2 IINTRODUCTIONNTRODUCTION to seeitthanunderstandourwords.SearchThorneBeehivesonYouTube andsubscribetoourchannel text means,dohavealook.Theyexplainclearlywhatitis,isfor, andhowtouseassembleit.It’s somucheasie In thedetailsofseveralourproducts,youwillfindalinktocorrespondingvideoonYouTube. Ifyouareunsurewhatthe After agood2017,wehopeforweather, noAsianhornetsandfewervarroamitesthisyear. Welcome toour2018catalogue. innovations andnewideas. needed, thatThornes’continuetoleadthefieldin entrance andnewadaptaeke.Proof,ifproofwere You willalsofindanewmouldedfloor, newnoexit product whichisbasedonthechemicalAmitraz. granted late2017.Don’t confuseitwithanother be thesoledistributorforUK,withlicence On page68,youwillfindApivar. We arepleasedto show! positive. Yet morereasonstoattendthisfantastic National HoneyShowand,again,thefeedbackis we gaveawaysamplepotstocustomersatthe Another excitingnewproductisFeedbee.Again, healthy, strongerandisnowoverfiveframes. had justtwoframesofbees.Itnowislooking We putSHINSontooneofourweakcolonieswhich come in.It’s abitearlybut,sofar, it’s verypositive. only requestwasforfeedbackandthisisstartingto away tothosewhoshowedalotofinterest.Our thought itwasagreatproductandwegavedozens At theverysuccessfulNationalHoneyShowatSandownPark,weshowedournewproduct–SHINS.Manybeekeepers INTRODUCTION oigHvs Page32 Page31 Page27-30 Page43-44 Page 45-46 Page3-15 Heather HoneyandProcessing Tanks,ValvesandStrainers Page16-22 Extractors Page Page24-25 Uncapping Page Miscellaneous Page Clothing Page Moving Hives Clearing Bees Smokers andTools Swarms Page Spacing andEntranceFittings Sections Page Frames andFoundation Hives andBees 39-42 37-38 36 33-35 26 23 THORNE – 01673 858555 • www.thorne.co.uk THE COMPLETEEQUIPMENTSUPPLY COMPANY h ue Page62-65 Page61 Page66-69 Page55-56 Page59-60 Candlemaking Page Gifts Page Page58 Education Page Books Page Page57 Feeding Page Health andMaintenance The Queen Wax/Soap Moulds Wax ExtractionandPolish Pollen, RoyalJellyandPropolis Testing, ShowingandMarketing Honey Containers Labels Page 81-92 75-78 79-80 70-73 74 47-54 • [email protected] http://bit.ly/2nrr91y r

HHIVESIVES aandnd BBEESEES 3 2.5 N/A 2.5 N/A 0.2 N/A 0.2 N/A 0.5 N/A 30 N/A 30 N/A 4 N/A 0.5 – THORNE BEEHIVES THORNE – £4.00 £4.00 £3.00 £3.00 £36.00 £26.40 £48.40 £35.76 £525.00 £525.00 [email protected] • – Suitable – Three sizes. Open Mesh Floor - 405.00mm; Solid floor - – Three sizes. Open Mesh Floor - 405.00mm; Solid – still preferred by some preferred by – still Entrance Block Entrance Block for Budget Mesh Floor Spare Correx sheet for budget open mesh floor, 435 x 410mm Painted Hive, complete, including hive stand Exterior Oiled Hive, complete, including Hive Stand. Spare Correx sheet for above, 430 x 400mm Solid Floor National Hive Open Mesh Floor Assembled Flat Packed Wt. Happy Keeper Floor PAINTED HIVES See YouTube video: See YouTube http://bit.ly/2rP1hRL HAPPY KEEPER FLOOR ENTRANCE BLOCK SOLID FLOOR SOLID 419.00mm; Budget Open Mesh Floor - 413.00mm. . Photograph beekeepers. Photograph position shows the correct block. of the entrance for National hives with 12 brood frames spaced at 35mm (DN4 or 14" x 12") or 11 DN4 and a dummy board. As the bees groom themselves they lose bits of wax or propolis and of course varroa mites. the The debris drops between frames and the tubes and falls to the ground. Does not include an entrance block. Using our paint shown on page 8, we can now supply painted National Using our beehive paint shown on page 8, we can Hives in red, green, blue, yellow, brown or white. Now also available with Exterior Oil applied. Board Crown 27 31 25 22 www.thorne.co.uk www.thorne.co.uk

•

Roof

Floor Super

£397.20 £285.00 £266.10 £204.70 £439.00 £306.00 £284.50 £218.50

Brood Body Brood Queen – The healthy option providing good ventilation for the

01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

Empty Hive with 14"x12" brood body Complete Hive, as above National Hive Assembled Flat Packed Wt. Empty Hive, no frames, foundation or spacers Complete Hive with 14"x12" brood body NATIONAL FLOORS OPEN MESH FLOOR The following items show components used in the complete National hive and alternatives which may be purchased either separately or as part of a complete hive. For example, you could change the 4” roof to a gabled roof or the crownboard to a glass quilt. See our website to Build your own Hive. See YouTube video: http://bit.ly/2FrhYEP

The complete hive as shown comprises: open mesh floor, brood body with open mesh floor, brood hive as shown comprises: The complete premier on metal runners with wired frames (DN4) 11 hoffman self-spacing wood framed stainless steel wire queen excluder, foundation and dummy board, shallow frames (SN1) and wired premier foundation two supers, each with 10 crownboard with 2 plastic porter bee escapes and on metal castellated spacers, 4” roof. galvanised metal covered NATIONAL HIVE NATIONAL bottom bee Cedar. You will find this at Rand from Western Red Manufactured the most the British Isles. It is still walled hive in use all over spaced, single that also substantial hand holds Attractively designed with popular by far. Standard frame. the long lugs of the British accommodate colony. Removable correx sheet under galvanised mesh screen for convenient integrated pest management. Correx sheet available separately. 4 HHIVESIVES aandnd BBEESEES ADAPTA HIVESTAND feeder isworkingsimplicityitself,justslideitout disturbance tothecolony.Simplyconnecthose robbing, miceandcoldwinds.Thebeesaccessthe Sloping Alighting Board Potts SnuggleBoard Floor PollenTrap Under HiveEntrance Happy KeeperFloor Open MeshFloor Solid CedarFloor dpaHv Pie PackedWt. Price Base Adapta Hive plinth fittedtothesideoffloor.Checking Under HiveEntranceinsert.Thisprotectsagainst hive fromunderneaththroughan8mmslot.The floor hasa330x370galvanisedmeshpaneland at thefrontoffeedertoreservoir side ofthehive.The10litrereservoirsitsona Solid CedarFloorinsert.Alsoshowingsloping feeder canbeintroducedwitheaselittle Auto FlowFeederinsert.Anautomaticsyrup THORNE BEEHIVES– correx insertformonitoringpurposes. 01673 858555 from underthefloortoinspect. alighting board. £23.30 £12.40 £46.60 £46.60 £25.85 £31.00 £49.70 £6.20 • 0.75 4 3 2 2.5 4 2.5 8.6 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk inspection board.TheMeshInsertcanbereversed Floor PollenTrapinsert,withplasticdryingbasket the frontofstandontowhichaswarmcanbe re-inforced, whitecorrexrampthatfitseasilyto vertical pollenstripperthatfitsacrossthefloor. suspended underneathopen-meshareaand Swarm Introductioninsert.Ashaped,steel Open MeshFloorinsertandwhitecorrex to closethehivecompletely. See YouTubevideo:http://bit.ly/2GvwA7h Anti-robbing Screen. protect theentranceareafromdrivingrain)SwarmTrapinsert,ExpandingRobo-Blockand an entrancefeeder),anti-robbingdevice,canopy(clearpolycarbonatecoverhelps are mouseguard,slopingalightingboard(whenreversedtoahorizontalpositioncanhold the floorsquare.Allrailsoninsertsareoak.Inadditiontobelow,alsoavailable mode veryquickly.Thesplayedlegsliftthehive150mm.Heavysteelcross-memberkeeps The joistshaveavarietyofslots,holesandrunnerswhichenablethebeekeepertovaryits It isbasedaroundapairofmouldedplasticfloorjoistsmountedonsplayedcedarlegs. collecting, feeding,varroacontrolandmuchmore. This versatilestandgivesthebeekeeperavarietyofoptionsonmanagement,pollen shaken. dpaHv Pie PackedWt. Price Expanding Robo-Block Swarm Trap Entrance Canopy Mouseguard Anti RobbingDevice Swarm Introduction Auto FlowFeeder Anti-Robbing Screen Adapta Hive • Potts SnuggleBoardinsert.Suspendbelowthe Happy KeeperFloorinsert.Astandarddummy board willberequiredtoestablishthecorrect mesh floororsolidfloor.Seepage6formore [email protected] spacing. Seepage3formoredetails. See page24fordetails. £15.00 £49.70 £82.80 £11.40 Anti-robbing device. £7.20 £0.82 £5.00 £9.35 details. 0.2 2 0.5 0.2 1 2 8 2.5 HHIVESIVES aandnd BBEESEES 5 4" Roof 6.0 6.5 8 8 2.7 2.7 2.7 3.2 4.7 5.0 £15.50 £15.85 £29.00 – THORNE BEEHIVES THORNE – Gabled Roof £7.00 £91.90 £69.20 £62.10 £43.50 £70.90 £50.75 £76.35 £53.65 £46.20 £33.00 £85.45 £53.00 £93.80 £56.75 N/A [email protected] • Copper Roof National Roofs 4" depth Assembled Gabled galvanised metal only, pair Flat Wt. Packed National Hive Super, empty Assembled Flat Wt. Packed Top Bee Space option, per box 6" depth Gabled with galvanised metal Gabled with copper Metal only for flat roofs Gabled copper metal only, pair N/A N/A Super complete with 10 SN1 Super complete with 12 SN4 NATIONAL ROOFS The 4” deep roof is 3 different types: 4” deep; 6” deep and gabled design. 6” deep roof offers more top standard and suitable for use in most . The roofs may blow off in insulation and is better suited to exposed areas where the charm of the WBC with high winds. The gabled design illustrated provides the practicality of the National. The gabled roofs are with galvanised steel or copper metal cover. See YouTube video to assemble a: • National Roof: http://bit.ly/2Gvsg8d National Gabled Roof • http://bit.ly/1PyqODI See YouTube video: http://bit.ly/2DPHAe9 See YouTube TOP BEE SPACE at an additional cost. All our National hives can be supplied as Top Bee Space NATIONAL SUPER NATIONAL for honey storage. box, placed above the excluder, The standard 4.3 4.2 5.0 6.5 7.5 11 2 Brood Body with Observation Panel 14" x 12" Brood Body, complete N/A 2 www.thorne.co.uk www.thorne.co.uk • £99.15 £81.00 £38.10 £61.60 £44.85 £81.65 £59.90 £33.30 £24.00 £116.70 £78.30 £116.70 £78.30 £160.64 £100.75 " deep. The 14" x 12" brood body provides x 12" brood body provides " deep. The 14" 8 ⁄ 7 – Replaces the inner wall of a standard national 01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING Observation Panel Brood Body, empty National Hive Assembled Flat Packed Wt. Brood Body complete with 11 DN4 and dummy board Brood Body complete with DN1 frames and dummy board 14"x12" Brood Body empty 14"x12" Brood Body complete with 11 frames and dummy board 14"x12" Eke Brood Body with Observation Panel Standard Brood Body with 14" x 12" Eke See YouTube video: http://bit.ly/2BG29YC OBSERVATION PANEL See YouTube video: http://bit.ly/2rP39Kh Standard depth Brood Body, empty NATIONAL BROOD BODIES BROOD NATIONAL brood body is 8 The standard brood body allowing the to see inside without dismantling the hive. Supplied as individual panels or ready assembled in a brood body. Made from unbreakable polycarbonate. Clean with hot water. Do not scrape with . Ply shutter included. approximately 50% extra space for a larger brood nest for a stronger colony. brood nest for a stronger 50% extra space for a larger approximately brood that fits on top of a standard eke is a simple extension The 14" x 12" 14" x 12" frames. the extra depth to take body, providing 6 HHIVESIVES aandnd BBEESEES TWIN HIVESTAND long, 450mmhigh.SpacebetweenhivesactsasarestforNationalframes. for easymovement.Putsyourhivesatagreatworkingheight.460wide,1520 introducing aswarm. excellent alightingboardfor BASIC HIVESTAND Board toensureairflow. left inplaceabovetheSnuggle mesh floorswhichshouldbe standard HiveStandsusingopen temperatures. Hivessiton are dampandwetwithmild during winterwhenconditions use, particularly,onNationalhives from thebottom.Triedandtestedfor Wendy Pottstoinsulateyourhive A simplenewideafromKevinand http://bit.ly/2nrryQu See YouTubevideo: WITH LEGS SLOPING HIVESTAND http://bit.ly/2BEnzFs See YouTubevideo: SLOPING HIVESTAND http://bit.ly/2Elbgkd See YouTubevideo: POTTS SNUGGLEBOARD HIVE STANDS stable. ground andisvery the hive6”off touch ofclass.Itlifts to giveyourhivesa similar totheWBC legs withvery Sloping hivestandon by 2 WBC, elevatesthehive all hivesexceptthe stand, availablefor – Theslopinghive etc. damp grass,nettles,weeds, hive 10”andwellclearof stand withlegs,liftsthe ainlHv Asmld lt Packed Wt. Flat Assembled Basic hivestand National Hive Potts SnuggleBoard Twin hivestand Sloping withlegs Sloping hivestand 1 ⁄ 2 ” andprovidesan THORNE BEEHIVES– 01673 858555 –The – Treatedtimberhivestandfortwohives.Collapsiblelegs –This

£17.30 £78.65 £42.70 £32.70 £23.30 £15.60 £18.60 £12.00 NA 4 N/A 17 N/A • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 4 2.5 2.5 strongest andsturdiestwireexcluderonthemarket. screwed withstainlesssteelscrewsintoarebatedredwoodframe.Probablythe accurately spacedstainlesssteelrods,witharim,pre-drilledand slots. the beesandnosharpedgesthatmaydamagewings. and assembledusingsteelscrews.Grid,17”or18”squareavailableseparately. RAND EXCLUDER. SLOTTED STEELEXCLUDER. XP PLUSEXCLUDER. XP EXCLUDER. WIRE EXCLUDER. STAINLESS STEELWIREEXCLUDER. square edgedslots. on oneside.MadefromplasticandbasedtheHerzogexcluderdesignwith Excluder XP Plus QUEEN EXCLUDERS For fulldetailsseepage30. NATIONAL COVERBOARDSANDDUMMY Deep andShallow only Timber DummyBoard(Marine ply) Dummy Board,plastic,14"x12" Dummy Board,plastic,deepor shallow Plain PolycarbonateQuilt Polycarbonate Quiltwithescape Glass Quilt Rand Excluder XP PlusExcluder PackedWt. Per10 PackedWt. Price Galvanised Gridonly Wire Excluder Wire Excluder Stainless Steel National Hive ainlHv Pie PackedWt. Price Crownboard National Hive Slotted SteelExcluder XP Excluder um or TimberDummyBoard Dummy Board Board Crownboard/Clearer with beeescape Polycarbonate Quilt Wire Excluder TheplasticXPexcluderisastrong,beefriendlytype.Warmfor As abovebutingalvanisedsteel,exactlythesamepattern Asabovebutmadeinstainlesssteel.

Our XPexcluderwithatwist.Non-stickbeespace £20.00 £10.00 £15.00 Flatexcluderingalvanisedsteelwithstaggered • £8.50 £6.00 £5.00 £4.24 [email protected] 1.5 1.2 1.2 0.7 1.5

Theseexcluderscompriseagridof 0.8 1.2 £11.40 £7.34 £19.75 £20.50 £18.70 £14.63 £180.00 £50.00 £37.15 £135.00 Quilt Plain Polycarbonate Excluder Slotted Steel £6.12 XP Excluder Glass Quilt N/A N/A £75.00

1 1.1 0.8 1.4 1.4 2.9 1.3 5.6 5.6 3 12.7 12.7 N/A N/A HHIVESIVES aandnd BBEESEES 7 NEW NEW NEW 0.15 2.5 0.1 3 4 0.1 – THORNE BEEHIVES THORNE – £7.50 £27.50 £1.80 £29.50 £34.50 £1.50 [email protected] • 5 Slot Castellated Spacers, pair MP Floor with legs Entrance Fitting, each No Exit Entrance No Exit Entrance Price Packed Wt. Half Size Super Half Size Super, flat Price Packed Wt. MP Floor MP Floor Price Packed Wt. HALF SIZE SUPER NO EXIT ENTRANCE MP FLOOR Struggling to lift heavy supers? These new half size versions will take either 5 SN1 frames on castellated spacers or 5 SN4 hoffman self-spacing frames. They are easy to manage and they will fit snugly side by side under a normal roof or crown board. A one size entrance block, 425mm long, with two one way ‘plastic curtains’. A useful piece of kit if you are planning an early trip to the moors or other forage destination, and need to close the hives the night before. A frustrating business if the bees are still flying at 9.00pm. We have adapted a French floor to suit National Hives. Combining the strength National Hives. Combining a French floor to suit We have adapted glance. The appears wooden at first with cedar, the floor of moulded plastic with rigid insert plastic, ventilated floor cloaks a robust moulded cedar however are an optional extra. tray. Steel legs floor to be positioned on the at the front enable the hive Locating lugs that the lugs is a deep slot securely every time. Behind accurately and coloured plastic entrance fittings. Each fitting is accommodates a variety of holes and the following size of restricting double sided with 3mm ventilation the 4.2mm, green 5.5mm, brown 9mm with option of arches: white 9mm, beige each many arches are open. The default, supplied with beekeeper choosing how floor, is the white fitting. extra. These fit into the locating holes moulded into Steel legs are an optional lift it 120mm off the ground. the base of the floor and NEW 1.5 2 3 www.thorne.co.uk www.thorne.co.uk • £9.00 £14.40 £20.64 ulation) INS ive H ustainable ustainable S 01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING Set to fit National Super, SN4 SHINS Price Packed Wt. Packed Price SHINS Set to fit National Brood Body, DN4 Set to fit 14 x 12 Brood Body SHINS ( SHINS The SHINS frames are based around a standard Hoffman frame with insulation around a standard Hoffman frame with insulation The SHINS frames are based These frames are coated. Remove inserted rather than foundation. box you are insulating and place two SHINS frame, one outside frame from the therefore with ten one on each side, of the remaining frames. You overwinter conventional frames and two SHINS. These inserts are held in place with double sided tape. Simply peel off the These inserts are held in place place. Ensure the hive is perfectly clean and dry backing and press firmly in before applying. SHINS are available in three sizes to suit National Hives: National Super, SHINS are available in three Brood. Each kit contains two appropriately sized National Brood and 14x12 insert that fits snugly between the locking bars. frames and shaped CORK SHINS is made from cork which is known as a highly efficient insulator in the which is known as a highly efficient insulator in the SHINS is made from cork a thermal conductivity rating of 0.039 W/m.K. construction industry. It has used extensively in polystyrene hives, is 0.03 Expanded polystyrene foam, W/m.K. We are, therefore, pleased to introduce insulation for your hive, made from insulation for your hive, pleased to introduce We are, therefore, sustainable material. We are well known for our green credentials. We use all our wood waste to We use all our wood for our green credentials. We are well known for wood manufacturing briquettes factory via a biomass furnace, either heat our for mulch. We also recycle cardboard or even making garden burning stoves in our parcels. loose fill packaging 8 HHIVESIVES aandnd BBEESEES excluder andgabledroof.Assembledonly. two superscompletewith11SN4frames,crownboardescapes,wire body withintegralporchandentranceslidescomplete11DN4frames, to separateeasily.Thehivecomprisesanopenmeshflooronsplayedlegs,brood the oldtrickofusingVaselinesmearedalongalledgesisamustifboxesare impressive porchandlappedgableroof.Allpartstelescopeovereachotherso frames. Doublewalledfrontandbackwithan It isan11framehive,takingBSNational 1913. evidence ofhivesthatEdgarwasmakingin on drawings,oldcataloguesandanecdotal introduced TheCentenaryHive.Thisisbased To celebrateour100yearsofhistorywe them eversince. beehive...... and wehavebeenmaking and wheelwrightifhecouldmakehima his friend,EdgarHenryThorne,alocaljoiner 105 yearsagoaWragbySchoolmasterasked CENTENARY HIVE You willfindtheseclothsbrilliantforapplying ExteriorOil.Inpacksofthree300x300mm. Supplied ina1litrescrewtoptin. Brushes canbecleanedinwater. your hives.ItcontainsUVlightinhibitorsthatprotectagainstsunlightwiththe oildryingtoalowlustrefinish. An improvementontheDanishOil,itisawaterborneblendofnaturalplant oilsandotherspecialingredientstonourishp with ahivetoolorothersharpinstrument. Simply warmaportionofpasteinyourhandtosoftenandpressintooffending crack.Removeexcess rain, isfrostandhightemperatureresistantsuitableforsealingleaking feeders.100g. Multi componentandmulti-usehivepasteforsealingcracks,splits,knotsetc. Iteffectivelyprotectsfrom Available in750ml.tinspine,walnutorkhaki. prevent longtermgreyingofthewoodthroughUVradiation. repellent, tackfreesurfacewithnoharmtothebees.Light-resistantpigmentsgiveintensivecolourtimberand Also fromGermany,thishighlyweatherresistanttimberglaze.Itpenetratesdeepintothewoodtogiveadirtandwater Available in375mltinswhite,yellow,redandblue750mlgreenbrown. painted withthesepaints.Seepage3. to orientationforthebees,helpingpreventdrifting.WehaveacompleteNationalhive In Europeitisprimarilyusedtopaintalightingboards,entrances,broodsetcasanaid surfaces ofthehive. is veryeasytoapplywithbrilliantcolourfastnessandcanevenbeappliedinterior polystyrene. Thepaintiswaterbased,hardwearing,hazardfreeandbreathable.It resistant acrylicpaintwhichhasbeenspeciallyformulatedforhives,bothwoodenor From anoldestablishedGermancompany,weofferthisbeehivepaint,ahighlyweather HIVE PROTECTION LINT FREECLOTHS EXTERIOR OIL APISTOP BEEHIVE GLAZE BEEHIVE PAINT iePoeto Pie PackedWt. Price Beehive Paint,375ml Hive Protection PackedWt. Assembled Complete Hive Centenary Hive Crownboard Wire Excluder Entrance Slides Roof Super, complete Super, empty Brood Body,complete Brood Body,empty Open MeshFloorwithlegs Empty Hive Beehive Glaze,750ml Beehive Paint,750ml THORNE BEEHIVES– 01673 858555 £24.00 £22.00 £16.00 £128.65 £364.20 £570.30 £14.63 £19.00 £75.00 £90.45 £46.15 £80.00 £86.70 • £5.44 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 1.3 1.3 0.75 11.5 28 33 1.3 1.5 0.5 8 4.7 3.2 8 8.6 SAFE-WAY WOODSTAINANDTREATMENT HIVE PROTECTION Supplied in473and946mlplasticbottles. inside ofthehive.Dryingtimeisveryrapidat1-2hours. variety ofattractivecoloursandcanevenbeusedonthe protection forallwoodenhives.Itissuppliedina This productisveryeasytoapplyandoffersexcellent Lint FreeCloths Exterior Oil Wood Stain,large iePoeto Pie PackedWt. Price Wood Stain,small Hive Protection iePoeto Pie PackedWt. Price Apistop Hive Protection • [email protected] rotect £16.80 £11.99 £4.00 £24.00 £8.50 0.06 1.5 0.15 1.4 0.75 HHIVESIVES aandnd BBEESEES 9 29 32 29 32 42 45 We can supply these beginners kits with any type of hive. Please contact us for prices. £421.30 £542.50 £440.00 £565.90 £496.30 – THORNE BEEHIVES THORNE –

