces cerevisiae cyclin-dependent kinase, cdc28p, precedes cyclin binding. Mol Biol Cell 11, 1597-1609.
Rothstein, R. (1991). Targeting, disruption, replacement, and allele rescue: integrative DNA transformation in yeast. Methods Enzymol 194, 281-301.
Roy, A., Kucukural, A., and Zhang, Y. (2010). I-TASSER: a unified platform for automated protein structure and function prediction. Nat Protoc 5, 725-738.
Rudner, A.D., Hardwick, K.G., and Murray, A.W. (2000). Cdc28 activates exit from mitosis in budding yeast. The Journal of cell biology 149, 1361-1376.
Russo, A.A., Jeffrey, P.D., Patten, A.K., Massague, J., and Pavletich, N.P. (1996). Crystal structure of the p27Kip1 cyclin-dependent-kinase inhibitor bound to the cyclin A-Cdk2 complex. Nature 382, 325-331.
Russo, A.A., Tong, L., Lee, J.O., Jeffrey, P.D., and Pavletich, N.P. (1998). Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a. Nature 395, 237-243.
260
Salama, S.R., Hendricks, K.B., and Thorner, J. (1994). G1 cyclin degradation: the PEST motif of yeast Cln2 is necessary, but not sufficient, for rapid protein turnover. Mol Cell Biol 14, 7953-7966.
Salazar, C., Brummer, A., Alberghina, L., and Hofer, T. (2010). Timing control in regulatory networks by multisite protein modifications. Trends in cell biology 20, 634-641.
Satyanarayana, A., Hilton, M.B., and Kaldis, P. (2008). p21 Inhibits Cdk1 in the absence of Cdk2 to maintain the G1/S phase DNA damage checkpoint. Mol Biol Cell 19, 65-77.
Schneider, B.L., Patton, E.E., Lanker, S., Mendenhall, M.D., Wittenberg, C., Futcher, B., and Tyers, M. (1998). Yeast G1 cyclins are unstable in G1 phase. Nature 395, 86-89.
Schulman, B.A., Lindstrom, D.L., and Harlow, E. (1998). Substrate recruitment to cyclin-dependent kinase 2 by a multipurpose docking site on cyclin A. Proceedings of the National Academy of Sciences of the United States of America 95, 10453-10458.
Schwob, E., Bohm, T., Mendenhall, M.D., and Nasmyth, K. (1994). The B-type cyclin kinase inhibitor p40SIC1 controls the G1 to S transition in S. cerevisiae. Cell 79, 233-244.
Schwob, E., and Nasmyth, K. (1993). CLB5 and CLB6, a new pair of B cyclins involved in DNA replication in Saccharomyces cerevisiae. Genes Dev 7, 1160- 1175.
Sedgwick, C., Rawluk, M., Decesare, J., Raithatha, S., Wohlschlegel, J., Semchuk, P., Ellison, M., Yates, J., 3rd, and Stuart, D. (2006). Saccharomyces cerevisiae Ime2 phosphorylates Sic1 at multiple PXS/T sites but is insufficient to trigger Sic1 degradation. The Biochemical journal 399, 151-160.
Serrano, M., Hannon, G.J., and Beach, D. (1993). A new regulatory motif in cell- cycle control causing specific inhibition of cyclin D/CDK4. Nature 366, 704-707.
Sherman, F. (2002). Getting started with yeast. Methods Enzymol 350, 3-41.
Sherr, C.J., and Roberts, J.M. (1999). CDK inhibitors: positive and negative regulators of G1-phase progression. Genes Dev 13, 1501-1512.
Shirayama, M., Toth, A., Galova, M., and Nasmyth, K. (1999). APC(Cdc20) promotes exit from mitosis by destroying the anaphase inhibitor Pds1 and cyclin Clb5. Nature 402, 203-207.
261
Sievers, F., Wilm, A., Dineen, D., Gibson, T.J., Karplus, K., Li, W., Lopez, R., McWilliam, H., Remmert, M., Soding, J., et al. (2011). Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. Mol Syst Biol 7, 539.
