DCP1A monoclonal antibody (M06), decapping enzyme form a decapping complex, which clone 3G4 interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing Catalog Number: H00055802-M06 premature termination codons. This protein also participates in the TGF-beta signaling pathway. Regulatory Status: For research use only (RUO) [provided by RefSeq]
Product Description: Mouse monoclonal antibody References: raised against a partial recombinant DCP1A. 1. A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Clone Name: 3G4 Maintenance versus Differentiation during Mammalian Neurogenesis. Amadei G, Zander MA, Yang G, Dumelie Immunogen: DCP1A (NP_060873, 186 a.a. ~ 285 a.a) JG, Vessey JP, Lipshitz HD, Smibert CA, Kaplan DR, partial recombinant protein with GST tag. MW of the Miller FD. J Neurosci. 2015 Nov 25;35(47):15666-81. GST tag alone is 26 KDa. 2. Host cytoplasmic processing bodies assembled by Trypanosoma cruzi during infection exert anti-parasitic Sequence: activity. Seto E, Onizuka Y, Nakajima-Shimada J. STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEEL Parasitol Int. 2015 Jul 30;64(6):540-546. FGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLP 3. Hepatitis C virus infection inhibits P-body granule FPFEQLGGAPQSETLGVPSAAHHSVQ formation in human livers. Perez-Vilaro G, Fernandez-Carrillo C, Mensa L, Miquel R, Sanjuan X, Host: Mouse Forns X, Perez-Del-Pulgar S, Diez J J Hepatol. 2014 Reactivity: Human Nov 21. pii: S0168-8278(14)00863-0. doi: 10.1016/j.jhep.2014.11.018. Applications: ELISA, IF, S-ELISA, WB-Re (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Isotype: IgG2a Kappa
Storage Buffer: In 1x PBS, pH 7.4
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 55802
Gene Symbol: DCP1A
Gene Alias: FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene Summary: Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another
Page 1/1
Powered by TCPDF (www.tcpdf.org)