£528.30 £652.60 £553.50 £690.20 £611.90 £714.50 £599.00 [email protected] National • With Assembled With Flat Packed Beginners Kits National Standard National Deluxe National 14x12 Standard National 14x12 Deluxe WBC Standard WBC Deluxe WBC YOUR CHOICE OF HIVE DELUXE BEGINNERS KIT BEGINNERS DELUXE Your choice of hive, National or WBC, in the flat with assembly instructions or in the flat with assembly hive, National or WBC, Your choice of Bee Manual with legs, the book, The plus: sloping hive stand ready assembled all-in-one, pair 10 smoker cartridges, standard copper smoker, by Clare Waring, tool, english brush, stainless steel hive gloves, mouseguard, bee of kid leather for sale sign. feeder and Honey Hive Hive Weight Hive Hive £270.00 www.thorne.co.uk www.thorne.co.uk • 01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING Nucleus of Bees (Collection only) Bees STANDARD BEGINNERS KIT Your choice of hive, National or WBC, in the flat with assembly instructions or Your choice of hive, National or WBC, in the flat with Bees at the Bottom of the ready assembled plus: standard hive stand, the book, jacket and veil, pair of Garden by Alan Campion, standard galvanised smoker, steel hive tool and mordant leather gloves, mouseguard, bee brush, stainless english feeder. NUCLEUS OF BEES NUCLEUS in England and selected breeders offer are from our own apiaries The bees we to qualities. They adhere for good temper and hardworking and are bred providing a There are six frames set by the National Bee Unit. the standard stores. eggs, sealed brood and food of all ages, newly laid balance of bees supplied in years old. Our nuclei are are not more than two Frames of comb ). They (very useful around the plywood travelling boxes non-refundable Stockbridge. from Rand, Windsor or can be collected 10 HHIVESIVES aandnd BBEESEES AVAILABLE ONLINEONLY BEES ONABUDGET See YouTubevideo:http://bit.ly/2GxKhmq valve, uncappingforkanddoublestrainer. 15lb. honeybuckets,1x30lb.bucketwith Two framemanualhoneyextractor,3x PACKAGE 3–HONEYPROCESSINGKIT feeder andmouseguard. brush, smokercartridges, gloves, jacketandveil,bee a smoker,hivetool,leather Everything inpackage1plus PACKAGE 2–THEBASICKIT with escapesand4”roof. and foundation,crownboard with 10selfspacingframes excluder, twosuperseach and foundation,wiregrid 10 selfspacingframes block, broodbodywith mesh floorwithentrance The hivescomprises:open THE LANGSTROTHHIVE http://bit.ly/2Gvsg8d Roof: • Budget http://bit.ly/2nrjiQK • Budget OpenMeshFloor: http://bit.ly/2rSfai4 • Budget BroodBody: http://bit.ly/2DNfznB Super: • Budget assemble a: See YouTubevideoto basic beekeepingguide. glue instructionsand and foundation,nails, including allframes standard broodbody packed hivewith A completeflat PACKAGE 1–THENATIONALHIVE porter escapes,4”roof. on metalrunners,dummyboard,plasticqueenexcluder,twosuperseachwith10SN1framescastellationswiredfou The hivescompriseof:openmeshfloorwithentranceblock,standardbroodbodyor14x1211hoffmanselfspacin than WesternRedCedarandhavesmallsolidliveknots.Fullinstructionsforassemblyallnailsgluearesupplied. Complete NationalHivewitheitherastandardbroodbodyor14x12body.ManufacturedfromBritishgrowncedarsustai agtohHv Price(onlineonly) ,assembled Langstroth Hive,flat Langstroth Hive THORNE BEEHIVES– 01673 858555 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk £150.00 £120.00 PACKAGE 4–THEKITPLUS As packagesonetosevenbutwithanassembledhive. PACKAGES 11to17 1 x30lbbucketwithvalve,uncappingforkanddoublestrainer. plus atwoframemanualhoneyextractor,2x15lbbuckets, Everything inPackage6 PACKAGE 7–THE14x12KITPLUS bee brush,smokercartridges,feederandmouseguard Everything inPackage5plusasmoker,hivetool,leathergloves,jacketandveil, PACKAGE 6–THEBASIC14x12KIT foundation, nails,glue,instructionsandbasicbeekeepingguide. A completeflatpackedhivewith14x12broodbodyincludingallframesand PACKAGE 5–THE14x12NATIONALHIVE honey buckets,1x30lb.bucketwithvalve,uncappingforkanddoublestrainer. Everything inPackage2plusatwoframemanualhoneyextractor,3x15lb. akg 5–Te1 2Hv Price(onlineonly) Package 17–The 14x12HiveandKitPlus Package 16–The14x12Hiveand BasicKit Package 15–The14x12Hive Package 14–TheStandardHive andKitPlus Package 12–TheStandardHive andBasicKit Package 11–TheHive ASSEMBLED HIVE Price(onlineonly) Package 7–The14x12HiveandKitPlus Package 6–The14x12HiveandBasicKit Package 5–The14x12Hive Package 4–TheKitPlus Package 3–HoneyProcessingKit Package 2–TheBasicKit Package 1–TheNationalHive Bees onaBudget • [email protected] ndation, crownboardwithtwoplastic g framesandwiredfoundationtosuit nable forests.Timberwillbepaler £320.00 £410.00 £280.00 £210.00 £385.00 £260.00 £185.00 £360.00 £160.00 £230.00 £160.00 £450.00 £250.00 HHIVESIVES aandnd BBEESEES 11 2.7 8 5.4 9 3 8 0.2 8 2.7 3.4 5.5 4.3 1.3 1.3 £4.00 £49.70 £72.35 £17.80 £58.85 £15.85 £28.90 £25.30 £34.85 £16.25 £21.10

N/A 8.6 – THORNE BEEHIVES THORNE – £74.20 £51.60 £89.75 £67.15 £36.40 £80.90 £49.70 £26.30 £56.20 £34.40 £86.70 £86.70 £122.00 [email protected] ” 8 ⁄ 7 • – These legs are suitable for the WBC hive. They are made – These legs are suitable – Made at Rand – Made at Rand Brood body, complete with DN1 frames 14"x 12" brood body, complete with frames Roof metal only Copper Roof N/A Plastic Legs Entrance Slides N/A N/A Solid Floor WBC Hive Roof Assembled Flat Packed Wt. WBC Hive Brood body, empty Assembled Flat Packed Wt. WBC Hive Varroa floor Assembled Flat Wt. Packed Copper Roof metal only N/A Cedar Legs N/A 14"x 12" brood body, empty Super, empty Super, complete deep. The 14” x 12” brood body provides approximately 50% extra space for a larger brood nest for a stronger colony. The standard super is placed above the excluder for honey storage. See YouTube video: http://bit.ly/2rSp8jn WBC BROOD BODIES AND SUPER The standard brood body is 8 See YouTube video: http://bit.ly/2DQRS1x WBC ROOF CEDAR LEGS PLASTIC LEGS WBC ENTRANCE SLIDES WBC LEGS WBC Standard is galvanised metal covered. Now available with copper cover. from durable recycled plastic; can be cut and screwed like timber and look like can be cut and screwed like timber and look like from durable recycled plastic; with the sloping hive stand. timber. Can also be used from Western Red Cedar, the from Western raise the hive splayed legs 150mm. Sold in pairs. Slide in from each end of the porch as shown. 41 37 49 28 www.thorne.co.uk www.thorne.co.uk £380.30 £314.00 £431.70 £239.80 •

£508.75 £411.40 £588.80 £301.40 – The – The traditional

01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING

Complete Hive – as above WBC Hive Assembled Flat Packed Wt. Empty Hive – no frames, foundation or spacers Complete with 14" x 12" brood body and one extra lift Outer Case only – floor, lifts and roof SOLID FLOOR floor still used by many beekeepers. WBC FLOORS VARROA FLOOR healthy option providing good ventilation for the colony. Removable steel tray under galvanised mesh screen for convenient integrated pest management. The complete hive comprises: varroa floor with legs, three lifts, (one with porch), varroa floor with legs, three lifts, (one with porch), The complete hive comprises: cone escapes, entrance slides, brood body with metal covered roof with two on narrow plastic ends, wire queen excluder, ten D.N.1. frames and foundation frames and foundation on castellated spacers and two supers each with eight bee escapes. crownboard with plastic porter Manufactured at Rand from Western Red Cedar. The Classic Cottage Garden Cedar. The Classic Cottage at Rand from Western Red Manufactured design. This for its attractive and stable by beekeepers worldwide hive, admired A stunning focal against the weather. hive offers great protection double walled We can when painted white. garden, large or small, especially point for any we recommend wish to paint it yourself, an additional cost. If you paint them at a coat of quality once thoroughly dry, good quality undercoat and, two coats of gloss paint.

See YouTube video: http://bit.ly/2DKAoQh WBC HIVE 12 HHIVESIVES aandnd BBEESEES for asecurefit. deep withslightlybevellededges used onallWBChives.195mm This isthestandardriserorlift, LIFT ANDWITHPORCH is stillalsoverypopular.Distinguishedbyitsstaggeredslots. fastened intoawoodenframe.Beespaceonesideonly.Theslottedsteelversion These excluderscompriseofagridaccuratelyspacedsteelrodssecurely The wiretypeisnowsuppliedasthestandardoptionforacompleteWBChive. WBC QUEENEXCLUDERS any gardenorapiary. hive isreadytoadorn one coatofgloss,this quality undercoatand With twocoatsofgood PAINTED WHITE • WBC Porch:http://bit.ly/2DVLlCb • WBC Lift:http://bit.ly/2rST9PZ See YouTubevideotoassemblea: oc ny N/A Porch only Lift withporch To paintwhitethecompletehive Wire excluder WBC Hive Packed Wt. Flat Assembled Lift WBC Hive Slotted steelexcluder THORNE BEEHIVES– 01673 858555 Wire type £20.00 £6.00 rc Pce t Pr1 PackedWt. Per10 PackedWt. Price Slotted SteelExcluder 1.2 1.5

£85.25 £57.95 £41.00 £42.35 £10.15

• £180.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY £50.00 £30.90 www.thorne.co.uk N/A 0.5 4.7 4.2 5.6 12.7 traditional crownboard. You mayprefertotryaglassorpolycarbonatequiltasanalternativethe frame. Withtwobeeescapes. Crownboards aremanufacturedusing6mmexteriorqualityplywoodinacedar WBC COVERBOARDSANDDUMMY ornament foryourgarden.Itcannotbeusedkeepingbees. and measuresapproximately550mmsquare900mmhigh.Thishiveisan quickly andblendintoyourgardeninaveryshortspaceoftime.Hiveisfullsize available. Thetimberdoesnotrequireanytreatmentandwillweathervery for ‘GroundForce’weknewthetimewasrighttomakethemmorewidely them asagardenornament.WhenAlanTichmarshrequestedanoldWBCHive making hivessinceearlylastcenturyandhaveoftenbeenrequestedtoprovide The traditionalEnglishbeehivemadeinlonglastingCedar.Wehavebeen GARDEN HIVE Dummy Board,14"x12",plastic Dummy Board,deeporshallow,plastic Plain PolycarbonateQuilt Polycarbonate Quiltwithescape Glass Quilt B ie rc PackedWt. Price Crownboard WBC Hive B ie sebe Fa Packed Wt. Flat Assembled Garden Hive WBC Hive Quilt Plain Polycarbonate Dummy Board Clearer Board Crownboard/ • [email protected] £153.50 £19.75 £20.50 £18.70 £14.63 £7.34 £6.12

with beeescape Polycarbonate Quilt £118.20 Glass Quilt 16 0.8 0.8 1.4 1.4 2.9 1.3 HHIVESIVES aandnd BBEESEES 13 Wire Queen Excluder 1.3 1.5 2.9 0.2 0.8 21 3.3 7.5 10.8 5.2 7.3 6.7 7.7 2.7 2.5 4 28 Entrance Block £4.00 £7.34 £14.63 £20.00 £18.70 £31.35 £59.10 £98.80 £37.00 £65.00 £50.00 £56.75 £15.50 £15.60 £32.70 £251.20 £340.20 N/A 3.5

– THORNE BEEHIVES THORNE – Plastic Dummy Board £42.95 £42.95 £80.60 £50.70 £70.40 £78.40 £23.30 £42.70 £320.30 £159.60 £100.75 £481.70 [email protected] • Glass Quilt Solid Floor Langstroth or Dadant Hive Crownboard Price Packed Wt. Dadant Hive Complete Hive as above Assembled Flat Wt. Packed Wire Queen Excluder Glass Quilt Entrance Block Plastic Dummy Board Empty Hive, no frames or foundation Open Mesh Floor Brood Body, empty Brood Body, complete Super, empty Super, complete Roof, 4” Roof, 6” Roof Metal only Sloping Hive Stand Sloping Hive Stand with legs N/A Crownboard Similar in construction and design to the Langstroth and also American in Langstroth and also American and design to the Similar in construction complete hive wider spacing. The are deeper with a slightly origin; the frames self spacing frames and brood body with eleven open mesh floor, comprises: spacing supers each with eleven self queen excluder, two foundation, wire roof. crownboard, 4” frames and foundation, biggest in the produce and is one of the is the largest hive we The Dadant hive almost 4000 sq. ins. Also popular with commercial world with a brood area of large capacity. It can be very heavy to lift and move beekeepers because of its are concerned. The hive which Brother Adam used around, even when supers is a twelve frame version. exclusively at Buckfast Abbey See YouTube video to assemble a: • Dadant Super: http://bit.ly/2DKzTFT Dadant Brood Body: • http://bit.ly/2nqHgvu DADANT HIVE DADANT 30 23 7 10 6 6.5 2.7 2.5 4 28 21 3 6 9 4.5 6.5 £59.10 £96.00 £46.90 £54.90 £15.50 £15.60 £32.70 £28.50 £45.80 £76.70 £28.70 £52.40 www.thorne.co.uk www.thorne.co.uk £307.15 £229.40 £288.50 £218.20 •

N/A 3.1 £80.45 £67.20 £76.00 £23.30 £42.70 £39.50 £39.50 £62.80 £40.50 £81.65 £432.00 £294.35 £152.15 £400.00 £276.60 £118.45

01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING

Empty Hive with Jumbo Brood Body Jumbo Brood Body, complete Complete Hive with Jumbo Brood Body Roof, 6" Roof metal only Sloping Hive Stand Sloping Hive Stand with legs N/A Empty Hive, no frames or foundation Open Mesh Floor Brood Body, empty Brood Body, complete Super, empty Super, complete Roof, 4" Solid Floor Jumbo Brood Body, empty Langstroth Hive Assembled Flat Packed Wt. Complete Hive as above Langstroth Hive Assembled Flat Packed Wt. See YouTube video to assemble a: See YouTube video to assemble • Langstroth Super: http://bit.ly/2DKzTFT Langstroth Brood Body: • http://bit.ly/2nqHgvu

The complete hive comprises: open mesh floor, brood body with ten self spacing body with ten self spacing open mesh floor, brood hive comprises: The complete ten self two supers each with wire queen excluder, frames and foundation, and 4” roof. and foundation, crownboard spacing frames LANGSTROTH HIVE LANGSTROTH in the by many commercial beekeepers popular hive. It is used The world’s most of design and ease of handling. brood body, simplicity UK for it’s larger We can also supply the hive with a Jumbo brood body to accommodate extra deep frames. 14 HHIVESIVES aandnd BBEESEES box. rebate ofthebrood existing framerunner will fitsnuglyintothe pattern ofhiveand machined tofitour The cedarpartsare frame Commercial. body intoaten National brood for convertinga An ingeniousdevice hobbyist andcommercialbeekeepersalike. frames andfoundation,crownboard,4”roof.AverypopularhiveinIrelandwith and foundation,wirequeenexcluder,twosuperseachwithelevenselfspacing hive comprises:openmeshfloor,broodbodywithelevenselfspacingframes from alargebroodareawitheasytomanageframesandsupers.Thecomplete therefore, useNationalsupersabovethe16”x10”broodbox,thusbenefiting crownboards androofsareallthesameasNationalHive.Manybeekeepers, A simplesquarehiveforthosewhopreferalargebroodarea.Floors,excluders, COMMERCIAL HIVE16X10 HAMILTON CONVERTER • Commercial BroodBody:http://bit.ly/2nqHgvu • Commercial Super:http://bit.ly/2DKzTFT See YouTubevideotoassemblea: ofmtlol N/A with legs Sloping HiveStand Sloping HiveStand Roof metalonly Roof, 6" Super, empty Brood Body,complete Open MeshFloor foundation Empty Hive,noframes omrilHv Asmld lt PackedWt. Flat Assembled Hamilton Converter Commercial Hive PackedWt. Flat Assembled Complete Hiveasabove Commercial Hive Solid Floor Roof, 4" Super, complete Brood Body,empty THORNE BEEHIVES– 01673 858555 £101.70 £139.30 £271.80 £449.50 £42.70 £23.30 £70.90 £62.10 £47.00 £65.95 £35.76 £35.76 £11.90 2.7 N/A • £212.20 £312.60 THE COMPLETEEQUIPMENTSUPPLY COMPANY £32.70 £15.60 £15.50 £50.75 £43.50 £64.40 £33.80 £85.00 £48.30 £26.40 www.thorne.co.uk £7.95 4 2.5 2.7 6.6 6 7.3 5 9.5 6.8 2.6 21 28 2 Crownboard http://bit.ly/2nqHgvu • Smith BroodBody: http://bit.ly/2DKzTFT Super: • Smith assemble a: See YouTubevideoto 14” x12”broodbody. 4” roof.Alsoavailableisa foundation, crownboard, self spacingframesand supers eachwitheleven wire queenexcluder,two frames andfoundation, with elevenselfspacing mesh floor,broodbody hive comprises: open WBC. Thecomplete as theNationaland size offoundation frames andthesame lugged BritishStandard accommodate short body andsuperframesoftheSmithhive Langstroth hive,incorporatingallthedesignfeaturesofthathive.Thebrood ideal formovingtotheheathermoors.Basically,Mr.Smithdevelopedasmall Innerleithen, Peebles.Itiswellsuitedtotheweatherconditionsinnorthand A popularhive,particularlyinScotland,developedbyMr.W.Smithof SMITH HIVE Super, empty 14"x12" BroodBody,complete Solid Floor ls ul Plastic DummyBoard Entrance Block Glass Quilt Wire QueenExcluder N/A with legs Sloping HiveStand Sloping HiveStand Roof metalonly Roof, 6” Roof, 4” Super, complete 14"x12" BroodBody,empty Brood Body,complete Brood Body,empty Open MeshFloor or foundation Empty Hive,noframes mt ie sebe Fa PackedWt. Flat Assembled Complete Hiveasabove Smith Hive omrilo mt ie rc PackedWt. Price Crownboard Commercial orSmithHive Glass Quilt • [email protected] £255.30 £377.80 £161.00 £101.00 £37.00 £42.70 £23.30 £71.20 £62.20 £82.45 £38.75 £82.00 £51.60 £37.80 Plastic DummyBoard NA 2.7 N/A 11.2 N/A 7.6 N/A £197.80 £265.80 £18.70 £20.00 £14.63 £32.70 £15.60 £15.50 £50.80 £43.50 £49.70 £27.10 £64.25 £36.65 £27.10 £7.34 £4.00 Entrance Block 0.8 0.2 2.9 1.5 1.3 4 2.5 2.7 6.3 5.5 5.2 3.5 6.7 4.5 2.6 21 28 Excluder Queen Wire HHIVESIVES aandnd BBEESEES 15 6.5 8.5 27 18 21 – THORNE BEEHIVES THORNE – £69.20 £126.50 £21.30 £14.35 £75.85 £45.38 £350.84 £243.00 [email protected] Development Trust • for UK Registered Charity Number 1078803 Become a supporter of the Become a supporter of Bees and help promote sustainable for bees and people. Visit www.beesfordevelopment.org or call 01600 714848 for more information Box Complete Hive, complete Rose OSB Box only Assembled Flat Packed Wt. Top Bar Hive Cedar, Assembled Plywood, Flat Price Packed Wt. ROSE OSB (One Size Box) TOP BAR HIVE TOP BAR A single box complete with 24 simple bar frames with groove for wax starter. bar frames with groove for complete with 24 simple A single box for removing the floor is a mesh panel roof. Centrally placed in Flat, plywood hive is made drawer. The assembled also includes a simple varroa debris which and the flat hive from British cedar quality from exterior plywood plywood. All will require a timber preservative. Overall length of body 880mm, 350mm wide at base, 485mm wide at top, 295mm high. A £10 donation to Bees for sold. Development for every hive See YouTube video: http://bit.ly/2BEeuMR A simple design made from Russian redwood and marine plywood to take 12 frames. Use as a substitute for brood body or super. Full details at www. rosebeehives.com All other components are National size. Complete hive comprises, Open Mesh Floor, 3 Brood bodies complete with 12 frames and premier foundation, stainless steel wire excluder, crownboard with two porter bee escapes and 4” roof. www.thorne.co.uk www.thorne.co.uk 3 0.15 6 30 6 6 6 30 • £2.30 £11.50 £57.65 £63.44 £31.75 £58.40 £236.45 £263.10

01673 858555 splayed legs and integral varroa screen and drawer each with eight plain top bars hessian cover and woodshaving insulation

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS • Four brood bodies, • A ventilated roof • A deep quilt with • A plain canvas quilt • A floor with Canvas Quilt only Roof Floor Brood Body Brood Body with Observation Panel Complete hive, 4 brood bodies, one with Observation Panel Deep Quilt Complete with four brood bodies Warre Hive Assembled Packed Wt. WARRE HIVE WARRE The brood body is also available with an observation panel (pictured below). We recommend the book ‘Beekeeping for All’ as an accompaniment to this hive. Made from British Cedar, each hive comprises: Beekeeping in France in the late 19th Century was on the decline and a Century was on the decline France in the late 19th Beekeeping in that a more was convinced Abbe Emile Warré (1867-1951) beekeeper called trials with a was possible. After many way of beekeeping simple and economic Warre Hive he designed his own, the variety of hives as the Ruche Populaire or (also known ‘Peoples Hive’). 16 AASSEMBLINGSSEMBLING HHIVESIVES aandnd FFRAMESRAMES operated handleswithrubbergrips.100mmlong. and cutjawsforremovingframenails.Spring Handy sizedpincerswithaccuratelyshaped assembly and B etc. Large roundheadedpinforrunners,coneescapes, Slim Nailsformoredelicatehiveassembly. 1.5" or1"SheradisedPanelPins: hive assembly.Round,notovalfinish.Losthead. 2.65mm gaugeheavilygalvanisednailsforgeneral 2" GalvanisedNails: Each gunissuppliedwith2000nails. Fires 18gauge,15mmgalvanisednails. to use.Makesframeassemblyapleasure. Lightweight andveryeasyaccurate 260mm long. 150g headweight. A smallhammersuitableforframeassembly. glued. 200ml.or50ml. of alltimberjointsinhiveparts.Framesshouldnotbe Supplied inspoutedbottles.Werecommendthegluing A waterproofwoodgluesuitableforhiveassembly. See YouTubevideo:http://bit.ly/2DOpsp1 5 Overall length160mm. the handle,isdrivenintowood. A framenailisplacedinthetubeand,withafirmpunchon frames. frames. 50gof¾”nailswillassembleapproximately25 HIVE NAILS FRAME NAILPLIERS FRAME NAILINGGUN FRAME NAILHAMMER HIVE GLUE RAMPIN FRAME NAILS ⁄ 8 Frame NailPliers 2000 NailsforNailingGun Electric FrameNailingGun Frame NailHammer Hive Glue,50ml Rampin 50g 50g 500g 500g 100g 500g 1”PanelPins 500g 1.5”PanelPins sebigHvsadFae Pie PackedWt. Price Hive Glue,200ml Assembling HivesandFrames PackedWt. Price 500g 2”GalvanisedNails Assembling HivesandFrames lack japannedtopreventrusting.¾”forgeneralframe " BrassEscutcheonPins: 3 3 THORNE BEEHIVES– 01673 858555 ⁄ ⁄ 8 4 3 3 5 ” ” ⁄ ⁄ ⁄ 8 4 8 FrameNails FrameNails ” ” ” FrameNails FrameNails EscutcheonPins 3 ⁄ 8 ” forholdingwirewhencrosswiring £46.20 £7.50 £1.70 £1.40 £7.50 £5.00 £2.50 £8.40 £8.40 £5.00 £4.00 £6.29 £3.00 £2.40 £7.20 • 0.1 0.6 1.5 0.25 0.1 0.25 0.15 0.06 0.06 0.75 0.75 0.15 0.75 0.75 0.75 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk for piercingroofmetalspriortonailing. punch. Verysharppointsuitable A 100mmlonghardenedsteel insulated probes. when wiringyourownframes.130mm embedding framewireintofoundation This 12Vtransformerisperfectfor much easier.Nostrainingofthewireorsorehands. A tensioningandcrimpingdevicewhichmakeswiringframes 215mm long. hardened steelneedle. construction with Hardwood andsteel inserting eyelets. holes insidebarsand A robusttoolforpunching (approx. 270)and200g. or punchedthroughapre-drilledhole.Packetsof28g wire fromcuttingintotimber.Canbeeitherhammered Small brasseyeletsforinsertionintoasidebartoprevent The waxismeltedandcoversthewire.Wireneedstobetaut. Heat withasmallflame.Runalongwire. spur wheel.Overalllength165mm. shaped woodenhandleand50mmdiameter embedding. 235mmlong. If youwireyourownframeswillfindthesetoolsindispensable. foundation especiallyonthelargerbroodframes. your ownframesandprovidingextrasupportforthe These gradesofwireareideallysuitedforwiring hard wireonreelsof250g. U.S. style: Euro style: Stainless Steel: Standard: EYELETS SPUR EMBEDDERS FRAME WIRE ROOF METALPUNCH TRANSFORMER WIRE CRIMPER EYELET PUNCH iigFae Pie PackedWt. Transformer Wire Crimper Eyelet Punch Price Eyelets, 200g Eyelets, 28g US SpurEmbedder Euro SpurEmbedder Stainless SteelFrameWire Standard FrameWire Roof MetalPunch Wiring Frames