Sikorski, R.S., and Hieter, P. (1989). A system of shuttle vectors and yeast host strains designed for efficient manipulation of DNA in Saccharomyces cerevisiae. Genetics 122, 19-27.
Sinha, I., Wang, Y.M., Philp, R., Li, C.R., Yap, W.H., and Wang, Y. (2007). Cyclin-dependent kinases control septin phosphorylation in Candida albicans hyphal development. Dev Cell 13, 421-432.
Skotheim, J.M., Di Talia, S., Siggia, E.D., and Cross, F.R. (2008). Positive feedback of G1 cyclins ensures coherent cell cycle entry. Nature 454, 291-296.
Skowyra, D., Craig, K.L., Tyers, M., Elledge, S.J., and Harper, J.W. (1997). F-box proteins are receptors that recruit phosphorylated substrates to the SCF ubiquitin-ligase complex. Cell 91, 209-219.
Skowyra, D., Koepp, D.M., Kamura, T., Conrad, M.N., Conaway, R.C., Conaway, J.W., Elledge, S.J., and Harper, J.W. (1999). Reconstitution of G1 cyclin ubiquitination with complexes containing SCFGrr1 and Rbx1. Science 284, 662- 665.
Sloat, B.F., Adams, A., and Pringle, J.R. (1981). Roles of the CDC24 gene product in cellular morphogenesis during the Saccharomyces cerevisiae cell cycle. The Journal of cell biology 89, 395-405.
Sloat, B.F., and Pringle, J.R. (1978). A mutant of yeast defective in cellular morphogenesis. Science 200, 1171-1173.
Songyang, Z., Blechner, S., Hoagland, N., Hoekstra, M.F., Piwnica-Worms, H., and Cantley, L.C. (1994). Use of an oriented peptide library to determine the optimal substrates of protein kinases. Curr Biol 4, 973-982.
Sopko, R., Huang, D., Smith, J.C., Figeys, D., and Andrews, B.J. (2007). Activation of the Cdc42p GTPase by cyclin-dependent protein kinases in budding yeast. EMBO J 26, 4487-4500.
Spellman, P.T., Sherlock, G., Zhang, M.Q., Iyer, V.R., Anders, K., Eisen, M.B., Brown, P.O., Botstein, D., and Futcher, B. (1998). Comprehensive identification of cell cycle-regulated genes of the yeast Saccharomyces cerevisiae by microarray hybridization. Mol Biol Cell 9, 3273-3297.
262
Stern, B., and Nurse, P. (1996). A quantitative model for the cdc2 control of S phase and mitosis in fission yeast. Trends in genetics : TIG 12, 345-350.
Stevenson-Lindert, L.M., Fowler, P., and Lew, J. (2003). Substrate specificity of CDK2-cyclin A. What is optimal? The Journal of biological chemistry 278, 50956- 50960.
Strickfaden, S.C., Winters, M.J., Ben-Ari, G., Lamson, R.E., Tyers, M., and Pryciak, P.M. (2007). A mechanism for cell-cycle regulation of MAP kinase signaling in a yeast differentiation pathway. Cell 128, 519-531.
Stuart, D., and Wittenberg, C. (1995). CLN3, not positive feedback, determines the timing of CLN2 transcription in cycling cells. Genes Dev 9, 2780-2794.
Takahashi, S., and Pryciak, P.M. (2007). Identification of novel membrane- binding domains in multiple yeast Cdc42 effectors. Mol Biol Cell 18, 4945-4956.
Takeda, D.Y., Wohlschlegel, J.A., and Dutta, A. (2001). A bipartite substrate recognition motif for cyclin-dependent kinases. The Journal of biological chemistry 276, 1993-1997.
Toyoshima, H., and Hunter, T. (1994). p27, a novel inhibitor of G1 cyclin-Cdk protein kinase activity, is related to p21. Cell 78, 67-74.
Trunnell, N.B., Poon, A.C., Kim, S.Y., and Ferrell Jr, J.E. (2011). Ultrasensitivity in the Regulation of Cdc25C by Cdk1. Molecular Cell 41, 263-274.