250g reelsof0.40mmrustproofedwire. Embedder with100mm

Brass fittings,plastichandleandknurledwheelforsimple

0.44mm ingauge,averysmooth, • [email protected] £40.00 £10.00 £22.50 £10.00 £3.00 £9.50 £5.00 £8.50 £5.00 £7.50 2 0.15 1.5 0.25 0.06 0.15 0.25 0.3 0.3 0.5 FFRAMESRAMES aandnd FFOUNDATIONOUNDATION 17 12 0.75 1.7 6.5 14.5 6 6.5 3.5 4.3 6 4.3 1.7 3.5 4.3 1.4 1.25 0.75 0.75 1.25 0.7 0.75 0.75 0.4 0.5 0.7 0.5 0.2 0.4 0.5 8.6 10.8 6.5 6.5 10.8 6 1 £7.28 £4.39 £5.46 £6.24 £6.24 £1.11 £3.04 £4.10 £7.45 £4.45 £5.60 £6.40 £6.40 £1.14 £3.10 £4.18 – THORNE BEEHIVES THORNE – £9.14 £8.44 £6.56 £5.90 £7.85 £7.28 £9.40 £8.70 £9.40 £8.70 £9.40 £8.70 £6.30 £5.75 £7.64 £7.06 £9.14 £8.44 £9.14 £8.44 £17.85 £16.48 £12.80 £11.78 £17.85 £16.46 £14.90 £13.77 £10.50 £9.59 £17.38 £16.00 £12.40 £11.44 £17.38 £16.00 £14.47 £13.34 £10.73 £9.90 [email protected] TEN SHEET RATE • ONE HUNDRED SHEET RATE (per 10 sheets) Langstroth Deep Langstroth Shallow Dadant Deep Commercial deep Commercial Shallow OSB Thin Super for Cut Comb B.S. Deep B.S. Shallow Langstroth Shallow Dadant Shallow Commercial Shallow Section Square Three section Length Four Section Length B.S. Shallow Langstroth Deep Langstroth Shallow Dadant Deep Commercial deep Commercial Shallow OSB Thin Super for Cut Comb B.S. Deep B.S. Shallow Langstroth Shallow Dadant Shallow Commercial Shallow Section Square Three section Length Four Section Length B.S. Shallow Description Wired Unwired Packed Wt. Packed Unwired Description Wired B.S. Deep B.S. 14” x 12” Dadant Shallow B.S. 14” x 12” Dadant Shallow B.S. Deep STANDARD BEESWAX 14.5 1.7 1.7 3.5 4.3 12 10.8 6.5 6.5 10.8 6 6 6.5 3.5 4.3 6 4.3 0.7 0.75 0.75 0.4 0.5 0.7 0.5 0.2 0.4 0.5 8.6 6.5 1 0.75 1.4 1.25 0.75 0.75 1.25 0.5 £1.27 £4.65 £8.27 £4.97 £6.20 £7.07 £7.07 £8.90 £5.33 £6.68 £7.42 £1.36 £3.73 £5.00 www.thorne.co.uk www.thorne.co.uk • £3.45 £7.42 £9.12 £8.40 £7.20 £7.56 £6.84 £7.80 £7.00 £9.35 £8.67 £20.70 £19.14 £14.80 £13.62 £20.70 £19.14 £10.90 £10.07 £17.24 £15.92 £10.90 £10.07 £10.90 £10.07 £11.20 £10.40 £11.20 £10.40 £12.47 £11.44 £12.79 £11.82 £21.37 £19.69 £15.22 £14.23 £21.37 £19.69 £11.20 £10.40 £17.77 £16.40 TEN SHEET RATE ONE HUNDRED SHEET RATE (per 10 sheets)

01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

Dadant Shallow Description Wired Unwired Packed Wt. Packed Unwired Description Wired B.S. Deep Dadant Shallow Three section Length Four Section Length B.S. Deep Langstroth Deep Langstroth Shallow Dadant Deep Commercial deep Commercial Shallow OSB Thin Super for Cut Comb B.S. Shallow Langstroth Shallow Dadant Shallow Commercial Shallow Section Square B.S. Deep B.S. Deep 14”x12” Extension OSB Thin Super for Cut Comb B.S. Shallow Langstroth Shallow Dadant Shallow Commercial Shallow Section Square Three section Length Four Section Length B.S. Shallow B.S. 14” x 12” B.S. Shallow B.S. 14” x 12” Langstroth Deep Langstroth Shallow Dadant Deep Commercial deep Commercial Shallow until it is warmer. weather. In this situation, we will hold orders weather. In this situation, we will hold orders NB: Beeswax sheets easily shatter in very cold NB: Beeswax sheets easily shatter in very cold special sizes made to order. available in worker base only. Wired or plain- available in worker base only. Wired or plain- base. Thin super for cut comb and sections is regular sizes, both in worker base and regular sizes, both in worker in multiples of ten, and is manufactured in all in multiples of ten, and and to keep it fresh. All foundation, is packed and to keep it fresh. All polythene to help retain the delicate aroma polythene to help retain PREMIER BEESWAX After careful checks, the wax is packed in After careful checks, the has excellent colour and aroma. has excellent colour and blended beeswax from a variety of sources and blended beeswax from Our standard grade is manufactured with Our standard grade is manufactured beeswax foundation in the UK. beeswax foundation in reputation as being the leading manufacturer of reputation as being the for over 55 years and on which we base our for over 55 years and on which has been manufactured by Thornes which has been manufactured beeswax. This is the top quality foundation is the top quality foundation beeswax. This Irish, Australian, New Zealand and East African New Zealand and Irish, Australian, quality wax blended from the finest British, blended from the finest quality wax Premier and Standard. Premier is our usual top Standard. Premier is our Premier and Beeswax sheets are available in two grades, are available in two Beeswax sheets BEESWAX FOUNDATION BEESWAX 18 FFRAMESRAMES aandnd FFOUNDATIONOUNDATION Same priceasstandardD/SN4frames.Seepage22. 4.9/50mm foundation.Theyare32mmwide. The spacingontheseframesismoresuitablewhenusing Available inLangstrothorBritishStandard sizesonly. now asamatterofcourse.Notcoated withbeeswaxbutcanbequicklydipped. to workthefoundation.Manycommercial beekeepersuseplasticfoundation must benearperfectforthebees that conditionsforcombbuilding up. Itmusthoweverbepointedout without fearofthecombbreaking beekeeper toextractathighspeed indestructible, enablingthe Once drawnthecombsarevirtually Premier gradeonly. deep andshallow14x12. professionals. AvailableasBS without sagging.Thechoiceof sheet. Forperfectlystraightcombs electrically embeddedintoevery has sevenverticalcrimpedwires Welwyn thisPremierfoundation Originally pioneeredbyTaylorsof Premier gradeonly. Scutellata, theAfricanHoneyBee.Nottobeconfusedwith4.9/5.0mmcellsize. We nowofferthesmallercellsizefoundation,suitableforApisMellifera use inNational,WBCandSmithstandardbroodbodies. the blackfoundation.BSDeepsizeonlyfor beekeepers mayfinditeasiertospoteggsin cells, eliminatinganytendencytosag.Some the freshlymilledwaxatanangleto the onecontinuouslengthisembeddedinto variety ofsources.Itisdiagonallywiredand Rand. Itisdyedbeeswaxblendedfroma Standard gradebeeswaxmanufacturedat Prices asshownonpage17. Available inallworkerbasedeepsizes,wiredorunwired,premiergradeonly. months. the hive.Thebeesmustfirstbesubjecttoregressionoveraperiodofseveral It cannotbedoneeitherbysimplyputting10framesofsmallcellfoundationin small cellhowevercanbedifficultandmustdoneatthecorrecttimeofyear. experimented withsmallcellhavereportedencouragingresults.Movingoverto produce incombwidthnature.ManybeekeeperstheUSAwhohave reproduce intheslightlysmallercellsize.4.9mmbeingclosetowhatbees 4.9 mmfoundationforvarroacontrol.Itisclaimedmitesstruggleto DN4 ANDSN4FRAMESFORSMALLCELLFOUNDATION 4.9/5.0MM CELLSIZEFOUNDATION PLASTIC FOUNDATION "STRONGHOLD" CRIMPEDWIRED 4.7MM CELLSIZEFOUNDATION BLACK FOUNDATIONSHEETS BS orLangsShallow, persheet lsi onain rc Packed Wt. Price BS orLangsDeep,persheet Plastic Foundation BS 14”x12”Wired,per10sheets BS ShallowWired,per10sheets 10Sheets Srnhl"CipdWr Pie PackedWt. Price BS DeepWired,per10sheets "Stronghold" CrimpedWire Langstroth Deep Description Wired Unwired BS DeepBlackFoundationSheet Description Packed Packed Wt. Wt. Langstroth Shallow THORNE BEEHIVES– 01673 858555 £15.22 £14.07 £9.35 £8.67 £12.79 £21.37 £0.70 £0.70 £7.80 £10.50 £1.20 • 0.2 0.2 1.4 0.75 1 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.75 1.25 1 0.15 NEW tendency tosag. embedded intothefreshlymilledwaxatanangletocells,eliminatingany Our finishedfoundationiswireddiagonallyandtheonecontinuouslength DIAGONAL WIREDFOUNDATION • [email protected] FFRAMESRAMES aandnd FFOUNDATIONOUNDATION 19 £3.50 £2.25 Sheets Sheets Sheets Sheets Sheets Sheets Sheets Sheets Sheets Sheets Sheets Sheets NEW 2 2 4 4 4 4 2 4 4 4 2 4 ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ 1 1 3 1 3 3 1 1 3 3 1 1 – THORNE BEEHIVES THORNE – on Squares. You can decide; maybe [email protected] • Sheets Sheets Sheets Langs Sheets Section Squares 3 Sect. Length 49 16 10 Sheets Sheets Sheets Sheets B.S. Deep B.S. Shallow Sheets Commercial Shallow Sheets Dadant 8 Section Squares 3 Sect. Length 11 7 Sheets 43 Sheets 8 15 Sheets B.S. Deep B.S. Shallow Dadant 13 Sheets 8 Sheets 9 4 2 2 4 4 2 2 4 4 4 4 4 2 ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ 1 1 1 1 3 1 1 3 3 1 1 1 1 Against purchase of goods, kg Outright purchase, kg NEW–WAX SERVICE CONVERSION a more personal Thorne are now offering wax conversion service. If you, or a group of beekeeping friends, have at least 500lbs (224kgs) we can convert this into foundation. beeswax back We guarantee you will get your own its provenance. so you have peace of mind knowing Any size of foundation is available. For more details call 01673 858555. BEESWAX CONVERSION AT THE EXHIBITIONS THE AT CONVERSION BEESWAX Straight Conversion and to offer our We are happy exhibitions: at the following Swap service Spring Convention, Ulster Beekeepers Bee Tradex, Spring Convention, BBKA Spring Welsh Beekeepers National Honey Show. Convention and the your crude wax and we will Simply bring along foundation. convert into premier £1.50 £1.05 £0.95 £1.16 £1.72 www.thorne.co.uk www.thorne.co.uk • “No Cash Straight-Swap” Sheets Sheets Sheets B.S. Deep Sheets B.S. Shallow Commercial Deep Sheets Dadant Deep Sheets 4 Sheets Langs Deep 5 9 14” x 12” 3 Commercial Shallow 4 10 Sheets 3 Sheets Sheets Sheets B.S. Deep Sheets B.S. Shallow Sheets Sheets Commercial Shallow Sheets Dadant Deep Sheets Dadant Shallow 5 Langs Deep 4 8 Langs Shallow 14” x 12” 5 3 Sheets 4 7 Sheets Langs 3 Sheets 4 Sect. Length 11 9 4 4 4 2 4 2 4 4 4 4 4 2 4 4 ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ ⁄ 1 3 1 1 3 1 3 1 3 1 3 1 1 1 You give us beeswax – We give you foundation You give us beeswax

British Standard Shallow British Standard Shallow British Standard Deep British Standard Shallow Thin Super British Standard Deep Thin Super Rose, OSB Commercial Deep Commercial Shallow Commercial Thin Super 20 Dadant Deep Dadant Shallow 12 Dadant Thin Super 14 Langstroth Deep Langstroth Shallow 8 Langstroth Thin Super 14” x 12” Section Squares 3 Section Length 4 Section Length 15 10 6 8 14 10 5 16 12 7 75 25 20 5

01673 858555

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

Wiring Dadant Deep & 14” x 12”, 10 sheets Wiring Dadant Deep of sheets per lb. Approximate number Wiring Shallow Foundation, 10 sheets Wiring Shallow Foundation, Deep, 10 sheets Wiring BS, Langs, Commercial over 25kgs/55lbs per pound

Up to 25kg/55lbs per pound Beeswax Conversion B.S. Deep 4 WIRED UNWIRED SUPER THIN B.S. Deep 3 WIRED UNWIRED SUPER THIN 14” x 12” 2 Dadant Shallow Langs Deep Langs Shallow 5 Sheets 3 6 Sheets Dadant Shallow Langs Shallow 6 8 Sheets 4 Sect. Length 13 Sheets B.S. Shallow Commercial Deep Commercial Shallow Dadant Deep Dadant Shallow 4 3 Sheets Langs Deep 6 Langs Shallow 14” x 12” 2 4 Commercial Deep 3 5 3 B.S. Shallow 2 Commercial Deep Commercial Shallow Dadant Deep 3 5 Sheets 6 2 Commercial Shallow 6 BEESWAX CREDIT If you have excess clean beeswax, we will buy it, either against purchase of goods or outright. BEESWAX TO CONVERT – Over 51 lbs. BEESWAX TO CONVERT – Up to 50 lbs.

The Straight Swap is exactly as it The Straight and we sounds. You provide the wax wired or swap it for Premier Foundation, Hands. unwired and No Cash Changes BEESWAX CONVERSION BEESWAX lb. per system provides for a The Conversion of crude wax into refined lb. exchange beekeeper pays for this foundation. The to which we add a on a per lb. rate if necessary. wiring charge We work out to the nearest sheet, always higher rather than lower. We work out to the nearest sheet, always higher rather If you need any help working it out, our staff will be pleased to help you. If you need any help working it out, our staff will be 4lbs BS Deep Wired (that will give you 15 sheets), that leaves 6lbs. for Section Squares (263 sheets). 4lbs BS Deep Wired (that will give you 15 sheets), that And your wallet stays firmly closed!! For example, you have 10lbs. beeswax to “straight swap”. You will use the top table. You want some BS Deep Wired and some Secti For example, you have 10lbs. beeswax to “straight The tables below show exactly (to the nearest quarter of a sheet) how many sheets per pound we swap. The tables below show exactly (to the nearest quarter 20 FFRAMESRAMES aandnd FFOUNDATIONOUNDATION Our museumandpart ofourapiary. rollers is62mm. Rollers are320mmlong.Diameterofindividual hexagonal cellshape. both sidesofthesheetwithaccurate 5mm thicksheet.Theengravedrollersemboss The plainrollerscompresssoftbeeswaxintoa or 4.7mmcellwidthforapismelliferascutellata. production. 5.4mmcellwidthapismellifera Precision mademanualrollersforhomefoundation mellifera scutellata cell formers.Cellsizesfor and hiddenmatrix,withsiliconerubber stainless steelconstructionincludinghinges Make yourownbeeswaxfoundationsheets.All SILICONE FOUNDATIONPRESS FOUNDATION ROLLERS British Standard,CommercialorLangstrothhives. Makes sheets420x245mm–suitablefor National WBC Smith Commercial Langstroth Dadant rmsadFudto Pie PackedWt. Price Silicone FoundationPress Frames andFoundation aly 1 9 1 0 10 11 8 10 3740 sq.ins. 10 11 2750sq.ins. 3000sq.ins. 10 11 2200sq.ins. 8 9 2000sq.ins. 10 8or10 2200sq.ins. 8 10 Deep 13 10 9,10or11 11 Foundation Bee Bottom Top Bottom Top No. Brood Area 11 Castellated Spacers Space Worker Wide Ends 50,000 45,00050,00070,50061,40085,000 Manley 11 10 *11*10 Hoffman Cells Super Frames Narrow Ends Hoffman Brood Frames 18 External Dimensions THORNE BEEHIVES– 01673 858555 (5.4mmwide)and (4.7mmwide)available. ue et 5 Super depth epboddph 12 Deep brooddepth ro et 8 Brood depth xr ep1x2o ub 13 Extra Deep14x12orJumbo Shallow 13 apis mellifera apis mellifera Section squares4 FRAME, HIVEANDFOUNDATIONSPECIFICATION 7 1 ⁄ £384.40 ⁄ 16 *N.B. Oneextrabroodframecanbefittedineachofthesebutmanipulationsareeasierasshownwithdummyboard. 8 7 7 ” x18 ⁄ ⁄ ” x11 16 16 7 7 1 ” 13 13 ” x5” ” x8” 1 ⁄ ⁄ 8 8 ⁄ ⁄ 2 8 ” 5 ” 8 ” 12 ” x4 1 1 ⁄ ⁄ 8 2 ” 16 • ” 13 10 THE COMPLETEEQUIPMENTSUPPLY COMPANY 3 www.thorne.co.uk ⁄ 16 3Sectionlength12 ” 21 3 17 ⁄ 1 4 ⁄ ” x16 7 2 ⁄ ” x21 Thin superfoundationsizes: 16 7 7 ⁄ ⁄ ” x11 16 16 7 7 ” 13 13 ” x5” ” x8” 1 ⁄ ⁄ 8 8 ⁄ 1 2 ” 5 ” 8 ⁄ ” 12 1 4 ⁄ ” brood 2 ” lifts 1 ⁄ 2 ” 13 7 3 ⁄ ⁄ 16 8 7 7 which thenheatsthe building. Our woodworkshop. Thesawdustandshavingsaresent to abiomassboiler SILICONE SPRAY FOUNDATIONLESS FRAMES,DN5 matrix immediatelybeforeuse.400ml. Assists withreleasingwaxduringfoundationmanufacture.Sprayontorollersor purchase asthebeesownwaxproduction. is nonecessitytorunwaxontheVasitwillnothavemuch and fillthevoidinframewithnaturalcomb.There The beesattachcombtotheVprojection with aVprofilecutontheunderside. bottom barandsolidtop frame withaonepiece frames. BasicallyaDN5 now manufacturingthese By populardemandweare ” x18 ⁄ ⁄ ” x11 16 16 rmsadFudto Pie PackedWt. Silicone Spray Price assembled10 Foundationless Frames,flat10 Foundation Rollers,Embossed Foundation Rollers,Plain Frames andFoundation 7 7 ” 15 15 ” x5” ” x8” 3 1 ⁄ ⁄ 8 8 ⁄ ⁄ 2 ” 6 ” 10 4 ” 11 ” x4 1 1 ⁄ ⁄ 4 2 ” 18 16 ” 3 ⁄ 16 4Sectionlength17”x ” 5 ⁄ 7 7 16 ⁄ ⁄ 16 16 ” x18 ” x5 ” x9 3 1 ⁄ 8 ⁄ 2 ” 5 ” 9 1 1 5 ⁄ ⁄ ⁄ 2 2 16 ” 16 ” 16 20”x16 ” • [email protected] 3 3 3 ⁄ 4 ⁄ ⁄ 4 4 ” x10 £35.20 £20.00 ” x4 ” x8 7 3 ⁄ £5.50 3 ⁄ POA POA 16 4 ⁄ 4 ” 6 ” 11 ” 1 7 5 ⁄ 3 ⁄ ⁄ 4 8 8 ⁄ 20”x18 ” 4 ” 16 ” 16 35 35 ” 0.8 3.0 2.0 3 ⁄ 16 ” 3 3 ⁄ 4 ⁄ 4 ” x10 ” x5 5 3 ⁄ 8 ⁄ 4 ” ” 1 3 ⁄ 3 ⁄ 2 4 ⁄ ” 4 ” ” FFRAMESRAMES aandnd FFOUNDATIONOUNDATION 21 6” ” 8 / ” 3 8 / 5 5 ” 8 1 16x6 / 5 Manley 1 2.5 8 15 50 15 50 2.5 8 Manley Langstroth ” 4 ” / 8 ” ” 1 / 3 ” 16 16 / 5 / 16 9 ” 9 / 8 9 / 3 1 – THORNE BEEHIVES THORNE – ” Shallow 8 / Langstroth 3 1 16x6 6” £18.00 £18.00 £87.00 £87.00 £18.00 £18.00 £87.10 £87.10 £169.15 £169.15 £782.56 £782.56 £169.15 £169.15 £782.56 £782.56

” in width making uncapping with a knife or 16 ” Langstroth - 19” ⁄ [email protected] 1 16 £20.90 £20.15 £97.90 / 1 £101.85 £197.60 £913.80 £189.85 £883.00 • 1 – also referred to as 16” x 6” – comprises the – comprises the Commercial Top bar, 16” x 6”

– comprises the Langstroth Top Bar, Langstroth ” Commercial (16x10) - 17 ” Commercial – comprises the Langstroth Top bar, Langstroth – comprises the Langstroth Top Bar, Langstroth jumbo ” Langstroth Manley - 17 ” 4 16 Langstroth Standard - 17 8 / / – also referred to as 16” x 10” - comprises the Langstroth one piece - 17 / 1 1 1 – comprises the Langstroth Top Bar, Langstroth deep side Commercial Manley (16x6) - 16” Commercial Manley (16x6) 1 9 11 Commercial Standard (16x10) - 16” Commercial Standard (16x10) Commercial (16x10) one piece - 16” Commercial (16x10) one 10” 16x10 £20.15 £97.90 ” in width making uncapping with a knife or machine easier. ” in width making uncapping with a knife or machine £189.85 £883.00 16 ⁄ Langstroth Deep 1 Langstroth Jumbo ” ” 8 8 / / ” 3 3 8 / 1 1 3 1 Frames Deep Jumbo Shallow Manley Packed Wt. Packed Manley Shallow Jumbo Langstroth Frames Deep 10 50 100 500 500 Commercial Frames 10 Deep 50 Shallow 100 Manley Packed Wt. FRAMES TO FIT A LANGSTROTH HIVE FRAMES TO FIT A COMMERCIAL HIVE A COMMERCIAL TO FIT FRAMES machine easier. Shallow size only. Langstroth Deep Commercial Deep piece 16” bottom bar. Commercial Top Bar, 16” x 10” side bars and two Commercial Shallow bottom bar. Commercial Top Bar, 16” x 6” side bars and two piece Commercial Manley bar. Both the top and bottom Manley side bars and the two piece Manley bottom bars measure 1 bars and two piece Langstroth bottom bar. Langstroth Jumbo side bars and two piece Langstroth bottom bar. Langstroth Shallow shallow side bars and two piece Langstroth bottom bar. Langstroth Manley Manley side bars and the two piece Langstroth Manley bottom bar. Both the top and bottom bars measure 1 Shallow size only. 2 7.5 14 50 ” 2 / 1 £20.90 5 ” ” £101.85 £197.60 £913.80 8 2 / /

5 1 B.S. 1 8 Manley DN4, DN5 www.thorne.co.uk www.thorne.co.uk £18.00 £87.10 £169.15 £782.56 •

” 2 ” ” / 8 2 / 1 / 3 1 1 ” £18.00 £87.10 2 ” at the bottom, and the two piece / 8 £169.15 £782.56 1 ⁄ 7

5 ” 8 ” wide top bar (a little stronger than the are identical to those above but have the / ” wide top bar (a little stronger than the 7 16 16 ⁄ ⁄ 12” ” wide top bar, the BS Manley parallel side 1 1 14x12 SN1, SN2 £16.00 £77.15 ” Smith - 15 ” top bar, the 14” x 12” Hoffman self spacing 16 ⁄ £149.65 £692.40 ” Smith - 15 16 1 16 8

⁄ / / 1 1 7 1 ” ” wide top bar, the DN1 side bar and the two piece ” wide top bar, the DN1 side bar and the two piece ” wide top bar, the DN4 Hoffman self spacing side bar ” wide top bar, the DN4 Hoffman self spacing side 8 8 8 / £15.20 £73.70 ⁄ ⁄ 3 7 7 £143.00 £661.34 ” 1 2 British Standard/National - 14”

/ 1 5 ” ” 2 British Standard/National Manley - 14” 8 / / 1 British Standard/National one piece - 14” 3 ” British Standard DN1, SN1, DN4, SN4 - 17” ” British Standard DN1, SN4 SN5 8 £13.15 £63.55 8 1 / £123.40 £570.85 7 – comprises the 1 DN1, DN2 ” in width making uncapping with a knife or machine easier. – comprises the 1 ” wide at the top tapering to 16 8 ⁄ ⁄ 1 3 – comprises the – as the D.N.1 but with a 1 – as the D.N.4 but with a 1 – comprises the ” British Standard DN2, SN2, DN5, SN5, Manley, 14" x 12" - 17” ” British Standard DN2, ” 8

/ 16 01673 858555 / 7 1 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

1 ” and discourages brace comb). ” and discourages brace comb). 10 BS Frames DN1 or DN2 or DN4 or DN5 or 12” BS Wt Manley SN1 SN2 SN4 SN5 14” x Packed 50 100 500 8 8 ⁄ ⁄ BS (BRITISH STANDARD) FRAMES TO FIT THE SMITH HIVE

BS (BRITISH STANDARD) FRAMES TO FIT EITHER THE BS (BRITISH STANDARD) CENTENARY HIVES NATIONAL, WBC OR FRAMES Shallow size only. Smith frames are identical to those for National and WBC but have a short lug as shown above. Prices are also the same. 7 D.N.2 7 D.N.1 type is the narrow 14” bottom bar. They should be spaced, the recommended brood body. plastic end. These are supplied as standard in the WBC See YouTube video to assemble a: See YouTube http://bit.ly/2DZZPkk Super Frame: • Brood Frame: http://bit.ly/2GvB3qz • Our frames are manufactured from the best quality, seasoned, Russian or best quality, seasoned, Russian manufactured from the Our frames are At first the British Standard specification. in accordance with Swedish softwood We hope the appear rather complicated. sizes and selection can glance, frames choice easier. will help to make your information below D.N.5 14” bottom bar. These are supplied as standard in our National brood body. BS Manley which is 1 shallow side bars for supers. S.N.1, S.N.2, S.N.4, and S.N.5 side bars and the two piece 14” bottom bar. 14” x 12” D.N.4 bar and the two piece BS Manley bottom bar. Both the top and bottom bars measure 1 22 FFRAMESRAMES aandnd FFOUNDATIONOUNDATION bars measure1 bars andthetwopieceDadantManleybottombar.Bothtop Dadant Manley and twopieceDadantbottombar. Dadant Shallow two pieceDadantbottombar. Dadant Deep Shallow sizeonly. For theWarreHive,totallyplain;320mmx25mm10mm. 2mm deepgroove. For theTopBarHive,theseare480mmx35mm12mmwitha4mmwideand They areusedwhenbeekeeperswiretheirownframes. These areavailableinBritishStandard,Commercial,LangstrothandDadant size. deep HoffmanselfspacingsidebarsandtwopieceBSbottombar. FRAMES TOFITADADANTHIVE TOP BARSFORBARANDWARREHIVES ONE PIECEBOTTOMBARS ROSE OSBFRAMES BURNETT 14”X12”EXTENSIONKIT These aremadetofittheRosebox,usingaBritishStandard supplied witheachkit. Gimp pinsforassembly hoffman converterclips. linked togetherusing to suit.Framepartsare special depthfoundation depth. Wealsosupply DN1 framestofull14x12 This kitwillextend10 Top BarforWarre Hive,10 Top BarforHive,10 with onepiecebottombars Additional costfor10frames Rose OSBFrames,50 Rose OSBFrames,10 500 100 50 Burnett 14x12ExtensionKit,10 Frames Price Packed Wt. PackedWt. Manley Shallow Deep 10 Dadant Frames 1 1 / 2 THORNE BEEHIVES– 01673 858555 ” Dadant Deep 1 ⁄ 16 11 ” inwidthmakinguncappingwithaknifeormachineeasier. – comprisestheDadantTopBar,deepsidebarsand 1 / 4 –comprisestheDadantTopbar,Manleyside ” –comprisestheDadantTopBar,shallowsidebars Dadant onepiece-17 Dadant Manley-17 £913.80 £197.60 £101.80 1 £20.90 1 Dadant -17 / 16 ” Dadant-19”

£782.56 £169.15 £87.10 £18.00 Shallow Dadant 9 1 / 16 1 / ” 2 ” £12.00 £77.17 £15.89 £11.00 9 6 / £7.83 £2.50 9 16 1 / / 16 4 ” • ” ” THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 1 3 7.5 2 1.5 7 / 8 ” topbar,7 50 15 8 2.5 Manley Dadant 1 5 / 8 ” 6 1 / 4 ” 1 / 8 ” FRAME PARTS LUG SAVERS foundation. supplied withwiredpremier unless otherwiserequested, are availableassembledand, foundation. Allsizesofframes wired, unwiredorthinsuper ready assembled,fittedwith Frames maybepurchased ASSEMBLED FRAMES pinned tothetopbarandsidebar. and canbesecurely of Nationalframes over thelonglug brackets thatfit galvanised Savers. Shaped use ournewLug out ofthemwhynot to ekeabitmorelife for eversoifyouwant frames willnotlast it. Thosehoneyladen when theyleastexpect to time...... normally frame lugsfromtime broken/fractured have experienced All beekeepersmust at Wt. Wt. BS Parts Frame Commercial Shallow orManley Commercial Deep Dadant ShalloworManley Dadant Deep Langstroth ShalloworManley Langstroth Jumbo PackedWt. Langstroth Deep Priceper10 14” x12” BS Manley SN4 DN4/OSB SN1 completewithends DN1 completewithends Assembled Frames Lug Savers,setof5 Wedge forDN1TopBar Bottom Bars,onepiece 2 piece,perpair All ManleyBottomBars, per pair All BottomBars,2piece, or 14”x12”sidebars Dadant Deep,LangstrothJumbo deep sidebars Langstroth orCommercial side bars All Manleyshallow side bars All Hoffmanshallow DN4 orOSBsidebars DN1 orSN1sidebars or Dadanttopbars Commercial, Langstroth BS 1 7 ⁄ 8 1 ” TopBars ⁄ 16 ” TopBars

£0.41 £0.29 £0.92 £0.92 £0.71 £2.50 £0.19 £0.58 £0.54 £0.39 £0.54 £0.50 £0.35 £0.41 • Price [email protected] Pce Packed 0.06 0.06 0.1 0.1 0.1 0.25 0.06 0.06 0.06 0.06 0.06 0.06 0.06 0.06 £47.34 £69.30 £47.34 £74.81 £45.37 £74.81 £58.02 £74.81 £43.57 £41.26 £46.74 £40.38 £46.15 £34.08 £21.53 £86.08 £86.08 £62.76 £12.98 £53.81 £50.23 £32.29 £50.23 £43.00 £28.70 £34.08 3.2 3.6 3.2 4.4 3.2 4.4 4.2 4.4 3.2 3.2 3.6 3 3.4 100 Packed 1 3.3 3.3 2.2 4.8 4 3.5 3.3 3.6 2.6 10 10 7.4 SSECTIONSECTIONS 23 7.1 6.2 7.1 7.3 4.3 3.2 4.3 4.5 4.1 1 4 3 0.7 0.15 0.25 £7.00 £2.00 £4.60 £76.80 £66.50 £73.50 £82.70 £68.35 £14.10 £67.00 £56.70 £144.40 £128.00 £134.70 £146.30 – THORNE BEEHIVES THORNE – [email protected] • Half comb Sections Rack, Complete 30 Half comb Sections Acrylic top cover Price Packed Wt. Weight Packed Price Sections National/Commercial, complete with timber sections, assembled WBC, complete with timber sections, assembled Langstroth, complete with timber sections, assembled Dadant, complete with timber sections, assembled Smith, complete with timber sections, assembled Complete Section Frame with all rings, covers and labels Section rings, 4 pairs Covers, opaque or clear, 4 pairs National/Commercial rack complete with round sections, assembled WBC Rack complete with round section, assembled Langstroth Rack complete with round sections, assembled Dadant Rack, complete with round sections, assembled HALFCOMB SECTIONS SECTION RACKS COMPLETE WITH SECTION RACKS COMPLETE DIVIDERS TIMBER SECTIONS AND ROUND SECTIONS PLASTIC SECTIONS SECTION RACKS COMPLETE WITH ROUND SECTION RACK CAPACITIES RACK SECTION Each hanging rack holds 30 half-combs and fits snugly into a National or WBC super. Once complete the rack can be removed and emptied. Each half comb has a separate clip on lid, seal this with clear sellotape, add one of our comb labels and that’s it, ready for sale. Each comb holds approx. 12 oz. As an optional extra we can supply a 5mm thick clear acrylic top cover, so that comb building can be viewed easily. Section Rack Section Rack Round Section Frames National Langstroth Timber Sections 10 frames = 40 sections Dadant = 36 sections 9 frames Smith 4 rows of 8 = 32 sections WBC 10 frames = 40 sections sections 4 rows of 7 = 28 WILL NOT FIT 4 rows of 8 = 32 sections 9 frames = 36 sections = 28 sections 4 rows of 7 24 sections 3 rows of 8 = that will All plastic section frames bees produce circular combs. The as there seem to prefer this shape fill. are no difficult corners to Frames have built in dividers and are re-usable. The completed section is packaged using rings, clear and opaque covers and the labels to ‘tie’ the package together. Each frame holds four sections. NOTE: Round sections will only fit into section racks not standard supers. 2.4 3.4 0.15 3.3 £1.70 £17.35 £22.30 £20.90 www.thorne.co.uk www.thorne.co.uk 0.5 3 0.4 0.5 1 0.6 0.8 1 •

£5.40 £48.90 £11.20 £12.60 £19.00 £10.55 £13.30 £17.80

£30.40 £28.60 £23.70

01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

English/Irish, 100 Hanging Section without dividers, flat Hanging Section with dividers, flat Section Dividers, 3 size, 10 Section Dividers, 4 size, 10 Hanging Section Dividers, 10 Hanging Section complete, assembled English/Irish, 10 Sections Price Packed Wt. Packed Sections Price National/Commercial, empty Section Racks Assembled Flat Packed Wt. Langstroth/Dadant/Smith, empty Retaining Spring N/A WBC, empty SECTION RACKS AND SPRINGS SECTION DIVIDERS

HANGING SECTIONS SECTIONS See YouTube video: http://bit.ly/2Fuz6tg Made in Western Red Cedar and available for all hives. Retaining spring included. Purpose built full size racks for holding sections securely in the hive. Dividers are placed between each row of sections preventing brace comb and ensuring an attractive level capping. Manufactured in 1mm white polystyrene. Four section size for National/Commercial, Langstroth, Dadant and WBC or three section size for Smith. The plastic dividers have the advantage of being easy to clean, no sharp edges and more importantly, they are ‘warm’ for the bees. Hanging Sections available in BS size only. See YouTube video: http://bit.ly/2EpZwNE A convenient way of obtaining A convenient way of obtaining a few sections. The hanging frame can be placed in a of super occupying the space two frames. Hanging dividers must be used to prevent brace comb from being built onto the adjoining standard frames. Available in BS size only. See YouTube video: http://bit.ly/2rUsUZs The grooved with split top type is sometimes called The grooved with split top the section square the English pattern and takes split type is also available, foundation. A three sided This is used with 3 often called the Irish pattern. i.e. one sheet of or 4 section length foundation, 3 or 4 sections. foundation is slotted into Sections were once the most popular way of producing comb once the most popular way Sections were Welwyn would regulary ship early fifties EH Taylor of honey. In the crates to Ireland for comb of these small wooden over 2.5 million but they are not as popular now production. They comb product for marketing are still the premium honey. 24 EENTRANCENTRANCE FFITTINGSITTINGS aandnd SSWARMSWARMS bars. Langstroth 14 In threesizes:-National/Commercial,DadantorSmith-16 Made ingalvanisedsteel,plasticandstainlesssteel.Thelatterareacidproof. Suitable forframeswith is 1 bar clearforeasycleaning.Spacing side oftheframe,keepingtop into theselfspacingtype.Fiton Easy tofitplasticclipsturnframes out. to staggerthespacersuntilcombsarepartiallydrawn you findthisspacinginitiallytoowide,itisagoodidea In naturalonly.Canbestaggeredaswidemetalends.If 1 brood bodyis1 Made inourownworkshopsfrom0.38mmcoils.Narrowsize,usuallyusedthe to codequeenageorapiarysystem. Extremely durablewithnosharpedges.Usethecolours from WBCandCentenary. fittings, willfitallhivesapart predators. Completewith robbing beesandother entrance devicethatdeters This isaFullWidthgalvanised available. screws included.Allsizes board forallhives.Fixing provide asturdyalighting solid lengthofcedar angled bracketsanda A pairofhandedand SLOPING ALIGHTINGBOARD FRAME RUNNERS HOFFMAN CONVERTERCLIPS METAL ENDS WIDE PLASTICENDS NARROW PLASTICENDS ANTI ROBBINGDEVICE Hoffman ConverterClips,50 Wide MetalEnds,50 Narrow MetalEnds,100 Wide PlasticEnds,100 Narrow PlasticEnds,100 Anti RobbingDevice unr Pi Pce t 1 ar Packed Wt. 10Pairs PackedWt. Pair Metal FrameRunners Runners Sloping AlightingBoard Spacers Price Packed Wt. Runners Stainless SteelFrame Plastic FrameRunners 7 / 16 3 ” spacing.Inred,green,blue,yellowornatural. / 8 ”. THORNE BEEHIVES– 01673 858555 1 / 2 7 ”. / 16 ” spacingandwide,usedinsupers,is 7 / 8 ” wideside £3.00 £1.00 £1.45 0.2 0.15 0.2 £10.55 £10.00 £6.00 £5.90 £7.50 £5.00 £7.30 • 0.7 0.5 0.65 0.2 0.2 0.75 0.75 THE COMPLETEEQUIPMENTSUPPLY COMPANY £25.00 £10.55 www.thorne.co.uk £8.20 1 7 1 / / 8 2 ”. ”, WBC-15”and 1.2 0.6 1.2 Fitted asabove. of thehive.Greatformovingbees. ventilated sideforcompleteclosure Similar toabovebutoneedgehasa of thefloorentrance.SuitableonlyforNationalHives. the striplocatesonthisstopwhenslidinfromtop.Itthereforehangs front box ofthehive,notfloor.Eachfixingbrackethasoneclosedend,lug of the deviceisfittedtobrood etc. enteringthehive.Notethat sides topreventmice,rats,birds 440mm long.Castellatedonboth Very robustreversiblemetalstrip its headandsimplypressintoposition.Easy.95mmlong. and expensiveondrawingpins!Thissimpletoolistheanswer.Pickupapinby when wearinggloves.Itisveryfiddly,frustrating standard mouseguardtoahivewithdrawingpins How manytimeshaveyoustruggledtofita 0.5mm. nucleus hives.200x38 Mini Mouseguardtofit Available forallhives. with drawingpins. entrance. Heldinposition that fitsontothehive A simplegalvanisedstrip slot only. also haveslightlyshorterspacerstonailintotheinsideofourbudgetsuper.10 means youcanexperimentandchangethespacingofyoursuperswithease.We WBC supershaveslotstoaccommodatespacerswhichsavesnailingandalso or 10slotforWBCand9,11National.OurfirstqualityNational We recommendthistypeofspacerforNationalandWBCsupers.Availablein8 MOUSEGUARDS CASTELLATED SPACERS VENTILATED MOUSEGUARD CASTELLATED MOUSEGUARD SNOWLEY MOUSEGUARDMAGNET MINI MOUSEGUARDS nrneFtig Pie PackedWt. Price Ventilated Mouseguard, per10 Ventilated Mouseguard,each Castellated Mouseguard,per10 Castellated Mouseguard,each Snowley MouseguardMagnet Mouseguard, anysize,per10 Mouseguard, anysize,each Entrance Fittings Super, 10pairs Castellated SpacerforBudget Super, pair Castellated SpacerforBudget Castellated Spacers,10pairs Castellated Spacers,pair Spacers Price Packed Wt. • [email protected] £20.00 £20.00 £21.10 £21.10 £2.50 £2.50 £3.50 £7.50 £0.84 £2.35 £2.35 2 0.3 2 0.3 0.1 0.75 0.2 1.3 0.25 1.3 0.25 EENTRANCENTRANCE FFITTINGSITTINGS aandnd SSWARMSWARMS 25 2.5 0.5 0.45 0.15 0.06 0.1 0.1 0.2 0.2 0.15 – THORNE BEEHIVES THORNE – £3.60 £6.80 £0.80 £0.46 £1.80 £1.30 £1.60 £65.00 £10.50 £16.00 [email protected] • Swarms Price Packed Wt. Packed Swarms Price Horsley Board Uniting Board Plastic Disc Entrance Orientation Disc, each Orientation Disc, set of 5 Steel Disc Entrance Entrance Fittings RoBo-Block Expanding RoBo-Block Orientation Guard, each Orientation Guard, set of 5 Price Packed Wt. HORSLEY BOARD UNITING BOARD PLASTIC DISC ENTRANCE ORIENTATION DISCS STEEL DISC ENTRANCE ORIENTATION GUARDS ORIENTATION An adjustable disc that can be used as an alternative to the An adjustable disc that can It has four openings: completely traditional floor entrance. ventilation or ‘queen excluder open or closed, closed with Diameter 190mm. segment’ to prevent . A very effective swarm control board. Invented by Yorkshire-man, Arthur A very effective swarm control board. Invented by Horsley. two stainless steel expanded Substantially made from 12mm ply and cedar with mesh panels and stainless steel adjustable entrance. Queen excluder is also steel. Have available a spare brood body with frames and foundation, or drawn comb. Carry out weekly inspections looking for signs of swarming, mark queen if seen as this will help later. A simple rectangle of plywood that fits both a Langstroth or National Hive for the purpose of uniting/transferring a colony from one type of hive to another without the need to improvise the blanking off of exposed frames. Green, blue, red, yellow and white Green, blue, from 4mm thick plastic. guards. Made one edge and castellated Ventilated on Colours assist bees on the other. way home. Screw in finding their slight angle to ends of brackets at a ensure guard stops in floor joists to position. Length 403mm. white Green, blue, red, yellow and mini-nuc entrance discs suitable for and beekeeper! identification for both bees or Turn to adjust to open, ventilated excluder position. Diameter 52mm. closed, Strong, galvanised steel disc with settings for fully open, queen excluder and ventilated. Diameter 125mm. mode www.thorne.co.uk www.thorne.co.uk 0.2 *Fully closed • *Anti-robbing *Ventilated *Mouseguard £6.99 *Pollen Stripping 01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING Wasp Out Wasp Out Price Wt. Packed RoBo-BLOCK WASP OUT WASP See YouTube video: http://bit.ly/2Gw5uwQ This entrance block has a spring loaded feature at one end enabling it to be used in any hive entrance from Langstroth to Dadant width. It has all the features of a regular Robo-Block. Expanding Robo-Block For those keen to examine the pollen the hive is collecting, turn the block away from you through 90 degrees and expose a 6mm entrance slot on the left-hand side (this also acts as a mouseguard) plus a bank of 5mm pollen stripping holes on the right-hand side with an alloy slide to expose either feature. Below the stripping holes is a shallow, removable tray which collects the pollen samples. This will only need to be set to pollen stripping for a matter of minutes as samples will build up rapidly. In its main position the block is either an entrance ventilator of 3mm holes on the right-hand side or an anti-robbing device of 6mm holes on the left-hand side, with a further row of 6mm holes off-set on the opposite side. Bees in the hive can find their way out and back again. Robbing bees or wasps find it difficult to negotiate both banks of holes. The adjustable alloy slide is used to close the entrance as required, exposing the ventilation holes. Also in this position, the slides can be extended outwards and tacked/screwed to the floor joists. In this position the hive will be completely closed and secure if you are planning to move it any distance. Made from 20mm aluminium profile, the same size as a regular entrance block. Developed, tested and manufactured at Rand. The only entrance block you will ever need. Made for National (405mm), Commercial (405mm), Dadant (425mm), Langstroth (367mm) and Smith (417mm) hives. Please advise length of entrance if you think your floor may be a different size. Opening must be at least 20mm high. This year they have recently been placed on an 8 colony apiary on another This year they have recently been placed on an 8 colony private estate with the same results. Following discussions with Thornes I adapted the wasp out using a ‘flat’ tube Following discussions with Thornes I adapted the wasp and have had them in use ever since. This was repeated throughout this last season in both apiaries with the same This was repeated throughout this last season in both results. I made five for my own use for last season. None of the hives on either apiary I made five for my own use for last season. None of the jam traps filled up more were predated by wasps . What we did find was that could not find their way in quickly with wasps, leaving us to believe that wasps to the hives and chose the traps instead. By the beginning of the 2015 season I had created the Wasp Out prototype By the beginning of the 2015 it would work, I showed a fellow beekeeper in but having no idea whether and he made six, with my agreement, for one of his Cirencester the prototype, apiaries. I overheard two experienced beekeepers discussing the wasp issue and one said beekeepers discussing the wasp issue and one I overheard two experienced this I wondered how I could create an entrance wasps don’t like tubes. Following block that resembled a tube. Having taken all usual wasp precautions, jam jar traps and hanging traps I still precautions, jam jar traps and hanging traps I still Having taken all usual wasp and one at home. lost two at the private estate Inventors Experience single brood, colonies on a private estate near Three years ago I had three on my home apiary. Ampney Crucis and three Wasp Out - a Wasp Out - a simple entrance block to help prevent robbing. The block is and 415mm long to fit a standard should be trimmed below is open mesh floor. The text written by the inventor. 26 SSWARMSWARMS Needs dailyattention. Full instructionssupplied.Patented.Nationalsizeonly. The swarmtrapcatchesthequeenassheleaveshiveduringaswarm. branch waitingforyourreturn! following week,whilstatwork,andwouldnotbesittingcontentedlyonalow weather. Inthesecircumstancesyoucanbesureaswarmwouldcomeoutthe colonies overtheweekendonlytohaveyourplansshatteredbyadverse How oftenhaveyoubeenfullofgoodintentionsonaFridaynighttoinspect impossible duetowork/familycommitmentsandunpredictableweather. to removequeencellsalmost who findsweeklyinspections with thehobbybeekeeperinmind The SwarmTrapwasdeveloped for closingthetop.Woodenpolenotincluded. strong canvasandplatedsteelwithnylonropepullcord Ideal forthosejust-out-of-reachswarms.Madefrom Capacity 500ml. swarms. Repeatevery8daysduringtheswarmingperiod. hive. Lightlysprayattheentranceandinsideabaithivetoattract of stronglyscentedflowerswhichattractswarmstothedecoy This highlyperfumedsprayisalmostentirelymadeoftheessences secondary swarms(headedbyoneormorevirginqueens). ways tousethelureattractprimaryswarms(headedbyoldqueen)and products/honeybee-swarm-attractant-wipe/) andlearnaboutthedifferent — readabouttheresearchhere(https://www.vita-europe.com/beehealth/ Rigorous universityresearchhasshownthatthelureattracts60-90%ofswarms container, oritcanbewipedoverthesurfaceofcontainer. and hunginanemptyhive,skeporothersuitable To activate,thesachetcanbepiercedortornopen oils extractedfromplants. cleansing wipe.Itisimpregnatedwithessential It comesinasmallsachetandresembles attractant. leaving theapiaryifabaithivecontains attractant. Itwillevenreducetherisksofswarms places intoaskeporboxcontainingtheswarm temporarily hangingintreesandotherawkward to attractpassingswarms,andlureswarms Vita’s HoneybeeSwarmAttractantWipehelps SWARM WIPES SWARM TRAP SWARM CATCHER API-CHARM swarming inthearea). 50-80% swarm-catching box.Researchshowsthat,onaverage,swarmsfromtheareawilloccupy Synthetically producedNasonovwillattractswarmstounoccupiedhiveequipmentora scent fantoattractothers. the hiveentrance.Also,whenanairborneswarmbeginstocluster,earlyarrivingbeeswill glands andfantheirwingsvigorously.Thisiscalled“scentfanning”.Beesmaydothisat colony. Tobroadcastthisscent,beesraisetheirabdomentwhichcontaintheNasonov Nasonov pheromoneisreleasedbyworkerstoorientreturningforagerbeesbackthe calls to“comegetaswarmofbees”. add toyourhivecountandhoneyyieldmaywellprevent Stray swarmsfromotherhivesinthearea,ifcaptured,will hives thusreducinglossofbeesandhoneyduetoswarming. Swarm Lure control measures. always enoughtimetocarryoutthenecessarypreventionand Swarming isoneofthebeekeeper’smajorchallenges.Thereisn’t SWARM LURE Swarm Lure Swarming Price Packed Wt. PackedWt. Price Swarm Wipes(packof10) Swarm Wipes Swarm Trap Swarm Catcher Api Charm THORNE BEEHIVES– 01673 858555 ofcatchboxescontainingNasonov(providedthereisareasonableamount cancapturemanyswarmsfromyourown £51.25 £65.26 £13.00 £4.00 £13.99 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.1 2 2.5 0.75 0.06 diameter (approx.). and beeswaxbasedcosmetics.260mmhigh,360mm for windowdisplaysmarketinghoney,candles handy intheapiaryforcatchingswarms.Alsoused Hand madeandverysturdy.Veryusefultohaveone united. Queen cellsinthetopboxesshouldbedestroyedandtwobroodlater Close bottomleft andtopright,openbottomrightback. Day 14: Closetopleft,openbottomleftandright. Day 7: Opentopleftentrance. Day 4: Snelgrove boardunderthetopboxandmanipulateentrancesinsequence. finally anotherboxwithalltheotherbroodframes.Fourdayslater,put with otherbroodlessframe,atthebottom,thenaqueenexcluder,supersand as follows:-Reorganisethehivewithqueenononeframeofopenbrood, lower partofthehive.Manyvariationsinusearepossible–hisfirstmethodis the colonyandcontinuouslybleedingyoungbeesfromatopbroodboxto few hivesinthegarden.Itreliesonsplitting method issuitableforthebeekeeperwitha Snelgrove’s ingeniousswarmcontrol swarm control. Snelgrove asthedefinitiveworkon its ControlandPrevention” by hole. Werecommend“Swarming, Perforated steelmeshovercentral on threesidesaboveandbelow. All sizesavailable.Hingeddoors long, 260mmhigh,wide. when usingSwarmLure.465mm housing aswarmorasbaithive only. Alsousefulintheapiaryfor the top.AvailableinNationalsize Ventilation holesinbothsidesand 6 frames.Idealformovingnucleii. Sturdy plywoodboxwhichwillhold SNELGROVE BOARD TRAVELLING BOX SWARMING ANDITSCONTROL STRAW SKEP Straw Skep Snelgrove Board,WBC Snelgrove Board,allsizesexceptWBC Travelling Box Swarming Price Packed Wt. Swarming it entirely. Any ofthefollowingwillreduceamountswarming still emergewithvirginqueens. and perhapshalftheworkers(mostlyyoungones).Subsequentswarmsmay colony willswarmeveryyear.Thefirstcontainstheoriginalqueen, will produceswarms–mainlyinMay,JuneandJuly,althoughnotevery minimise thenuisancethatourbeescause.Lefttotheirowndevices,colonies Watching aswarmisglorioussight,butitourdutyasbeekeepersto the season. queen. Ifincreaseisnotneeded,thetwo coloniescanbereunitedlaterin out allthenewqueencells,leavingone openone.Thiswillproducethenew bees gobacktotheoldsite.Cutoutall queencells,andoneweeklater,cut The otherportionofthehivemaybelocatedanywhereinapiary.Flying bees) goontothenewbroodbox. it upwithnewframesandfoundation.Thequeenexcludersupers(with position. Putinthenewboxoneframeofbroodwitholdqueen,andfill move thehivetooneside,andputanewbroodboxfloorinsame frame onceaweekforqueencellswitheggsorlarvae.Iftheyarefound, the artificialswarmwhichisdescribedineverytext.Examineeachbrood There arenumerousswarmcontroltechniques.Oneofthemostreliableis . Removesomebeesand/orbrood. 4. Givethemfoundationtodrawout. 3. Keepyoungqueens. 2. Giveplentyofroominthesupers. 1. . Cuttingoutoccupiedqueencells. 2. Clippingthequeen. 1. will notbeprevented £56.00 • [email protected] simplyby £41.00 £32.00 £37.80 2.9 2 2 3 but noteliminate SSMOKERSMOKERS aandnd TTOOLSOOLS 27 0.3 0.6 0.4 0.2 0.2 0.25 0.1 0.2 0.15 0.2 0.2 0.3 0.35 0.15 0.25 0.25 0.15 0.2 0.25 0.25 0.35 0.2 0.5 £6.00 £6.00 £7.50 £9.00 £5.00 £11.00 £16.00 £14.50 £10.00 – THORNE BEEHIVES THORNE – £10.00 £4.00 £6.70 £7.90 £4.25 £10.00 £15.00 £12.50 £15.50 £8.85 £5.00 £12.00 £1.50 £10.00 [email protected] • Palm Tool, large Starkey Frame Release Tool Grip Tool Roll Frame Cleaner Hive Tool and Frame Lifter, stainless steel Frame Lifter, stainless Hive Tool and M2 Hive Tool Tool Claw Hive C1 Hive Tool C2 Hive Tool C3 Hive Tool C4 Hive Tool C5 Hive Tool Pocket Hive Tool Frontier Hive Tool C6 Hive Tool C7 Hive Tool C8 Hive Tool C9 Hive Tool C10 Hive Tool Frame Tools Frame Grip Price Packed Wt. Frame Tools Palm Tool, small Price Packed Wt. Hive Tools Hive Tools stainless steel Standard design, Price Wt. Packed FRAME GRIP TOOL GRIP A frame grip as above, with the addition of a tool to release frames from the runners. Overall length 270mm. TOOL ROLL Keep all your hive tools and pieces of equipment in this nifty tool roll. Simply put the tools in the pockets, roll up and tie and you are ready to go. Velcro fastening with seven different size and depth pockets. Tools not included. Also available in green camouflage fabric. FRAME CLEANER PALM TOOL STARKEY FRAME RELEASE with A useful spring loaded device for gripping a frame one hand, particularly useful with short lugged frames. Stainless Steel tool with ‘swan’ neck for ease of use. For cleaning frame grooves and wedges. 220mm long, 120mm handle. A totally new design of the hive tool. The Palm Tool is carefully A totally new design of the hive tool. The Palm Tool use and hold. designed to fulfil several tasks yet be comfortable to Both sizes incorporate a scraper/lever blade, a frame is lifting hook and a Starkey frame release cam. Small suitable for glove size 9 and below and the large one for bigger hands. This stainless steel tool, developed by one of our customers in France, simply and easily releases all an 11 frame box. Will frames from runners with a swift quarter turn, assuming size only. not work if 12 frames are in the brood body. National C3 C2 C5 C1 C4 C8 C9 C7 C6 C10 www.thorne.co.uk www.thorne.co.uk • Stainless steel. , Stainless steel, , Stainless steel, Stainless steel with a 160mm long and 35mm This very sharp stainless steel This very sharp stainless steel 276mm long, 44mm wide, a 276mm long, 44mm wide, Specifically designed for use Nicely balanced hive tool with a Sturdy tool with heavy hammer An extra long and extra strong An extra long and extra strong A small and useful galvanised Z shaped, stainless steel tool that We saw this new knuckle tool A multi-use stainless steel tool Traditional hive tool with Very strong stainless steel tool 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS in top bar and Warre hives. Solid wooden handle with a 355mm stainless steel shaft and a 90 degree 45mm long hook. The hook is sharp on both sides so allows you to chop both down and up through the comb steel tool that won’t break the bank! 205x30mm. will assist greatly in prying free stubborn frames. 255x40mm wide. being demonstrated at Apimondia in South Korea recently. Extremely well made and finished, the tool is also well balanced and a comfortable fit in the hand. It also has two very sharp traditional scrapers as well as a frame lever. 240x55mm at widest point. with central wooden grip that has a variety of features. Toothed frame lever, flat scraper, angled scraper, hammer (head part can be removed), frame cleaner and excluder cleaner. 270x90mm at its widest point. variety of features. Scraper, nail puller, frame lever and prising blade. Riveted wooden handle 260mm x 70mm at widest point. comfortable, triple riveted wooden handle. 200x45mm 260 mm long 85mm wide. 40mm chisel and scraper and 40mm lever hook. end. Comfortable to hold and suitably balanced. Great for quick frame or hive repairs. Good lever action for removing nails. 220mm long 40mm wide. stainless steel tool. Ideal for 'breaking' hive parts and clearing brace comb deep inside the largest of brood bodies. 390mm long and 40mm wide. longer, tempered steel version of the very popular longer, tempered steel version hive tool and frame lifter. tool is exceptionally strong with a ridged claw tool is exceptionally strong 210 mm long with attachment for levering frames. nature of its design, two 35mm scrapers and by virtually unbendable! wide, this little tool fits easily and comfortably into all pockets. Stainless steel with frame lifter and chisel tip. With that useful hook for levering frame ends With that useful hook for 230mm long, 35mm wide. C10 Hive Tool C9 Hive Tool C8 Hive Tool C7 Hive Tool C6 Hive Tool serrated claw at one end and scraper at the other. Handy hole for removing nails or hanging up the tool when not in use. Frontier Hive Tool Pocket Hive Tool C5 Hive Tool C4 Hive Tool C3 Hive Tool C2 Hive Tool C1 Hive Tool Claw Hive Tool M2 Hive tool, Hive tool and frame lifter Hive tool and frame Traditional Standard Tool Traditional HIVE TOOLS HIVE equipment. and indispensable piece of An essential are available. Sixteen types blades, very with 45mm wide scraper 220mm long top bars. useful for cleaning 28 SSMOKERSMOKERS aandnd TTOOLSOOLS 600x100mm. area is open, exposed when fully 860x610mm frames. expose other Slide acrossto be takenout. a frameto down. Thecentresectioncanbefoldedovertoclose,orbackallow Heavy canvaswithstainlesssteelrodssewnintotheedgestoweightcloth floor withease. length 700mm.Removefloordebrisandcleanoutwaxmothfromundermesh Stainless steelshaftandblade,rubberhandle.Bladeis100mmlong,overall 115mm woodenhandle. scraper. Overalllength220mm, accurately machined10slotwire blade 65mmwideandsimilarwidth excluders. Stainlesssteelshaped than awirebrush.140mmlong,58mmwide. effective cleaningofwireexcluders,mucheasier of thebroodbox. tool foreasingafullframeout A twoprongedstainlesssteel Smith sizes. Commercial and Langstroth/ Dadant, body. National/ out ofthebrood that firstframe Somewhere toput FRAME REST MANIPULATION CLOTH FLOOR SCRAPER WE2 WE1 WIRE EXCLUDERCLEANER FRAME LEVER Frame Rest Tools Price Packed Wt. Manipulation Cloth Floor Scraper WE2 WE1 Frame Lever Adoubleheadedtoolforcleaningwire Stainlesssteel“comb”forsimplebutvery THORNE BEEHIVES– 01673 858555 £25.60 £18.70 £7.50 £10.50 £5.00 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk £6.00 1.0 0.7 0.2 0.15 0.2 0.3 Note: Smallbasketwillnottakesmokercartridges. Small: 170mmhigh,70mmdiameter. Large: 220mmhigh,90mmdiameter. The basketwillprolongthelifeofsmokerandkeepitcleaner. When alightusetheliftingeyetoplacebasketinyoursmoker. enable youtoloadandlightyoursmokerfueloutsidethesmoker. shaped tofitourlargeandstandardEmpiresmokers.Thesewill Simple galvanisedsteelbasketswithintegralfuelplatform, range only.Pleasespecifylargeorstandard. Spare gridsforthefireboxareavailableEmpire 215mm. 100mm, height dia. Large: Firebox height 180mm. dia. 75mm, Standard: Firebox steel. copper orstainless galvanised steel, Made ineither optional extra. Wire guardsarean bolt onbellows. In twosizeswith workshops. produced inourown British smoker, The traditional EMPIRE SMOKERS chamber. 350x100x100mm excluder scrapersintheother in theCaddy.Storehivetoolsand in thelargeroftwochambers and excluderscollectthewax Scrape bracecombfromframes any broodbodyduringinspections. Caddy clipsneatlyoverthesideof galvanised steelandpine,this of equipment.Madefrom0.8mm you willfind,indispensiblepiece A useful,inexpensiveandwethink TOOL ANDSCRAPWAXCADDY SMOKER BASKETINSERT SMOKER GRID Basket, Large Basket, Standard Galvanised, Large Galvanised, Standard Stainless Steel,Large Stainless Steel,Standard Copper, Large mieSoes ihu Wt Packed With Without Copper, Standard Guard Empire Smokers Guard Wt. rm ol Pie PackedWt. Price Tool andScrapWax Caddy Frame Tools PackedWt. Price Grid, LargeorStandard Smoker Spares • [email protected] £46.00 £56.50 £47.80 £42.25 £35.35 £54.30 £9.00 £7.50 £2.00