Turner, J.J., Ewald, J.C., and Skotheim, J.M. (2012). Cell size control in yeast. Curr Biol 22, R350-359.
Tyers, M. (1996). The cyclin-dependent kinase inhibitor p40SIC1 imposes the requirement for Cln G1 cyclin function at Start. Proceedings of the National Academy of Sciences of the United States of America 93, 7772-7776.
Tyers, M., and Futcher, B. (1993). Far1 and Fus3 link the mating pheromone signal transduction pathway to three G1-phase Cdc28 kinase complexes. Mol Cell Biol 13, 5659-5669.
Tyers, M., Tokiwa, G., and Futcher, B. (1993). Comparison of the Saccharomyces cerevisiae G1 cyclins: Cln3 may be an upstream activator of Cln1, Cln2 and other cyclins. EMBO J 12, 1955-1968.
Ubersax, J.A., and Ferrell, J.E., Jr. (2007). Mechanisms of specificity in protein phosphorylation. Nat Rev Mol Cell Biol 8, 530-541.
263
Ubersax, J.A., Woodbury, E.L., Quang, P.N., Paraz, M., Blethrow, J.D., Shah, K., Shokat, K.M., and Morgan, D.O. (2003). Targets of the cyclin-dependent kinase Cdk1. Nature 425, 859-864.
Uhlmann, F., Bouchoux, C., and Lopez-Aviles, S. (2011). A quantitative model for cyclin-dependent kinase control of the cell cycle: revisited. Philosophical transactions of the Royal Society of London Series B, Biological sciences 366, 3572-3583.
Valdivieso, M.H., Sugimoto, K., Jahng, K.Y., Fernandes, P.M., and Wittenberg, C. (1993). FAR1 is required for posttranscriptional regulation of CLN2 gene expression in response to mating pheromone. Mol Cell Biol 13, 1013-1022.
Venta, R., Valk, E., Koivomagi, M., and Loog, M. (2012). Double-negative feedback between S-phase cyclin-CDK and CKI generates abruptness in the G1/S switch. Frontiers in physiology 3, 459.
Verma, R., Feldman, R.M., and Deshaies, R.J. (1997). SIC1 is ubiquitinated in vitro by a pathway that requires CDC4, CDC34, and cyclin/CDK activities. Mol Biol Cell 8, 1427-1437.
Virtudazo, E.V., Kawamoto, S., Ohkusu, M., Aoki, S., Sipiczki, M., and Takeo, K. (2010). The single Cdk1-G1 cyclin of Cryptococcus neoformans is not essential for cell cycle progression, but plays important roles in the proper commitment to DNA synthesis and bud emergence in this yeast. FEMS yeast research 10, 605- 618.
Visintin, R., Prinz, S., and Amon, A. (1997). CDC20 and CDH1: a family of substrate-specific activators of APC-dependent proteolysis. Science 278, 460- 463.
Vodermaier, H.C. (2004). APC/C and SCF: controlling each other and the cell cycle. Curr Biol 14, R787-796.
Wagner, M.V., Smolka, M.B., de Bruin, R.A., Zhou, H., Wittenberg, C., and Dowdy, S.F. (2009). Whi5 regulation by site specific CDK-phosphorylation in Saccharomyces cerevisiae. PloS one 4, e4300.
Wai, S.C., Gerber, S.A., and Li, R. (2009). Multisite phosphorylation of the guanine nucleotide exchange factor Cdc24 during yeast cell polarization. PloS one 4, e6563.
Wang, Y. (2009). CDKs and the yeast-hyphal decision. Curr Opin Microbiol 12, 644-649.
264
Wasch, R., and Cross, F.R. (2002). APC-dependent proteolysis of the mitotic cyclin Clb2 is essential for mitotic exit. Nature 418, 556-562.
Wassmann, K., and Ammerer, G. (1997). Overexpression of the G1-cyclin gene CLN2 represses the mating pathway in Saccharomyces cerevisiae at the level of the MEKK Ste11. The Journal of biological chemistry 272, 13180-13188.