£52.00 £62.75 £54.00 £48.20 £41.30 £60.40 £8.00 1.5 0.4 0.3 0.1 2.1 1.8 2.1 1.8 2.1 1.8 NEW SSMOKERSMOKERS aandnd TTOOLSOOLS 29 0.25 1.1 27 0.06 2.1 0.1 0.7 0.5 5.0 1.2 – THORNE BEEHIVES THORNE – £9.80 £5.40 £66.00 £2.00 £12.00 £0.53 £4.75 £5.75 £3.00 £7.50 [email protected] • Smoker Fuel Stick Lighters Price Packed Wt. Smoker Fuel Smoker Cartridge, each Price Packed Wt. Smoker Pellets, 1kg Smoker Pellets, 25kgs Liquid Bee Smoke Apifuge Smoker Cartridge, 10 Smoker Cartridge, 10 Hessian Sacking Wood Chip, 5kg CC Smoker Fuel, 1kg LIQUID APIFUGE Direct from a cotton processor in the USA this clean, cotton processor in the USA Direct from a and cotton consists of short fibres raw cotton waste high pressure. are compressed under seed husks that shape for (CC) are the ideal The Cotton Cartridges a cool When alight it produces smoker fireboxes. the best free of all chemicals. Probably white smoke, light: ensure have come across. To smoker fuel we opened. If compacted it the cotton is “teased” and will not light easily. STICK LIGHTERS friendly, Small sticks of environmentally compressed, cellulose fibres, straw and saw dust. Ignites very quickly even in the most adverse conditions. Works exceptionally well with Smoker Pellets but not exclusively. When lit it will burn for hours in the heart of a smoker. Pack of approx. 100. SMOKER PELLETS Bags of compressed, straw based pellets which make an exceptional smoker fuel. The smoke produced is white and very cool with a pleasant burnt straw aroma. It lights very easily and will burn for hours without the usual need of pumping the bellows. It is made from 1kg or 25kg bags. 100% natural products without any chemical additives. Liquid Bee Smoke is made from a concentrate which is edible to humans. Dilute this 30g sachet in 1 litre of water. Use a trigger spray to administer as if it was a smoker. Smells exactly like smoke. Enough solution for 250 hives. Apifuge is a substitute for a traditional smoker in a variety of operations – quick inspections, clearing supers and simple manipulations. As your confidence and experience grows, spray on to hands immediately before opening the hive – no need for gloves. Capacity 500ml. CC SMOKER FUEL CC SMOKER 3 1.3 0.75 £17.50 www.thorne.co.uk www.thorne.co.uk • £60.00 £12.30 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Dadant Smoker Smokers Price Packed Wt. Packed Price Smokers Electric Smoker Bellows, Screw-on or Bolt-on Bellows, Screw-on or Smoker Spares Price Packed Wt. WOOD CHIPS Redwood and cedar wood chip made in our chipping plant from our own wood waste. Burns readily with a cool white smoke. 5kg bag. Smoker not included. HESSIAN SACKING Easy to light with a cool environmental friendly smoke. Approx. 1 x 1.5 m per pack. We find this burns very well if it is cut into strips about the same depth as the firebox of your smoker. Loosely roll to approximate diameter. Cut four or five times halfway across the roll - not all the way through. SMOKER CARTRIDGES Simple small reels of corrugated paper cut to fit standard smokers. 75 x 125mm. ELECTRIC SMOKER DADANT SMOKER Firebox measures 100mmx200mm high. Complete with wire guard. An inexpensive stainless steel smoker with battery operated fan, (takes 4AA batteries). This extra large classic stainless steel This extra large classic stainless from Australia smoker is in use in apiaries mm to Zimbabwe. Firebox 100x250 with wire heat shield and hanging hook. This very high quality smoker is manufactured in the USA by probably the oldest established bee equipment supply company in the world. SMOKER BELLOWS SMOKER bellows are Replacement the majority of available to fit have either the smokers. We using a wing nut bolt-on type smokers or suitable for Empire type suitable for the the screw-on Alloy binding around Etna design. edges. 30 SSMOKERS,MOKERS, TTOOLSOOLS aandnd CCLEARINGLEARING scratch easily. glass, itisnotashardandwill weather. Althoughmuchstrongerthan glass. Willnotcausecondensationincold glass. Farbetterinsulationpropertiesthan unbreakable material,300timesstrongerthan Polycarbonate quiltsaremadeatRandfrom3mmcrystalclear minimal disturbance.Onebeeescape. Glass quiltsarepopularalternativestocrownboardsforobservingthebeeswith frame withtwoplasticescapes.Beespacebothsides. Crownboards aremanufacturedusing6mmexteriorqualityplywoodinacedar RHOMBUS BOARD FORREST BOARD PORTER BEEESCAPE COVER BOARDS National/Commercial SizeOnly. into whichthebeescancongregate. one totwohourswithalargevoid rapid clearinginapproximately Escape. Theboardprovides ever popularRhombus but utilisingthe Clearer Board Canadian Board and Forrest to the device, similar Another clearing Commercial SizeOnly. will clearveryquickly.National/ a bitofrunningtodo!Bees screen. Itgivesthebees with galvanisedmesh grade plywood and Exterior Red Cedar Western from board made A rapidclearing old buttriedandtestedwayofclearingyourhoneysupers. necessary andwillnotrustorcorrode.Avery cleaning. Thespringsareeasytoadjustif stainless steelspringsslidesaparteasilyfor This plasticescapewithaccuratelyspaced Rhombus Board Forrest Board Porter BeeEscape,20 Porter BeeEscape Polycarbonate Quilt,Plain Polycarbonate QuiltwithBeeEscape Glass Quilt laigBe Pie PackedWt. Price Crownboard/Clearer Board Clearing Bees Glass Quilt THORNE BEEHIVES– 01673 858555 Plain PolycarbonateQuilt £24.90 £24.90 £18.00 £1.00 £19.75 £20.50 £18.70 £14.63 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk with beeescape Polycarbonate Quilt 2.5 2.5 0.25 0.06 1.4 1.4 2.9 1.3 Clearer Board Crownboard/ By turningtheAdaptaEkeover and accessibletothebees. will benefitfromtheheatgeneratedbybroodnestandbemoreappealing principle astheMeshRhombusBoard,anysyrupfeederplacedonthisboard The through thegalvanisedmesh. with uncappingandextraction,heatrisingdirectlyfromthebroodnest Mesh RhombusBoard.Thelatterescapewillkeephoneysuperswarmtoassist Rhombus Escape Canadian ConeEscapes Two PorterEscapes The time. Itis70mmdeepsocanbeafeederekeorApiguardRim. depending onwhatmanipulationyouarecarryingoutwithyourbeesatthe multi-purpose eke.Theekehasavarietyofledgesthatholddifferentboards Following onfromthesuccessofAdaptaStandwehavedevelopedthis ADAPTA EKE Change. on thehiveandbyaddingaqueenexcluderitcanbeusedforBaileyComb The AdaptaEkecanalsobeanupperentrance,usefulifthereareseveralsupers Oxalic Acidtreatments. NB alwayswearprotectiveclothing,mask,gogglesandgloveswhenvaporising setting thehivealight! what youaredoingthroughtheviewingwindow,thereforenegatingriskof more popular.Thefumesreadilydispersethroughthehiveandyoucansee vaporiser. VaporisingOxalicAcidtreatmentsfromaboveisbecomingmoreand 90x15mm entranceisformed.Throughhereitpossibletofitmostmakesof By removingtheshapedgalvanisedclosure(heldinplacebymagnets)a clear polycarbonateviewingwindowwithrubberseal. li or ny Mesh FeederBoard only Observation panelonly Plain Boardonly Travelling ScreenBoardonly Mesh RhombusBoardonly Canadian ConeBoardonly Porter BeeEscapeBoardonly Circular EscapeBoardonly Rhombus Boardonly dpaEe rc PackedWt. Price Adapta Eke Adapta Eke red green ledgewilltakeournewMeshFeederBoard.Workingonthesame NEW ledgewilltakeyourchoiceofplywoodclearerboardwitheither.... • [email protected] blue ledgewilltakeatravellingscreenor £11.00 £10.00 £12.00 £30.00 £7.50 £5.00 £9.50 £7.50 £7.50 £7.50 1.5 1.5 2 1.5 1.5 2 2 2 2 4 CCLEARINGLEARING BBEESEES 31 0.25 0.25 0.25 0.25 0.2 0.06 0.06 0.4 0.4 6 0.06 0.3 2 £1.25 £0.40 £3.00 – THORNE BEEHIVES THORNE – £3.00 £4.00 £5.00 £2.15 £12.00 £13.50 £120.00 £0.50 £2.75 £16.90 [email protected] • 400mm long brush with single row of 400mm long brush with twin row of natural fibres. 400mm long brush with a triple row of natural fibres. Bee Brush B2 Bee Brush B3 Nylon Bee Brush B4 Combi Brush Tunnel Escape Escape Tunnel, each Escape Tunnel, 10 Bee Quick, 3.8litre Fume Pad, each Fume Pad, per 10 Fume Board Clearing Bees and Quilts Bee Brush B1 Price Packed Wt. Clearing Bees Bee Quick, 240ml Price Packed Wt. COMBI-BRUSH TUNNEL ESCAPE ESCAPE TUNNELS BEE BRUSHES B1 B2 B3 Nylon Bee Brush Plastic back and soft, nylon bristle brush. 350mm long. Long wooden handled soft brush with one single row of 40mm nylon at one end and a stainless steel hive tool at the other. A tried and tested rapid bee escape with two tunnels. 112mm hole will be required in your crownboard. Shaped, galvanised mesh tunnels for use in home-made bee escapes. 80mm long, 30mm and 10mm wide apertures. FUME BOARD FUME natural fibres. This board greatly improves the This board greatly Bee Quick. A simple efficiency of 40mm wide has an wooden frame cover stretched over absorbent canvas Bee Quick as above and one side. Spray cover over the canvas place the metal on the honey supers. before placing raises the Heat from the sun quickly ensuring temperature of the Bee Quick fast clearing of supers. National size only. rapid evaporation and hence Perfect for gently brushing bees from each comb. 0.06 0.1 1.5 0.06 0.2 0.2 0.3 0.06 www.thorne.co.uk www.thorne.co.uk • £0.50 £4.00 £24.90 £0.40 £3.50 £1.75 £2.00 £4.00 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Canadian Clearer Board Clearing Bees Price Packed Wt. WBC Cone Escapes, 10 Canadian Cone Escape, each Canadian Cone Escape, 10 Rhombus Escape Circular Escape Curtain Escape WBC Cone Escape, each FUME PAD Made from very absorbent “beer mat” material, 250 x 230mm approximately. Ideal for use with Bee Quick and acetic acid. BEE QUICK A non-toxic blend of natural oils and herb extracts for clearing bees from supers. Safe to use for both bees, beekeepers and all hive products, and it can be posted! Using fume pads or a fume board, spray Bee Quick evenly in a zig zag pattern onto the absorbent surface ensuring the liquid reaches the edges. Remove all hive parts until you reach the honey supers. Place the soaked pads on top of the frames. Supers should be cleared in 2-5 minutes. Repeat as required. Best results will be obtained on a warm day when the vapours will evaporate more quickly. 240ml or 3.8ltrs. WBC CONE ESCAPE A plastic, circular escape with 10 free moving plastic A plastic, circular escape with 10 free moving plastic curtains. Works quickly with several bees being cleared at once. Requires a hole in clearer board of 64mm. Overall diameter is 98mm. CURTAIN ESCAPE Used mainly on the roofs of WBC hives to permit any Used mainly on the roofs of WBC hives to permit any in bees trapped in the cavity to escape. Can also be used drone or wasp trapping. CIRCULAR ESCAPE RHOMBUS ESCAPE This escape provides very rapid clearing. It requires pinning into a 50mm deep chamber board. This is simply 4 laths of timber 50mm wide tacked to a sheet of 6mm plywood. Cut a 75mm diameter hole central in the board and put the escape inside the chamber with the central void use simply place the board, of the escape over the hole cut in the plywood. To escape side down, under the super to be cleared. 255mm diameter with fixing and sensory holes. CANADIAN CONE ESCAPE A variation of the hexagonal rapid escape with two exits for clearing. Made in meshed translucent plastic letting both light and brood scent into the supers. 380mm long, 123mm wide. CANADIAN CLEARER BOARD CLEARER CANADIAN bees. and rapid way of clearing A very effective the bees not one way valves but The cones are to disorientated to be unable are sufficiently back into the supers. However find their way be left on for more than they should not in Western Red Cedar six hours. Made a quality plywood providing and exterior chamber depth of 50mm. Versatile conical escapes that can be incorporated into Versatile conical escapes clearer board as well as the several different designs of diameter 7mm, overall height traditional type above. Exit 21mm. 32mm. Entrance diameter 32 MMOVINGOVING HHIVESIVES wide webbing. Supplied with5metresof25mm an ingeniouslockingdevice. hardwearing strapwith Extremely strong, the mesh. be pouredthrough Water orsyrupcan The idealventilator. in placeoftheroof. on topofthehive made inallsizes,fits wire mesh(eightgauge) Wooden framedstainlesssteel size fitsallhives. in position.One once thehivesare Simple toremove ventilation. permits importantly yet more efficiently quickly and closed completely to be the hive strip enables A foamrubber FOAM ENTRANCECLOSURE http://bit.ly/2nri9Zs See YouTubevideo: method ofmovinghives. screws. Anextremelysecure of fourwithblackjapanned Galvanised steel,soldinsets TRIANGLES http://bit.ly/2rQ7n4a See YouTubevideo: 25mm widewebbing. as beehives,ontoatrailer.5mof strapping allsortsofloads,aswell to useandunlock.Suitablefor Excellent valueformoney,easy RATCHET HIVESTRAP http://bit.ly/2BEpHNz See YouTubevideo: 25mm widewebbing. the tighterstrap.5metresof tension appliedinthecorrectplane, contains aspikedcam–themore length ofwebbing.Thebuckle Just asstrongabovewithsame ECONOMY HIVESTRAP http://bit.ly/2Fwp9M3 See YouTubevideo: STANDARD HIVESTRAP TRAVELLING SCREEN oigHvs rc PackedWt. Price Foam EntranceClosure Moving Hives Ratchet HiveStrap Economy HiveStrap Standard HiveStrap Travelling Screen THORNE BEEHIVES– 01673 858555 £6.00 £3.00 £5.00 £17.45 £0.55 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.4 0.2 0.25 1.3 0.06 http://bit.ly/2Ft975r See YouTubevideo: securing hives,soldinpairswithfixingscrews. One ofthesimplestyeteffectiveways SPRING FASTENERS down withatapfromhammer. marking gauge.Hivecanbequicklybroken Galvanised steel,soldinpairswithscrewsand LOCKSLIDES separated quicklyandeasily. Enables componenthivepartstobe Sold inpairscompletewithscrews. TOGGLE FASTENERS grips. Measures560x760mmwhenfolded. hive, theharderitisgripped.Completewithcomfortablepolypropylenehandle A two-personliftingdeviceforanysizeofhiveexceptWBC.Theheavierthe HIVE CARRIER fixing screws.100mmwide.Suppliedinpairs. Strong platedsteelhandlescompletewith HIVE HANDLES especially ifmovinghives. the adjoiningpartforatemporaryfitting hive partwhiletackscanbeusedtofix screws fixthesupporttotopof box aboveby15mm.Designedsothat corner ofcomponentpartsandgripthe included) thesearefixedateverytop are foryou.Soldinsetsof4(screwsnot in blusteryweatherthenthesesupports and alwaysseparatingorblowingover If yourhivesareinanexposedposition CORNER SUPPORTS Hive Carrier Hive Handles(Pair) Spring Fasteners Lockslides Toggle Fasteners oigHvs rc PackedWt. Price Triangles Moving Hives oigHvs rc PackedWt. Price Corner Supports Moving Hives • [email protected] £1.75 £5.30 £4.60 £2.50 £77.50 £4.25 £1.20 6 0.1 0.15 0.06 0.2 0.1 0.15 CCLOTHINGLOTHING 33 1 1.2 0.8 1 0.6 0.5 0.5 £83.40 £96.00 £56.00 £69.50 £29.00 £19.35 £24.17 – THORNE BEEHIVES THORNE – [email protected] • Jacket and Veil, 52" Childs Jacket and Veil, 24" or 28" Childs Jacket and Veil, 32" Trousers, adults, small, medium, large, x-large Childs Trousers, small, medium Childs Trousers, large Clothing Price Packed Wt. Packed Price Clothing Jacket and Veil, 36", 40", 44", 48" See YouTube video on how to detach See YouTube video on how and re-attach hat: http://bit.ly/2Ezm3aN TROUSERS with Trousers are sold separately Both elasticated waist and ankles. cotton and are are made in polyester/ washable. Child: S, M, L. Adult: S, M, L, XL. TROUSERS CAMOUFLAGE JACKET AND VEIL AND JACKET AND VEIL JACKET Why advertise where you keep your bees by wearing white clothing. Stay hidden with our combat material jackets. Detachable top as standard jacket and veil, weight strong yet light material. Trousers in same material also in stock. Sizes: 36, 40, 44, 48” and trousers S, M, L, XL. Manu fac tured in Rand. Combined hat, jacket and veil. Hat Combined hat, to the jacket and veil is attached duty zip which allow with a heavy to be removed the hat and veil cotton. completely. Polyester at cated wrists. Large pocket Elasti 28, 32, 36, 40, 44, front. Sizes: 24, in Rand. 48 and 52”. Manufactured 2 2 2 2 1.6 1.8 2.5 1.5 £147.00 £137.70 www.thorne.co.uk www.thorne.co.uk • £83.30 £95.50 £132.50 £141.80 £84.50 £68.00 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Size 36" or 40" All-in-one Price Packed Wt. Packed Price All-in-one Ventilated All-in-one Ventilated Protective Clothing Price Packed Wt. Childs Size 24"/28" Size 44" or 48" All-in-one with Knee Pads, 36" and 40" All-in-one with Knee Pads, 44" and 48" Childs Size 32" Ventilated Jacket WITH ADDITIONAL KNEE PADS. Adult All-in-one now available with foam knee pads with a water resistant cover. See YouTube video on how to detach and re-attach hat: http://bit.ly/2Ezm3aN The veiling in our jackets and veil and All-in-one is a superb quality polyester mesh. Very, very strong and virtually unbreakable. Keep away from your smoker however! Sizes: 24, 28, 32, 36, 40, 44, 48 and 52”. Confidence boosting apiary wear, offering full head to ankle protection without restricting vision or movement. Polyester cotton. Elasticated wrists and ankles. Hat and veil is attached to the jacket with heavy duty zip and is completely removable. Velcro seal where zips meet. Manufactured in Rand. ALL IN ONE VENTILATED PROTECTIVE CLOTHING PROTECTIVE VENTILATED Small, medium, large, X-Large and XXL. A welcome addition A welcome addition to our clothing range. These All-in-ones are made from heavy a duty mesh with white net lining and outer layer. These will keep you well protected but also ensure you do not get too hot during long summer inspections. Fitted with knee pads. 34 CCLOTHINGLOTHING diameter. Super smoothstainlesssteel,spotweldedwithshrinksleevedcover.380mm Stainless SteelRings: SPARE PARTS stainless steelrimring. hold theveilinposition.Chinstrapincluded.Welded and elasticstrapswhichareplacedunderthearmsto Soft clothhat(onesize)withblacknetveilattached HAT ANDVEIL Ring sewnintothenettingtokeepveilclearof Soft cloth,onesize,hatwithblacknetveilattached. HAT ANDVEILWITHRING brighten upanybeekeeper. and pocketsofourAll-in-Oneswill The colourfulpatchesonknees,elbows attire andstandoutfromthecrowd. Add abitoffuntoyourbeekeeping PATCHES ALL-IN-ONE combined withourrangeofJacket&VeilsandAll-in-Ones. Our rigid,cool,lightweightandcomfortablemeshhelmet OPEN MESHHELMETWITHJACKET&VEILORALL-IN-ONE polyester netting. Suitable foreitherourJacketandVeilorAll-in-Onewiththesameverystrong Replacement Hat,VeilandCollar: Strong polyesternetting.Cuttoshapereplacetornorworn-outveiling. Replacement Net: ltigSaePrs rc PackedWt. Price Stainless SteelRing Clothing SpareParts Hat andVeilwithRing Clothing Price Packed Wt. Jacket andHelmet,36"-48" Clothing Price Packed Wt. Patches All-in-one,32" Patches All-in-one,24"/28" Patches All-in-one,52" Patches All-in-one,44"and48" Patches All-in-one,36"and40" All-in-one andHelmet,52" All-in-one andHelmet,44"48" All-in-one andHelmet,36"40" Jacket andHelmet,52" Replacement HatandVeilcollar Shaped Net Hat andVeil Child's HatandVeilwithRing THORNE BEEHIVES– 01673 858555 8 yearsold. Child’s versionavailableforupto stainless steelring. the veilinplace.Chinties.Welded are placedunderthearmstohold face andneck.Elasticstrapswhich