Welburn, J.P.I., Tucker, J.A., Johnson, T., Lindert, L., Morgan, M., Willis, A., Noble, M.E.M., and Endicott, J.A. (2007). How Tyrosine 15 Phosphorylation Inhibits the Activity of Cyclin-dependent Kinase 2-Cyclin A. Journal of Biological Chemistry 282, 3173-3181.
Willems, A.R., Lanker, S., Patton, E.E., Craig, K.L., Nason, T.F., Mathias, N., Kobayashi, R., Wittenberg, C., and Tyers, M. (1996). Cdc53 targets phosphorylated G1 cyclins for degradation by the ubiquitin proteolytic pathway. Cell 86, 453-463.
Wilmes, G.M., Archambault, V., Austin, R.J., Jacobson, M.D., Bell, S.P., and Cross, F.R. (2004). Interaction of the S-phase cyclin Clb5 with an "RXL" docking sequence in the initiator protein Orc6 provides an origin-localized replication control switch. Genes Dev 18, 981-991.
Winters, M.J., Lamson, R.E., Nakanishi, H., Neiman, A.M., and Pryciak, P.M. (2005). A membrane binding domain in the ste5 scaffold synergizes with gbetagamma binding to control localization and signaling in pheromone response. Mol Cell 20, 21-32.
Winters, M.J., and Pryciak, P.M. (2005). Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Mol Cell Biol 25, 2177-2190.
Winzeler, E.A., Shoemaker, D.D., Astromoff, A., Liang, H., Anderson, K., Andre, B., Bangham, R., Benito, R., Boeke, J.D., Bussey, H., et al. (1999). Functional characterization of the S. cerevisiae genome by gene deletion and parallel analysis. Science 285, 901-906.
Wittenberg, C., and Reed, S.I. (2005). Cell cycle-dependent transcription in yeast: promoters, transcription factors, and transcriptomes. Oncogene 24, 2746- 2755.
Wittenberg, C., Sugimoto, K., and Reed, S.I. (1990). G1-specific cyclins of S. cerevisiae: cell cycle periodicity, regulation by mating pheromone, and association with the p34CDC28 protein kinase. Cell 62, 225-237.
265
Wohlschlegel, J.A., Dwyer, B.T., Takeda, D.Y., and Dutta, A. (2001). Mutational analysis of the Cy motif from p21 reveals sequence degeneracy and specificity for different cyclin-dependent kinases. Mol Cell Biol 21, 4868-4874.
Wu, C., Leeuw, T., Leberer, E., Thomas, D.Y., and Whiteway, M. (1998). Cell cycle- and Cln2p-Cdc28p-dependent phosphorylation of the yeast Ste20p protein kinase. The Journal of biological chemistry 273, 28107-28115.
Xiong, Y., Hannon, G.J., Zhang, H., Casso, D., Kobayashi, R., and Beach, D. (1993). p21 is a universal inhibitor of cyclin kinases. Nature 366, 701-704.
Yang, X., Lau, K.Y., Sevim, V., and Tang, C. (2013). Design principles of the yeast G1/S switch. PLoS Biol 11, e1001673.
Zachariae, W., Schwab, M., Nasmyth, K., and Seufert, W. (1998). Control of cyclin ubiquitination by CDK-regulated binding of Hct1 to the anaphase promoting complex. Science 282, 1721-1724.
Zajac, A., Sun, X., Zhang, J., and Guo, W. (2005). Cyclical regulation of the exocyst and cell polarity determinants for polarized cell growth. Mol Biol Cell 16, 1500-1512.
Zhang, H., Hannon, G.J., and Beach, D. (1994). p21-containing cyclin kinases exist in both active and inactive states. Genes Dev 8, 1750-1758.
Zheng, X., and Wang, Y. (2004). Hgc1, a novel hypha-specific G1 cyclin-related protein regulates Candida albicans hyphal morphogenesis. EMBO J 23, 1845- 1856.
Zheng, X.D., Lee, R.T., Wang, Y.M., Lin, Q.S., and Wang, Y. (2007). Phosphorylation of Rga2, a Cdc42 GAP, by CDK/Hgc1 is crucial for Candida albicans hyphal growth. EMBO J 26, 3760-3769.