£45.20 £3.70 £3.60 • £175.45 £151.50 £141.85 £170.00 £141.80 £132.50 THE COMPLETEEQUIPMENTSUPPLY COMPANY £21.25 £15.00 £22.50 £99.00 £86.70 £96.00 £83.40 www.thorne.co.uk 1 0.06 0.06 1.8 1.6 1.2 1 0.2 0.2 0.2 2 2 2 2 2 2 Children size,XS,XXSandXXS. XX-Large. Adult sizes–small,medium,large,X-Largeand pockets andlongzip.Hoodcanbefullydetached. Tough budgetall-in-onewithfencinghood.Deep ALL-IN-ONE XXL. large, X-Largeand Small, medium, style hat. Round orfencing veil. Adult Jacketand JACKET ANDVEIL BEES ONABUDGETCLOTHING pocket. from strongblacknet.Thejackethasafront elasticated cuffsandwaistband.Veilismade all onepiece.Madefrompolyestercotton,with zip todetachthehatandveil-garmentis and strong.Overthehead(nofrontzip) A valuefencingstylejacketandveil.Verywellmade VALUE JACKETANDVEIL only. before theytaketheplunge!Largesize put theirtoeinthewaterofbeekeeping visiting friendsorthosewhojustwantto clothing isgreatforthatbusman’sholiday, This inexpensivepieceofprotective OCCASIONAL JACKETANDVEIL BOAB ChildAll-in-one BOAB AdultAll-in-one BOAB AdultJacketandVeil,fencinghat Value Jacketand Veil eso ugtCohn Pie PackedWt. Price BOAB AdultJacketandVeil,roundhat Bees onaBudgetClothing Occasional JacketandVeil Clothing Price Packed Wt. • [email protected] NO

£30.00 £14.99 £35.00 £47.00 £30.00 £8.50 0.2 1.0 1.6 2 1 1 CCLOTHINGLOTHING 35 0.3 0.25 0.25 0.25 0.3 0.3 0.3 0.15 0.06 0.06 0.06 0.3 0.15 0.1 0.06 0.06 £2.75 £1.00 £5.00 £2.50 £6.00 £12.99 £15.45 £12.88 £42.25 £22.87 £24.62 £24.62 £10.00 £0.80 £0.80 £0.80 – THORNE BEEHIVES THORNE – [email protected] • Mordant Gloves, Size 6-13 Mordant Gloves, Size 4-5 Kid Gloves Cowhide Gloves, plain Cowhide Gloves, ventilated Goatskin Gloves, ventilated Flock Lined Gloves Nitrile Gloves, pack of 5 pairs Double Nitrile Gloves, pack of 5 pairs Ultra Tough Gloves per pair Plastochrome Gloves Gauntlets Honey House Protection Apron, 10 Mob Cap, 10 Overshoes, 5 pairs Price Packed Wt. Gloves Pair Packed Wt. Packed Gloves Pair Fully Vented Gloves Hardwearing, washable plastochrome gloves. In sizes medium, large or extra large. GAUNTLETS HONEY HOUSE PROTECTION Cleanliness is vital whilst processing honey. Wear this cheap and disposable range of clothing during extraction and bottling. White apron with ties. Comfortable Mob Caps secure hair, minimising contamination risk. Plastic overshoes with elasticated ankle ensures a snug fit. FLOCK LINED GLOVES FLOCK LINED NITRILE GLOVES ULTRA TOUGH GLOVES PLASTOCHROME GLOVES GOATSKIN GLOVES GOATSKIN Cotton twill, elasticated at both ends to prevent bees crawling up the arm or into your glove. Sizes: Standard and Large. Hard wearing goatskin. Ventilated. Hard wearing Sizes: S, XL, XXL. Very comfortable to wear, offering more protection than nitrile or latex but with good are also sensitivity. The gauntlets the glove making a plastic and welded on to only. very strong seal. Large size They keep the Powder free nitrile gloves. protection and hands clean, offer a little manipulations. 100% sensitivity through Packs of 5 pairs S, M, L, XL. nitrile. Also available in double thickness They are exceptionally durable against tears and abrasion and have rolled cuffs to prevent foreign bodies from entering the glove. Available in small, medium, large and XL these tough nitrile coated gloves are the professionals choice. With a rolled cuff, the ‘tractor tread’ gloves offer great feel and sensitivity during manipulations with a little more protection than the standard nitrile gloves. 0.1 0.3 0.35 £7.00 £16.40 £12.00 www.thorne.co.uk www.thorne.co.uk • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Ring Veil Clothing Price Packed Wt. Packed Price Clothing Helmet Square Folding Veil COWHIDE GLOVES KID LEATHER GLOVES Tough gloves for professional beekeepers. Available plain or ventilated. Sizes: S, M, L, XL, XXL. Sizes: 4-13, no half sizes. Mordant gloves, well made and a good fit, comfortable to wear and incredible value. MORDANT GLOVES Kid gloves, beautifully made in the U.K. and snug fitting. Sizes: 6-11, no half sizes. FULLY VENTED GLOVES Hard wearing professional gloves with a vented gauntlet. Leather palm and thumb but vented back of hand. Draw cord at top with toggle. Mesh is three layers thick and keeps the hand cool on a hot day. SQUARE FOLDING VEIL veils around. One of the oldest styles of attached to the This new model has the veil veil also works shaped, one size hat. The cap underneath. very well with a baseball offers excellent Fine epoxy coated steel mesh with a generous all round vision. Complete pull cord for tying veil around waist. This helmet has a rigid brim and weighs This helmet has a rigid brim recycled only 150g. Made from 100% keep you paper. The open mesh will with Velcro cool. Fully size adjustable hat band. RING VEIL AND HELMET VEIL AND RING veil with black plastic A lightweight face ring. Elasticated mesh panel and the arms. 400mm straps fit under long.The veils we use diameter, 500mm together with our in our own apiaries open mesh helmet. 36 MMISCELLANEOUSISCELLANEOUS all hivesizes. an emptysuperorbroodbody.Availablein from recycledchipfoam.Fitssnuglyinside 20mm thickinsulationflexibleboardmade size only. be peeledbacktoexposesmallareas.National propolise themontotheframesbuttheycan canvas withflapforfeeding.Beestendto May beusedinplaceofacrownboard.Heavy CANVAS QUILT Price includespostage. sows 300sq/m,12kg1acre). Sowing Rate:3gmspersq/m(1kg other wildlife. wide rangeofpollinatinginsectsand Dwarf Sunflowertoencouragea species plusBorage,Sainfoinand list. Contains;23nativewildflower Society "PerfectForPollinators" species fromtheRoyalHorticultural Carefully formulatedtoinclude20 a visuallyattractivemeadow. and Butterflies,whilstcreating wildflowers, attractivetoBees Bright andbeautifulnative 100% WILDFLOWERSEEDS–BEESANDBUTTERFLYMIX BeesinTransitalsoavailableasamagneticsign. Size 200x280mm. Four selfadhesivegreenonwhitesignstonotifythepublic–notfrightenthem. CAUTION SIGNS apiary. queen propagation,breeding,orevensitingofan to assistthebeekeepermaximisehoneycrop, A cleverdevicedevelopedbyProfessorR.Pickard BEEKEEPERS RULE INSULATED QUILT iclaeu Priceincludingcarriage Wild FlowerSeeds, 100g Miscellaneous Beekeepers Rule Price Packed Canvas Quilt Quilts Wt. Price Packed Wt. esi rni antc Bees inTransit-Magnetic Caution Signs,each Insulated Quilt THORNE BEEHIVES– 01673 858555 £33.00 £3.30 £1.50 £2.75 £3.50 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk £6.00 0.2 0.06 0.06 0.3 0.15 ASPIVENIN TIDY TRAY HIVE NUMBERS VENTILATOR or step. which makesitintoastool for tools.Withhandycover Large capacityplastictray A mustforallapiaryvisits. SIT-STEP-STORE letters ornumbersrequiredandwewillmakeuptheiron.Maximum8letters. quickly pressagainstthehivepartorframetobeidentified.Simplyselect long steelshaftandwoodenhandle.Heatwithablow-torchtoredhot Arial font.Weldedontoasteelback-platewith450mm We have15mmhighlettersandnumbersavailablein Feel moresecurewiththesesteelbrandingirons. BRANDING IRON Up to4.8magnification. can alsobedirected.Batteriesincluded. Adjustable headband.Thelightsource magnifier, withadditional,swivellens. A deluxe,illuminatedheadband SUPER LOUPE poison fromthesting. the nozzle.Thisgentlydraws creates acontinuousvacuumin attack andpresseddownwhich and isthenappliedtotheareaof relief. Theplungerisdrawnback plunger bringsinstantsting This compactandeasytouse the perfectsolutiontostickyproblems. to transportwetsupers.TheTidyTrayis seats asyouhaveusedanup-turnedroof kitchen floor.Orworsestilltornyourcar into arowbecauseofhoneyalloverthe What agoodidea.Haveyouevergot pre-drilled holes. Letters donothave attach toyourhive. through thelettersand numbers. Simplynail A setof17plastichive crownboard topreventbeesenteringtheroofspace. inserting afinealloymesh.Slipthemintothe altered theusebyremovingspringsand Using aPorterBeeEscapeplatformwehave Branding Iron,AdditionalLetter Branding Iron,TwoLetters Aspivenin Tidy Tray Hive Numbers Sit-Step-Store Ventilator Miscellaneous Price Packed Wt. Super Loupe Health Price Packed Wt. • [email protected] £5.00 £25.00 £24.00 £14.00 £1.00 £1.00 £26.00 £14.40 0.3 3 2 1.5 2 0.06 0.06 UUNCAPPINGNCAPPING 37 0.6 0.4 0.3 0.2 0.7 0.2 0.2 0.2 0.2 0.2 – THORNE BEEHIVES THORNE – £7.50 £6.50 £4.50 £16.00 £100.00 £25.00 £2.50 £12.00 £15.00 £19.50 [email protected] • Medium Uncapping Roller Small Uncapping Roller Comb Rake Electric Uncapping Plane Uncapping Fork UF2 Uncapping Fork UF3 Uncapping Fork UF4 Uncapping Fork UF5 Uncapping Large Uncapping Roller Price Packed Wt. Uncapping Fork Uncapping Fork UF1 Price Packed Wt. UNCAPPING ROLLERS COMB RAKE ELECTRIC UNCAPPING PLANE UNCAPPING FORK UF3 UNCAPPING FORK UF4 UNCAPPING FORK UF5 UNCAPPING FORK UF2 FORK UNCAPPING Wooden handled fork with chrome plated shoulder fork with chrome plated Wooden handled needles steel sharpened straight gripping 10 stainless 40mm long. 220mm. Overall length handle. 110mm hardwood with cranked, shaped Identical to the UF2 fork but needles. uncapping fork. An extra large stainless steel spread of cranked tines. Plastic handle with 95mm edge for awkward One shaped and sharpened to use. hollows. Very comfortable This fork is virtually unbreakable. It is incredibly strong with laser cut, accurately spaced tines. Very sharp with side cutter for working comb hollows. Comfortable, moulded silicone handle. 205mm long, tines are 70mm wide. Steel is 2mm thick. Three budget uncapping rollers. Simply roll over the comb and then extract in the usual way. The sharp spikes pierce the cappings but do not remove them. Most of the wax stays in place until extraction and can be filtered out of the honey at a later date. Rollers lengths are: Large 115mm; Medium 64mm; Small 25m. A razor sharp blade provides the ideal tool for raking granulated comb back to the midrib. Alternatively to stimulate early colony development lightly rake the tool over capped stores. 225mm long, 60mm wide. 120mm handle. A heated and shaped blade is pushed up the comb allowing the cappings to build up on the back of the blade. The temperature of the blade can be controlled by placing the end of the plane upright into a heatproof container with 1” of water in the bottom. The water will heat up to 100°C and will, therefore, provide a suitable temperature control for uncapping. 1.0 0.35 0.5 0.5 0.5 £15.00 www.thorne.co.uk www.thorne.co.uk • £45.00 £12.00 £15.00 £12.00 01673 858555 cappings fall away from the frame. cappings fall away from the the frame, move the knife down frame just underneath the cappings and allow them to fall into a collecting container. helps to remove the cappings: the knife does not need to be razor sharp. SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS at the top of the With the blade the blade The heat from and secure surface. Hold the frame on a solid sheets of the frame towards you slightly to ensure that the Tilt the top of Easi-knife Uncapping Knives Price Packed Wt. Cold Uncapping Knife Serrated Uncapping Knife Utility Uncapping Knife Broad Uncapping Knife UNCAPPING FORK UF1 Still a popular and easy uncapping method. Use cold with a zig-zag action cutting just under the cappings. Rinse occasionally in hot water and wipe dry. Cranked stainless steel needles assist in lifting cappings clear of comb. 210mm long, 70mm wide. 420 mm long and 45mm wide. Serrated on one edge and plain honed on the other. Curved tip. Riveted Wooden handle. Very strong and sturdy. Riveted wooden handle 110mm long. BROAD UNCAPPING KNIFE Very sharp stainless steel blade 280mm long 35mm wide. Very sharp stainless steel blade 280mm long 35mm Honed on both edges. UTILITY UNCAPPING KNIFE SERRATED UNCAPPING KNIFE Stainless steel, 250mm hollow ground edge, extremely sharp. Works better if blade is heated in hot water. COLD UNCAPPING KNIFE Hollow ground on both sides and flexible. Riveted wooden handle 110 mm long. Very sharp stainless steel blade 280mm long and 35mm wide. ● ● ● ● EASI-KNIVES wooden ceramic element, turned with stainless steel blade, Electric Knives thermostatically switch. The knives are flex with on/off rocker handle, 2m black They are 85 and 105 degrees. adjustable) switching between controlled (not and 12v versions x 50mm blade. 240v comfortable to use. 250mm light and very latter). car battery required for available. (12v 38 HHIVESIVEUUNCAPPINGSN aandCnAdP PBBEESIENEGS phase motor.1000x700x1400mmhigh. steel construction,witha370Wsingle therefore forhollowcombs.Allstainless Adjustable uncappingdepth,suitable, on toacollectionarmreadyforextraction. oscillating blades,uncappedandthenfed are manuallywoundthroughapairof for a100+hiveoperation.Theframes This semi-automaticuncapperissuitable ALPHA MINIUNCAPPER 1050 mmhigh. stacking 20uncappedframespriortoextraction.1500mmlong,700mmwide This machinewillaccommodate20shallowframes.Thereisalsospacefor A largerversionofthe"MiniTetra".Electricextractorpoweredbya70wmotor. THOMAS TETRAPLUS 1000mm high. with fullyadjustableuncappingchains.500mmdiameter, uncapping tankabove.Manuallyfedandveryeasytouse adjustment. Itfitsquicklyandsimply,ifdesired,ontothe This machinewilluncapallsizesofframewithverylittle THOMAS UNCAPPINGMACHINE Knife notincluded. means itwillholdallsizesofframe. nylon honeyvalve.Anadjustablesupportbar Complete withdraininggridforcappingsand 820mm high,1050mmlongand480mmwide. A largestainlesssteeltankmountedonlegs. THOMAS UNCAPPINGTANK 1055mm long,595mmwide,1050mmhigh. Less space,mess,Greaterefficiency. ergonomically designedbottomchamber. frame manualextractor,settlehoneyinthe Uncap intotheperforatedbasket,load9 stainless steelconstruction(apartfromcagerings). extract andsettleyourhoneyinonemachine.All simple yetefficientmachineallowsyoutouncap, Suitable forabeekeeperwithupto10hives.Thisvery THOMAS MINITETRA napn rc PackedWt. Price Alpha MiniUncapper Uncapping Thomas TetraPlus Thomas MiniTetra Thomas UncappingMachine Thomas UncappingTank THORNE BEEHIVES– 01673 858555 £3828.00 £2060.00 £2600.00 £850.00 £3350.00 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 83 60 67 35 15 To order,wecansupplyaframeholdersuitableforCommercialframes. to uncapusingthewoodenbarsupplied. the holderisinusetherestillampleroom down thetraypriortoextracting.When the trayor10Langstroth/ MD 13 BritishStandardFramesacross frame holdertakesapproximately 90mm deep.Thestainlesssteel 760mm longx460mmwideand draining ofcappings.Eachtrayis top trayhas4mmperforationsforrapid nylon valvefittedintothelowerunit.The in highdensitypolyethylenewith40mm A largecapacityunheateddoubletray separate bottomtray. holder. Holdstwoframeswitha Budget uncappingtrayandframe The thermostatcanberetrofittedinourownworkshops. 840 x405125mm.Heatedareais790400mm. tray. Temperaturerangeof0–120°C. accurately controlsthetemperatureofwaterin Standard uncappingtrayfittedwithathermostatwhich 130x85x55mm. Graduatedon/offknob.2metresofcablesupplied. knob isturned.(NBthisnotathermostat).Strongplasticbox, controller thatwillswitchonandoffperiodicallyasthe wax extractororuncappingtray.Atime,simmerstat control youmightneedforrunninganoldstylesteam This electricdevicewillgiveyouthatlittlebitof the oldstylesteamwaxextractor. and elementsareavailablecanalsobefittedto Spare gridsareavailableseparately.Mainsleads rest barincluded. not leaveunattended.Heatedareais790x400mm.Woodenframe 1260W thermalcut-outheatingelementandfusedplugflex.Do a suitablereceptacle,e.g.ourstainlesssteelseparator.Itcomescompletewith the 25mmdiameterspoutandinto and throughthefilteroutof mixture rundowntheslopingbox the cappings.Thewaxandhoney which quicklymeltsthehoneyand and isawater-jackettedtank tray measures–840x405x125mm Our standardelectricuncapping STANDARD UNCAPPINGTRAY overnight. This willkeepcappingsandhoneycleanwhilstdraining 10mm correxwithredwoodlocatingbattens. A sturdycoverforourcolduncappingtrays.Madefrom Cold UncappingTrayCover COLD UNCAPPINGTRAYANDFRAMEHOLDER COMPACT UNCAPPINGTRAY THERMOSTATICALLY CONTROLLEDUNCAPPINGTRAY HAMILTON CONTROLLER opc napn ry Compact Uncapping Traywith1.5"valve Compact UncappingTray Retro FitThermostat Uncapping Tray Thermostatically Controlled Hamilton Controller Element andLead Uncapping TrayGrid Standard UncappingTray Cold TrayCover napn ry rc Packed Wt. Price Frame Holder Cold UncappingTrayand Uncapping Trays • [email protected] £130.00 £430.50 £54.85 £38.00 £26.90 £301.35 £125.00 £54.50 £40.00 £13.00 4 4 9.5 1 0.5 0.4 9 2 6.5 HHIVESEEXTRACTORSXIVTERSA CaandnTdO RBBEESSEES 3939 20 22 3 – THORNE BEEHIVES THORNE – 10 10 1.5 4 £23.00 £45.00 £43.25 [email protected] £362.00 £746.00 £490.60 £865.80 £251.90 • TABLE TOP ADAPTOR A stainless steel, removable, insert that will convert a Langstroth/ Commercial Table Top extractor so that it will accommodate BS frames. STANDS FOR PLASTIC EXTRACTORS A useful extra for all our plastic extractors including the Table Top. The stand for the lightweight or heavy duty extractor lifts it off the ground by 305mm; the table top by 270mm. See photograph left. Made at Rand, this is one of the best little machines this is one of the best little Made at Rand, on the market. beekeeper extractor for the hobbyist The ideal starter will hold 18 hives. The B.S. version with up to five of honey before the stroth 10 lbs. lbs. and the Lang be opened. honey valve must shaft, thus making the Neither model has a central easier. All frames can loading and turning of frames without removing them be swivelled on their axis polythene barrel with from the cage. Food grade with a ratio of 2½:1. 1½” nylon valve. Nylon gears with phosphor bronze Stainless steel internal cage top of the central shaft. self lubricating bush at the Nylon bush at the base. The B.S. type will Two versions are available. or two B.S. deep accommodate four B.S. shallow will hold four Langstroth frames. The Langstroth type 16” x 6”; or two Dadant shallow or two deep; two Overall height 660mm. shallow. Diameter 405mm. See YouTube video: http://bit.ly/2nqfxuB TABLE TOP EXTRACTOR TABLE £246.30 ” nylon valves. All have two piece ” nylon valves. All have two 2 ⁄ 1 Heavy Duty, Radial or Tangential Table Top Extractor, BS Table Top Extractor, Langstroth Table Top Adaptor Stand for L/W or H/D Extractor Stand for Table Top Extractor Extractors Lightweight, Radial or Tangential Manual Electric Packed Wt. HEAVY DUTY PLASTIC makes this model the Extremely robust polythene It is not susceptible choice of many associations. for honey under the to frost or UV light. Capacity cage is 80 lbs. stand which Can be supplied with an optional off the ground. Overall raises the machine 305mm 455mm. height 740mm; diameter www.thorne.co.uk www.thorne.co.uk •

01673 858555

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

LIGHTWEIGHT PLASTIC Capacity for One of our most popular models. lbs. Overall height honey under the cage is 85 Can be supplied with 710mm; diameter 480mm. an optional stand which raises the machine 305mm off the ground.

The polythene barrels are food grade quality (we recommend the lightweight is stored in a UV frost-free the lightweight is (we recommend barrels are food grade quality The polythene easy to use and are highly geared, very handles. The manual machines Both types have integral environment.) a maximum speed of motor producing are powered by an 80W reversible The electric machines extremely robust. gearbox. These models are fitted with the 1 280rpm through a 10:1 reduction THE UNIVERSAL RANGE OF EXTRACTOR RANGE OF THE UNIVERSAL There is a choice and is still as popular as ever. market for over 30 years extractors has been on the This range of of cage: radial or duty polythene. A choice barrels: lightweight or heavy or manual. A choice of of drives; electric of British extractors. from. The largest range total of eight models to choose tangential. A

removal. lids which we recommend are kept in place when the machine is being used. Allen key provided to assist in cage are kept in place when the machine is being used. Allen lids which we recommend 40 HHIVESIVEEXTRACTORSEXST RaandnAdC TBBEESOERES Legs requireassemblyontoextractor. ground. Legs lifttheextractor195mmfrom steel cage.Splittwopartplasticlid. Manual operationwitharobuststainless (16"x10"). Langstroth JumboandCommercialDeep apart from14"x12",DadantDeep, manual extractor.Willtakeallsizeframes A threeframestainlesssteeltangential UNIMEL See YouTubevideo:http://bit.ly/2DNltsO COLLECTION ONLY. Commercial Deep. 12”, DadantDeep,LangstrothJumboand Will takeallframesizesexcept14”x opening. under thecagebeforevalveneeds will holdapproximately10lbs.ofhoney diameter and950mmhigh.Theextractor bolts arestainlesssteelaswell.400mm bar andsteelgearhousing.Allnuts valve, supportlegsandframe.Alloytop Three framestainlesssteelcage,honey schools andpublicalike. interesting todemonstratebeekeepers, out ofthecombs.Itcanalsobevery .Seeyourflying This isacrystalclear,acrylicbodied, IC HONEYEXTRACTOR two partplasticlid. Robust stainlesssteelcage.Split to extractor.Nylonhoneyvalve. ground. Legsrequireassemblyon extractor 205mmfromthe Shallow Frames.Legsliftthe Shallow Framesor8Smith Manley Frames,8Commercial Shallow orLangstroth Frames, 8Langstroth 8 BSManley take 8BSor extractor. Will steel radialmanual Eight framestainless extractor onthemarket. The bestbudgetradial OCTIMEL http://bit.ly/2DNltsO See YouTubevideo: IC HoneyExtractor Octimel xrcos Pie PackedWt. Price Unimel Extractors THORNE BEEHIVES– 01673 858555 £250.00 £295.00 £160.00 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 25 22 nylon valve. in operation.330mmbelow switches offiflidisraisedwhilst mm high.110Wmotor.Motor 620mm insidediameter,1050 Manley. Dadant shallowHoffmanor deep; or6OSBframesor; frames; or6Langstroth take radially6BSDeep Versatile enoughtoalso shallow HoffmanorManley. Manley; or12Langstroth type; or1216x6Hoffman 12 BSshallowframesofany cage whichwillaccommodate Stainless steelbarrelandradial A versatileValueextractor. VERSOMEL Using ourRadialExtractor x 12”. Tangential: six B.S.orLangstrothshallow,threeofALLothersizesexcept14” This cagewillonlytakebroodframeswhenscreensarefitted. shallow, orsixManleyframesofanysize. Radial: nineB.S.orLangstrothshallow,sixCommercial(16”x6”)Dadant Your ChoiceofUniversalCage Radial and Tangential Extractors:TheProsandCons xrcos Price Versomel, collected Extractors esml nldn araewti K Versomel, includingcarriagewithinUK N.B. Useonlya3amp fuseintheplug. N.B. DonotreversetheRM motor whilethecageisrevolving. N.B. Ensurethetopbarsofframes areclearofanyhoneyintheextractor. Extractiontimewillvaryconsiderablydepending ontheambient 4. Rotate themachineforseveralminutesslowlyandthengraduallyincrease 3. Ensurethatthecageisevenlybalanced. 2. Placetheuncappedframeintoextractor,topbarluglocatedin 1. direction ofrotation. tangential cagewiththebottombarsofframepointingtowards a deepframe,thentangentialisthebetteroption.N.B.Alwaysspin slower thanradially.However,ifyouwanttoextractheatherhoney,or side. Theextrahandlingmeansthatextractingtangentiallyisgenerally all thehoneyfromotherside,thenturnedonceagaintofinishfirst to extractsomehoneyfromtheoutsidefaceofcomb,turned loading andunloading.Inatangentialmachine,eachframeisloaded,spun are usuallywiththeradialtype,aseachframeisonlyhandledtwice,on tangential istheonlyoption.Ifmachinelargeenough,advantages the diameterofbarrelmaynotbeenoughtofitframesradiallyso they arearrangedflatagainsttheoutsideofcage.Inasmallextractor, spokes ofawheelpointingoutfromthecentre.Intangentialextractor What dothesetermsmean?Inaradialextractortheframesarelike temperature andtheviscosityofhoney. machine orapprox.onehundredturns onamanualmachine. to spinfor2-3minutes,increasingmaximum speedontheelectric the speeduntilhoneycanbeseenleaving thecombfreely.Continue forks. the “D”sectionofbottomringandotherendbetweenupper • [email protected] £805.00 £745.00 HHIVESEEXTRACTORSXIVTERSA CaandnTdO RBBEESSEES 4141 25 22 42 44 60 80 80 120 42 25 25 £499.00 £760.00 £799.00 £1300.00 £1890.00 £2760.00 £3862.50 £3780.00 £5253.00 £2250.00 £1820.00 – THORNE BEEHIVES BEEHIVES THORNE THORNE – – [email protected] • Bati Press, tank only Thomas Extractine Thomas Duomel, manual Thomas Duomel, electric Thomas Babymatic Thomas Radianox 24 Frame Commercial Melter Euromel Baffle Clarifier Honey Pump Extractors Bati Press Price Packed Wt. 1050x550x470mm wide. 1050 1050x550x470mm high on legs. in lid, 700W 1600W heater cabinet. heater in the melter is a This cabinet type of equipment. It versatile piece and basically separates honey and beeswax carefully, safely efficiently. of It has a high capacity capable dealing with 100kgs of cappings. It can be used as a cappings melter, liquefier of crystallised frames, uncapping tank or warming cabinet. height with a 900mm diameter, adjustable single phase 550W motor. Holds 36 shallow frames of any type. This extractor is intended for beekeepers with 100+ hives. It has a variable speed controlled gearbox with an automatic acceleration device. Interlocking safety lid and also clear polycarbonate ½ lid so you can view extraction as it happens. Sloping internal base ensures all honey runs out of the 60mm outlet. A large capacity clarifying sump. 1250x470x320mm high, single phase 1200w The baffle clarifier is an important piece of equipment in any commercial operation. It greatly speeds up the processing of freshly extracted honey by separating impurities such as pieces of wax, bees, frame splinters etc. The heat in the base of the sump ensures the foreign bodies rise to the surface and are held back by the three baffles. Single phase 750W Specifically made for pumping honey without any emulsifying effect. Stainless steel blades with a capacity of 900kgs per hour, depending on viscosity. Recommended for use with the Cleanomel on page 46 or Baffle Clarifier above. BAFFLE CLARIFIER HONEY PUMP EUROMEL 36 COMMERCIAL MELTER COMMERCIAL NEW www.thorne.co.uk www.thorne.co.uk • tank. a dedicated its own or with The Bati Press can be purchased on 01673 858555 SERVINGSERVINGYEARS YEARS 100 100 OVER OVER FOR FOR WORLDWIDE WORLDWIDE BEEKEEPERS BEEKEEPERS This machine is similar to the Extractine but with a larger capacity. We can offer the machine either in manual or electric drive . 1100mm high, 525mm diameter. It will hold 9 shallow frames of any size and is suitable for up to 20 hives. It is complete with screens for tangential operation and a drip tray base and lid for the extractor and settling tank. 1000mm high, 800mm diameter. This machine will take 24 shallow frames of any size. THOMAS RADIANOX 24 FRAME An all stainless steel radial honey extractor with a single phase 110w motor fitted on top of the machine. Opening and loading is through a transparent ½ lid with an electronic interlock switch. THOMAS BABYMATIC 650mm diameter, 1100mm high, 180w electric motor. Very stable, and ideal for a 100 hive operation. A 20 frame semi-automatic extractor that gradually increases speed, once it has been programmed. This leaves you more time to continue uncapping! The machine is fitted with two half covers, one is transparent and fitted with a safety interlock switch, the other supports the control box. THOMAS DUOMEL THOMAS EXTRACTINE Suitable for up to 5 hives, this machine is a little gem. Hand operated with an integral strainer and 50kg settling tank. It will hold 3 shallow frames of any size tangentially. 400mm diameter, 870mm high. BATI PRESS BATI The extracted honey is clear. Place the combs vertically in the fixed Place the combs vertically compress cage. Turn the handle to The the combs from top to bottom. and cappings and honey are extracted This can be immediately strained. normal technique differs from the rough comb crushing because the perpendicular compression of cells allows a perfect separation of honey and wax. The pressed wax at the end little of the cycle contains very residual honey. A new extractor from Thomas Apiculture, from Thomas Apiculture, A new extractor and made in 304L France. Patented A simple and effective stainless steel. honey from raw solution to extract top bar hive combs, or combs or from honey. use for Heather 42 EEXTRACTORSXTRACTORS tapping screws.60mmdiameterwith19mmball. purchased separatelyandarecompletewithself lugs inside thebottomringofcage.N.B.Thelower When fittingscreens,ensurethatlowerlugsare your nineframeradialintoatangentialmachine. rod and12mmweldedmesh.Thesewillconvert In setsofthree,madefrom6mmstainlesssteel will suittheirpurpose. one, thesetoughhighimpactpolystyreneguards Whether makingyourownorreplacingabroken The smoothrunning,ballbearing extractor hasfixingpoints. 600mm tosuittheUniversalrangeprovidingyour with manualmachinesprovidingtheyhavefixingpoints, Ideal forusewithelectricextractorsbutwillalsowork 14mm, andthepinion gear12.7mm. Internal diameterof thecrowngearis see apairofgearswithbadlywornteeth. gears ataratioof2½:1.Wehaveyet to Tough, nylonconstructioncrownandpinion fitting instructionsprovided. extractors uptotwelveframes.Full attaching tothetopbarofmost speed controllerissuitablefor This combinedelectricmotorand collar sizeof12.7mmanddiameter495mm. For largermachineswealsohavethe12framecagewithadepthof400mm, tangential cagehasadepthof455mmandis375mmacrossatitswidestpoint. and thedepthis380mm.The The radialdiameteris405mm with Allenkeyandgrubscrews. 12.7mm shaftsandarecomplete Both havecollarsforfixingto cage orfortheDIY beekeeper. used forrenewinganoldexisting cages separately.Thesecanbe tangential UniversalExtractor We cansupplyeitherradialor RADIAL ANDTANGENTIALCAGE NYLON GEARS GUARD RM MOTORCONVERSIONKIT we requiretheoldbartomakeanexactcopy. heavy dutyextractorsareavailabletoreplacetheoldplasticcoatedtype.N.B. bars forbothlightweightand Replacement stainlesssteelbottom EXTRACTOR BOTTOMBAR STABILISER UNITSANDCASTORS SCREENS deep framerest. 270mm widewith50mm other willnot.460mmlong, into a“D”sectionwhilethe invariably findthatonewillfit “D” ofthelowerring.Youwill xrco prs Pie PackedWt. Price 9 FrameRadialCage Extractor Spares Castors, setof3 Stabiliser unit Set ofScreens Tangential Cage 12 FrameRadialCage do not THORNE BEEHIVES– 01673 858555 need locatingina castors canbe • £100.00 £108.70 £163.00 £108.70 THE COMPLETEEQUIPMENTSUPPLY COMPANY £19.00 £32.00 www.thorne.co.uk 0.3 5 3.8 6.9 10 6.9 approximately 2kgs. sack measures370x285mmandhas acapacity will berequiredfora400mmdiametercage.The extractor isaccuratelybalanced.Ideallythreesacks clip andspintheextractorcage.NBensure your cappingsinthesack,closestainlesssteel ring ofthemajorityhoneyextractors.Place A tough,nylonmeshsackthatfitsoverthetop very littleimbalance.800mmhigh. at 1500rpmdriescappingsadmirablywith 240mm diameterbasket(removable)spinning suited foruseina100+hiveoperation. income. Thisefficientcentrifugeisideally the beekeeperwithavaluablesourceof premium productsandwhencleanedprovide beekeeping. Cappingsareoneofthehives Dealing withcappingsisacrucialpartof plastic. Verycomfortabletouse. Produced fromveryhardwearingandvirtuallyunbreakable for thehandwheelversion. simple crankedand14mm bore sizesof12.7mmforthe Two stylesareavailablewith CAPPINGS MELTERANDHONEYLIQUIFIER SPARES SIDE HANDLES CAPPINGS SACK THOMAS MINICENTRIFUGE Cappings Sack Mini Centrifuge Ball Bearing,8mm Roll Pin, Allen key,3mm S/S GrubScrewM6x6or12 Nylon Bush,½"or 14mm sidehandle 12.7mm sidehandle Nylon Gears Guard RM Motorconversionkit xrco prs rc PackedWt. Price Bronze Bush½" Extractor Spares PackedWt. Price Bottom Bar Extractor Spares apns Pie PackedWt. Price Cappings MelterandHoneyLiquefier Cappings 3 ⁄ 16 " 9 ⁄ 16 " Depth ofchamberundermotoris500mm. 55cm. Heightincludingfanmotor:approx.85cm. adjusted from30-110°C.2000W/230V.Diameter: The spiralheatingelementcanbethermostatically surface. ensures anevenheatdistributiononthewax-honey honey withoutoverheatingthehoney.Thefan Honey Liquifierautomaticallyseparateswaxfrom integrated inthelid.TheCappingsMelterand element whichtogetherwithanelectricfanis Made fromstainlesssteel.Withtheaidofaheating • [email protected] £2652.00 £1300.00 £400.00 £18.65 £29.00 £12.74 £37.60 £12.50 £1.50 £0.50 £0.50 £0.50 £0.50 £2.00 £6.60 0.2 51 20 0.06 0.06 0.06 0.06 0.06 0.4 0.7 0.15 0.2 7 1 0.06 HHONEYONEY TTANKS,ANKS, VVALVESALVES aandnd SSTRAINERSTRAINERS 43 NEW 1.2 0.2 0.35 1.7 4 3 3 3 4 1.5 £6.60 £20.00 £10.00 £21.00 £20.00 £45.00 £13.00 £27.60 £44.10 £59.90 – THORNE BEEHIVES THORNE – [email protected] ” nylon honey • 2 ⁄ 1 Strainers Price Packed Wt. Packed Strainers Price Stainless Steel Double Strainer Nylon Double Strainer Conical Tap Strainer Honey/Wax Separator 40kg. Tank Only 40kg. Tank and Valve Tanks Price Packed Wt. Packed Tanks Price Mini Strainer and Tank VF Mini Strainer and Tank 15kg. Rectank Only 15kg. Rectank and Valve STAINLESS STEEL DOUBLE SLIDE STRAINER NYLON DOUBLE STRAINER CONICAL TAP STRAINER Made in stainless steel with a coarse 1.5mm straining mesh. The wire handle makes this strainer suitable for hanging on the tap of a honey tank or extractor. Diameter 135mm. 40kg. TANK and clamp valve. Will take either a band 40kg. straining bag. Overall tion or combina 370mm. height 410mm; diameter They are designed for single use only but can be used more if the lid is not clipped on fully. HONEY/WAX SEPARATOR HONEY/WAX steel A square stainless will hold container which 3-4 approximately kgs. Place under the uncapping the tray outlet. As the wax mixture cools, floats on top of the honey. The honey can be poured off from the baffle spout. A large double strainer with adjustable arms. An essential bit of beekeeping kit that will not break the bank. 240mm diameter. Arms, when extended, open to 420mm. Suitable for our 40 kg. tank. Coarse mesh has an aperture of 1.5mm and the fine 0.5mm. Depth of top strainer is approx. 40mm. A very effective and inexpensive version of the popular stainless steel strainer. Ideal for 30lb. buckets. Food grade plastic and nylon mesh, probably the most popular strainer we have. Diameter 225mm. 3 point location lugs fits a 30lb. bucket. By using a wooden lath it also fits our 40kg tank. Strainers are 16 and 30 mesh per inch. Available with or without 1 Available with or without 12 15 www.thorne.co.uk www.thorne.co.uk £520.00 £600.00 • ” nylon valve. Plastic 2 ⁄ 1 ” nylon honey valve. 2 ⁄ 1 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS 50kg tank complete with both strainers Stainless Steel Tanks Price Packed Wt. 100kg tank complete with both strainers The VF (vacuum filtration) Mini Strainer will speed up the filtering of your honey significantly. The 0.6mm stainless strainer part of the set seals itself to the main vessel as the small vacuum pump is operated with just a few simple strokes. As the vacuum is formed below the honey passes quickly through the strainer. The vacuum is sustained as long as the mesh of the strainer is covered. Spare hose included. For extra fine straining, use cloth on top of stainless steel mesh. Store in frost free area. This is an ideal, compact, filtering system for the small honey producer. The 0.6mm stainless steel mesh strainer is sealed into a large capacity inner bowl. It has a strong plastic handle and loose fit lid. VF MINI STRAINER MINI STRAINER AND TANK 100kg honey tank. 375mm diameter, 690mm high. tank. 375mm diameter, 690mm 100kg honey 50kg honey tank. 375mm diameter, 390 mm high. 375mm diameter, 390 50kg honey tank. 50 and 100kg in capacity with an excellent Clean Cut, spring loaded valve for Clean Cut, spring loaded in capacity with an excellent 50 and 100kg time after time. perfect bottling STAINLESS STEEL TANKS STEEL STAINLESS tanks from Thomas in France. Quality made carrying handle. Available with or without 1 Compact and easy to store, this small tank and valve is ideal for the small producer. 370mm long, 240mm wide, 270mm high. 1 15kg. RECTANK 44 HHONEYONEY TTANKS,ANKS, VVALVESALVES aandnd SSTRAINERSTRAINERS available- forthe40kgor70kgtanks. gravity; speedinguptheprocess.Twosizes is strainedunderpressureaswellby head ofhoney.Thisensuresthatthehoney conical shapeofthebagallowsforalarge suitable foryourexhibitionhoney.The Made from200micronratedclothsoare included withthevalve. steel tank.Athreadedstainlessboss is for weldingorsolderingintoastainless seal whichwillfitthefrontandback. – thumbscrews,hingeboltsandrubber Spares areavailabletofitthesevalves included. STRAINING CLOTHS accurate cutoff.1 A Thorneproducedstainlessvalvewith STAINLESS STEELVALVE 1 NYLON HONEYVALVE CONICAL NYLONSTRAININGBAGS will cutandassembletoorder. us knowthecircumferenceofyourtankandwe it dropsinthehoney?Soldpermetrelength.Let times haveyoutiedonaclothonlytofindthat around thetopofhoneytank.Howmany An efficientdeviceforsecuringastrainingcloth STAINLESS STEELBANDANDCLAMP the market. version isoneofthefinesthoneystrainingclothson ideal forfilteringexhibitionhoney.The200micron cloths usedextensivelyinthefoodindustryandare medium (500microns).Theseareindustrialstraining Two typesinmetresquares.Fine(200microns)and MICRON RATEDSTRAININGCLOTHS sizes ofnylonclothcanbesuppliedtoorder. for containersupto500mmindiameter.Special Circular clothsmadeinnylonwithpulltapessuitable wooden orsteelpresses. can befoldedinto“envelopes”forusein coarse intexture;idealforheatherhoney.They Linen scrimare79x100cmsandverystrong exceptionally fine. Nylon clothsare700mmxand Large ConicalNylonBag Small ConicalNylonBag Clamp Medium MicronRatedSquare Fine MicronRatedSquare Circular withtape Linen Scrim Stainless SteelBand,metre Strainers Price Packed PackedWt. Price Wt. Nylon, square Straining Cloths 1 ⁄ 2 ” borewithaccuratecutoff.Backnut THORNE BEEHIVES– 01673 858555 1 ⁄ 2 ” bore.Ideallysuited £19.00 £33.00 £33.00 £12.00 £25.30 £5.00 £4.80 £9.50 £3.20 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.06 0.06 0.06 0.06 0.2 0.2 0.06 0.2 0.06 TANK ISNOTINCLUDED. is 15kgs. Minimum quantityrequiredtodepressthespring tanks holdingbetween25kgs.and75kgs.ofhoney. maximum heightof700mm.Suitable,therefore,for tanks between300mmand350mmdiametera It isrecommendedforplasticorstainlesssteelbottling complete withback-nutandseal. across threads),50mmbore(60mmthreads).All 33mm bore(42mmacrossthreads),40mm(49mm ensures averycleanandaccuratecut-off. Three sizeswithastrongspringloadedgatethat LIQUID LEVELSENSOR HONEY TIPPER purposes. Willfitvirtuallyallsizesofhoneytank. a bucketortinontopofhoneytankfordraining Simple andpracticaldeviceinstainlesssteeltohold POURING AID HEXVALVE CLEAN CUTVALVE additional lathstoholdinplace. an additionallathtostabilise.Willalso workovera40kgtankifusingtwo over arectankwhenplaceddiagonally fromthecorneroftank-mayneed beekeeper withasmallnumberofhives.Willalsowork the waxandhoneytoseparate.Idealforhobbyist bucket. Thesecanthenbeslowlywarmedtoallow fork orknifetouncap.Thecappingsfallintothe top oftheframewhilstyouuseanuncapping the endoftopbarintohole.Hold uncapping. Placeovera30lbbucketandplace A simplewaytostabliseyourframesduring BUCKET BAR 15lb: 210mmdiameter,170mmhigh.30lb:280mm220mm removed withoutbreakingtheseal. tamper seals.Oncethelidisonforfirsttime,itcannotbe high whenfullwithliquidhoney.Bothsizeshaveintegral considerably onstoragespace.Donotstackmorethanthree Easy tocleanwithsnap-onlids.Bothsizesnestsaving 15lb. AND30lb.BUCKETS will ‘beep’assoonhoneytouchesthesensor. bucket orhoneytankandpourinliquidhoney.Thealarm Clip thissmallbatteryoperatedalarmovertherimofyour tightly inplace. where thebodyofvalvecanthenbescrewed locking nutfitsneatlythroughtheholeinvessel in vesselneedstobe46mmdiameter.Thethreaded A securevalvewithfaceboreof40mm.Thehole Bucket Bar 30lb. Bucket oe trg Ec Pce t Pr1 Packed Wt. Per10 PackedWt. Each 15lb. Bucket Honey Storage Liquid LevelSensor Tipper Pouring Aid Hexvalve Clean CutValve,Large Clean CutValve,Medium Clean CutValve,Small PackedWt. Stainless SteelValve Rubber Seal Hinge Bolt,S/Steel Price Thumbscrew, S/Steel Thumbscrew, plated Nylon Valve Honey StorageandStraining £2.50 £4.43 £3.24 • [email protected] 0.15 1.2 0.8 £28.99 £13.00 £42.65 £19.00 £34.00 £31.50 £30.00 £30.00 £7.50 £0.85 £2.59 £2.83 £1.12 £8.00 £39.90 NEW 0.1 5.0 1 0.2 0.4 0.35 0.3 0.75 0.06 0.06 0.06 0.06 0.2 6.5 3.7 HHEATHEREATHER HHONEYONEY aandnd HHONEYONEY PPROCESSINGROCESSING 45 0.4 0.5 0.75 0.25 0.06 1.5 1.0 2 0.25 0.5 £7.50 £3.00 £16.00 £22.00 £40.00 £22.55 £48.00 £80.00 £34.45 £25.00 – THORNE BEEHIVES THORNE – [email protected] • is liquid. Immerse the creamer and move it up and is liquid. Immerse the creamer 3 ⁄ 1 Honey Processing Honey Blade Honey Trowel Honey Spade Honey Scoop Honey Spatula Each Packed Wt. Mixing Honey Corkscrew Mixer Honey Churner 4" Mixing Propeller Propeller Blade, 4" Honey Creamer Price Packed Wt. HONEY TROWEL HONEY SPADE HONEY SCOOP HONEY SPATULA HONEY CREAMER HONEY BLADE MIXING PROPELLER MIXING down, being careful to keep the plunger below the level of the honey to avoid the plunger below the level of the honey to avoid down, being careful to keep drawing in air. For breaking up and transferring honey in deep containers. All stainless steel construction, 2mm thick curved blade with bevelled edge. Blade welded to a 20mm diameter shaft with ‘T’ head 55mm long. Overall length 510mm. A stainless steel shaped tool for scooping honey from buckets and tanks. Securely screwed, plastic handle. 355mm long. Scoop is 100mm at widest point. Flexible and strong plastic spatula for clearing/ cleaning remnants of liquid honey from buckets and honey tanks. 200mm long, 90mm wide. 100mm diameter, all stainless steel. Can be powered by an electric be powered by an electric all stainless steel. Can 100mm diameter, 600W) with a 12mm chuck. drill (at least purchased Blades can be fitting to your separately for own 12mm shaft. a wooden ‘T’ handle. The simplest creaming device. Made from aluminium with in diameter head. Carefully warm granulated honey 660mm long with a 125mm its container until approx. Stainless steel tool for scraping really stubborn granulated honey. 2mm thick stainless steel with bevelled edge. Blade is 120mm x 70mm. Riveted plywood handle, overall length 140mm. Use this tool to break up and transfer granulated honey. 2mm thick, slightly curved blade with honed edge. Blade is 170mm long and 85mm wide. 190mm long, shaped handle. 2 18 0.45 0.06 25 0.1 0.1 www.thorne.co.uk www.thorne.co.uk £1.75 £8.20 £8.20 • £28.80 £26.65 £317.00 £1600.00 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Mixer Wire only for above Economy Honey Press Economy Press Bag M.G. Heather Press Bag Spiral Mixer Smith Cutter/Scraper Heather Honey Price Packed Wt. HONEY CHURNER CORKSCREW MIXER THOMAS MIXER SPIRAL MIXER This mixer is fitted to a 100kg honey tank. The single speed 370w motor revolves at 35rpm. The device is very useful for seeding and creaming honey. A must for all serious honey producers. 750mm high 375mm diameter. This stainless steel mixer is suitable for heavy-duty electric drills. 10mm shaft, 650mm long with a 75mm diameter spiral. M.G. HEATHER PRESS BAG Heavy duty stainless steel mixing blade. 610mm long, 90mm diameter head, 10mm shaft. Strong, linen scrim bags. 380mm long, 230mm wide and Strong, linen scrim bags. 380mm long, 230mm wide combs 280mm deep. They will hold three full size B.S. Deep or six shallow. Manufactured at Rand. Solid hardwood timber Manufactured at Rand. Solid . Stainless steel base measures 355mm square 210mm in basket with 6mm perforations, Supplied with diameter and 240mm deep. bag which a specially shaped linen scrim can also be supplied separately. Easily disassembled for cleaning. N.B. Do not exert extra pressure by use of a tyre lever or similar. Manual machine for separating heather Manual machine for separating from the comb. or particularly thick honey bag, place into the Fold comb into the scrim onto the bag and basket, place wooden plate into the channel and turn handle. Honey flows down into your own container. Stainless steel spiral, overall length 685mm, diameter of spiral 80mm, diameter of shaft 8mm. Fit it to an electric drill. ECONOMY HONEY PRESS SMITH CUTTER SCRAPER CUTTER SMITH cutting the comb away with wooden handle for Stainless steel wire into the sheet. Insert the tensioned from the foundation draw downwards. Then one end of the frame and at The comb is and scrape off the comb/honey. reverse the tool 120mm handle. Overall be pressed. 90mm blade, now ready to wire can be purchased High tensile stainless steel length 250mm. separately. 46 HHONEYONEY PPROCESSINGROCESSING 400mm. above woodenbattensis 345 x325mmhigh.Height Internal dimensions:685x x 395530mmhigh; External dimensions:735 approximately 70°C. attainable temperatureis minutes. Maximum minutes; 65°C–54 – 8minutes;50°C16 30°C –4minutes;40°C 20°C –2minutes; attained:- following temperaturesare further insulation,the above thebase.Without approximately 100mm perimeter ofthecabinet which isfittedinsidethe cable, madebyourselves, provided bya25wheating wooden battens.Heatis two 30lbbucketson controlled cabinetholds This thermostatically considerably. 500mmdiameter,320mmhigh. This initialpre-filteringwillspeedupprocessingtime The heateris500wandthermostaticallycontrolled. speed filteringandhas6mm4mmmeshstrainers. outlet ofyourhoneyextractor.Thetankisheatedto This smallsettlingtankisdesignedtofitunderthe up to10kgscapacity.Poweroutputis50w.170mmdiameter. An inexpensiveheaterformeltingsethoneystoredinbucketsof 320mm (70kgtankisnotincluded). suitable forshowing.Tripodis500mmhighwithadiameterof liquid honeydrastically,producingbeautifullyclearrunny makes viscoushoneyhandlingapleasure.Speedsupfilteringof stand, micronratedcloth(200)andstainlesssteelsupportcone side ofcontainer,canbeusedwiththesystemillustrated.Tripod 350w thermostaticallycontrolledheater,shapedtohangover COILED HEATERSYSTEM WARMING CABINET CLEANOMEL CLARIFIER MINI HONEYLIQUEFIER Cleanomel Mini HoneyLiquifier Pedestal Heater strainer forabove Stand, supportand oe rcsig rc PackedWt. Price Coiled Heater Honey Processing THORNE BEEHIVES– 01673 858555 and letheaterworkitswaydown. element andthermostat.Standonsurfaceofsethoney Strong androbuststainlesssteelconstructionwithreplaceable and willswitchon/offasthetemperaturecontroldemands. liquefies tubsofcrystallisedhoney.Thethermostatisadjustable A 220mmdiameterheater(250W)whichquicklyandsimply PEDESTAL HEATER £950.00 £360.00 £120.00 £77.00 £62.40 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 15 2 7 2 2.5 temperature 85°C. of 30Wpermetre.Maximumattainable Warms honeyslowly.Thecablehasanoutput around stainlesssteeltanksandextractors. with capillaryprobe.Suitableforwrapping Thermostatically controlled,8metresinlength cabinet. Outputisapprox.10wattspermetre. supplied. Allwerequirefromyouaretheinternaldimensionsofproposed to measureheatingcablekitinstallyourself.Fullinstructions a redundantfridgeorfreezer,wecanalsoproducemade If youareconsideringalargercabinetorconverting instructions. the necessaryelementandthermostatwithfullfitting cabinet, similarinsizetotheabove,wecansupply If youareconsideringmakingyourownwarming included). 100Wattmotor. and cleanfillinghead.115V(transformer the headonceprimed.Quicktodisassemble is capableofliftinghoneyfrom1mbelow operate electroniccontrolunit.The‘FillUp’ pipe andtubingrequired).Simpleto and cantransfer260kgs.perhour(additional grammes. Thedevicewillalsooperateasapump 300x1lb. jarsperhour.Accuratetowithin3 between 20g.and9999g.capableofbottling Suitable forcreamedandliquidhoney.Fullyadjustable Small andefficientbottlingunitofmodulardesign. N.B. Honeymustbestirredfrequentlytoavoidhotspots. 480mm high,390mmdiameter. water canbemadeliquidovernight.120minutetimer. a 30lb.bucketofgranulatedhoneydroppedinto Alternatively byusingasteelgridorwoodenblocks low temperaturesettingandpreparedforbottling. can beheateddirectlyinthecontaineronavery with arangebetween30°and100°C.Honey a 1800Wthermostaticallycontrolledheater This unitwillhold70lbs.ofhoneyandcontains stainless steelvalveataveryaffordableprice. A superbstainlesssteelheatedbottlingunitwith height 880mm,overalldiameter325mm. liquefy 25-50kgs.perhourdependingonconsistencyofthehoney.Overall either, liquidorgranulatedandswitchontheheater.Thedevicewillfilter between 30°Cand80°C.Addthehoneytobeprocessedtopchamber This hasathermostatcontrolwithrange in diameter,isplacedthetopchamber. heated. A500Wflatspiralheater,270mm condensate toescapeasthehoneyis a 50mmperforatedsteelringthatallows steel valve.Betweenthetwoelementsis hold 50kgs.+andhasachromeplated with asteelhoop.Thelowertankwill fine nylonclothwhichistrappedinplace steel meshbase.Abovethisisplaceda of anupperchamberwithastainless liquid andsethoney.Thedeviceconsists today. Itwilldealadmirablywithboth one ofthemostefficientonmarket This heatingandmeltingsystemisprobably MELITHERM SYSTEM HEATING CABLE HONEY WARMINGKIT NASSENHEIDER 'FILLUP' BABY BOTTLER oe rcsig rc PackedWt. Price Heating Cable Bespoke HoneyWarmingKit Honey WarmingKit Warming Cabinet Honey Processing oe otig rc PackedWt. Price Nassenheider Fill-up Baby Bottler Melitherm System Honey Bottling • [email protected] £2640.00 £1050.00 £200.00 £210.00 £349.50 £87.00 POA

3 1 16 15 10 30 LLABELSABELS 47 0.4 0.7 0.4 0.7 0.06 0.06 £7.70 £6.35 £26.80 £47.65 £20.20 £35.50 – THORNE BEEHIVES THORNE – ge 49. your text. Please see the basic regulations see the basic regulations your text. Please [email protected] • Labels Price Packed Wt. Packed Price Labels L4 Labels, 100 L4 Labels, 500 L4 Labels, 1000 All other labels on this page, 100 All other labels on this page, 500 All other labels on this page, 1000 L.25 L.26 L.20 L.21 L.22 Word “Honey” is pre-printed. Word “Honey” White, yellow or clear. www.thorne.co.uk www.thorne.co.uk •

format. Lincolnshire, Forest of Dean, Scottish Borders. honey must be at least 75% of that particular type. label. It does not need to be complete but you should be able to be found from the information. number. now. England, Produce of Scotland, Harvested in Wales. Adding the country to the end of your address is not acceptable. 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

2. be on the label – we will ensure it is the legal size and The weight must 3. the area where the honey is produced. For example, You can specify 4. the type of honey. For example, Heather, Borage. The You can specify 5. the honey, you must have your name and address on the If you are selling 6. the honey through a third party, you must have a lot If you are selling 7. a best before date on the jar. We suggest 2-5 years from You must have 8. a country of origin on the jar. For example – Produce of You must have 1. is required. The Word “HONEY” Below is our simple advice on honey labelling. For more detailed information – go to the website of the Food Standards Agency. UK Honey Labelling Regulations L.4 L.2 below to guide you on the correct wording required in the UK. Concise details of sizes and print parameters will be found on pa print parameters will be details of sizes and required in the UK. Concise you on the correct wording below to guide 60-80% size. shown at approximately All labels are L.1

CENTENARY LABEL CENTENARY LABELS then decide the basic label and labels in the world. Choose the best selection of honey pages of labels. Probably Introducing 8 Word “Honey” is pre-printed. 48 LLABELSABELS Word “Honey”ispre-printed. L.27 L.42 L.41 L.40 L.29 L.28 THORNE BEEHIVES– 01673 858555 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk see page56. crystal containers, Perfect forthe your combhoney. customer cansee Clear labelso Clear labelsocustomercanseeyourhoney. L.60 L.50 Portrait L.50 Landscape STH COMB STH All otherlabelsonthis page,1000 All otherlabelsonthispage,500 All otherlabelsonthispage,100 L60 Labels,1000 L60 Labels,500 L60 Labels,100 Labels Price Packed Wt. • [email protected]

£35.50 £20.20 £52.80 £29.70 £6.35 £9.25 0.06 0.06 0.7 0.4 0.7 0.4 HHIVESLLABELSAIVBEESL Saandnd BBEESEES 4949 0.35 0.4 0.8 0.06 0.06 0.06 0.4 0.06 0.4 0.7 0.06 0.4 0.7 £2.60 £6.35 £15.00 £20.20 £35.50 £1.75 £5.10 £3.30 £16.30 £23.30 £43.30 £15.00 £27.70 – THORNE BEEHIVES BEEHIVES THORNE THORNE – –

[email protected] • White Granulation Label, 1000 L60 Granulation, 100 L60 Granulation, 500 L60 Granulation, 1000 STH Granulation Label, 100 STH Granulation Label, 500 STH Granulation Label, 1000 Labels Price Packed Wt. Wt. Packed Packed Price Price Labels Round Section Labels, 10 Round Section Labels, 100 Labels Squeeze Bear, L7 & L8 Labels, 100 Squeeze Bear, L7 & L8 Labels, 500 Squeeze Bear, L7 & L8 Labels, 1000 Granulation or Combi-Labels White Granulation Label, 100 Pack Packed Wt. SQUEEZE BEAR STH Clear label so customer can see the honey in the squeeze bear. See page 56. L.7 & L8 Label includes both granulation Label includes and infant information. mm x 25 mm; White label 76 mm x 51 mm. STH label 76 COMBI-LABEL www.thorne.co.uk www.thorne.co.uk • letters in lines of characters Max. No. of Max. No. of Max. No. of Size millimetres 01673 858555 SERVINGSERVINGYEARS YEARS 100 100 OVER OVER FOR FOR WORLDWIDE WORLDWIDE BEEKEEPERS BEEKEEPERS Centenary Label L.1 Large 76 x 51 L.1 Small L.2 18 80 x 50 L.4 60 x 40 L.5 16 L.7 4 16 L.8 heading 95 x 45 personalisation L.17 63 x 45 line per 4 L.20 Large 32 x 22 24 24 3 L.20 Small 38 x 25 12 L.21 Large 38 x 25 90 x 50 dia. 31 L.21 Medium 20 12 1 80 x 42 L21 Small 15 12 3 76 x 51 24 76 x 38 L.22 Large 20 L.22 Small 5 3 38 14 76 x 25 14 L.25 Large 3 24 76 x 51 4 L.25 Small 60 x 40 5 3 14 L.26 18 12 78 x 48 14 4 L.27 3 12 60 x 40 14 20 L.28 18 16 15 0 L.29 14 4 18 L.40 76 x 51 18 3 L.41 76 x 51 4 100 x 50 L.42 0 16 3 14 L.50 Large 76 x 51 14 12 12 L.50 Small 63 x 45 20 L.50 Portrait 63 x 45 12 6 80 x 50 16 L.60 63 x 45 12 3 60 x 40 3 STH 50 x 80 12 16 STH Comb 12 4 15 12 4 12 30 20 65 x 57 4 40 x 29 2 76 x 46 4 22 2 12 20 5 8 12 20 35 20 26 4 15 2 4 20 28 24 Label

Label sizes and print parameters Produced in the USA to seal the covers to complete a round section container. 337mm x 32mm. Produced in the USA to seal the covers to complete ROUND SECTION LABEL L.60 GRANULATION STH GRANULATION Clear label. 76 mm x 51 mm. GRANULATION Includes use of for the reverse of the jar. tion label instruc Self adhesive x 25mm. microwave. 76mm 50 HHIVESIVES aandnLLABELSdA BBEESBEEELS Sizes: Large 80x51mm;Medium63.5x46.6mm;Small only thecentrepanel. Designs L201-204coverthefulllabelandL205onward then addyourowntext. Choose fromthedesignsbeloworonline,yoursizeoflabeland examples belowandourwebsiteformoredetails. Available in8sizesandapproximately80designs–see SPECTRUM LABELS TINY –L209DESIGN SMALL –L259DESIGN MEDIUM _L234DESIGN LARGE –L202DESIGN L201-L217, Large,250 Labels Price Packed Wt. L201-L217, Large Oval,1000 L201-L217, LargeOval,500 L201-L217, SmallSquare,1000 L201-L217, SmallSquare,500 Small Oval,1000 L201-L217, LargeSquareor Small Oval,500 L201-L217, LargeSquareor L201-L217, Tiny,1000 L201-L217, Tiny,500 L201-L217, Small,1000 L201-L217, Small,500 L201-L217, Medium,1000 L201-L217, Medium,500 L201-L217, Large,1000 L201-L217, Large,500 THORNE BEEHIVES– 01673 858555 60x49mm. Small Square40mm;LargeOval95x53mm, 63.5x38.1mm; Tiny38.1x21.2mm;LargeSquare51mm, • £45.00 £30.00 £25.80 £17.35 £30.85 £20.00 £16.50 £11.50 £21.70 £15.35 £23.20 £16.10 £31.50 £20.20 £10.75 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.8 0.5 0.8 0.5 0.8 0.5 0.5 0.3 0.8 0.5 0.8 0.5 1.2 0.8 0.5 LARGE OVAL–L222DESIGN LARGE SQUARE–L254DESIGN SMALL SQUARE–L212DESIGN SMALL OVAL–L221DESIGN L218-L296; L501-L505,Large,250 Labels Price Packed Wt. L218-L296; L501-L505, LargeOval,1000 L218-L296; L501-L505,LargeOval, 500 L218-L296; L501-L505,SmallSquare, 1000 L218-L296; L501-L505,SmallSquare, 500 Small Oval,1000 L218-L296; L501-L505,LargeSquare or Small Oval,500 L218-L296; L501-L505,LargeSquare or L218-L296, Tiny,1000 L218-L296, Tiny,500 L218-L296; L501-L505,Small,1000 L218-L296; L501-L505,Small,500 L218-L296; L501-L505,Medium,1000 L218-L296; L501-L505,Medium,500 L218-L296; L501-L505,Large,1000 L218-L296; L501-L505,Large,500 • [email protected] £51.40 £32.15 £29.00 £19.20 £34.25 £21.85 £18.35 £12.65 £24.50 £16.90 £26.40 £17.80 £37.00 £23.00 £12.20 0.8 0.5 0.8 0.5 0.8 0.5 0.8 0.5 0.8 0.5 0.8 0.5 1.2 0.8 0.5 HHIVESLLABELSAIVBEESL Saandnd BBEESEES 5151 0.5 0.8 1.2 0.5 0.8 0.5 0.8 £12.80 £24.25 £39.60 £18.50 £28.10 £17.35 £25.70 – THORNE BEEHIVES BEEHIVES THORNE THORNE – – [email protected] L.406 L.402 L.300 L.303 L.403 • L401-L408, Large, 500 L401-L408, Large, 1000 L401-L408, Medium, 500 L401-L408, Medium, 1000 L401-L408, Small, 500 L401-L408, Small, 1000 Labels Price Packed Wt. Packed Labels Price L401-L408, Large, 250 0.8 0.5 0.8 0.5 0.8 1.2 0.5 L.408 L.401 L.405 L.302 L.298 www.thorne.co.uk www.thorne.co.uk £37.75 £21.40 £34.00 £16.75 £32.35 £55.80 £23.35 •

01673 858555 SERVINGSERVINGYEARS YEARS 100 100 OVER OVER FOR FOR WORLDWIDE WORLDWIDE BEEKEEPERS BEEKEEPERS

L.297-L304, Small, 500 L.297-L304, Small, 1000 L.297-L304, Large, 500 L.297-L304, Large, 1000 L.297-L304, Medium, 500 L.297-L304, Medium, 1000 L.297-L304, Large, 250 Labels Price Packed Wt. Packed Labels Price L.407 L.404 L.304 L.301

L.297 SPECTRUM LABELS SPECTRUM Small 63.5x38.1mm. Medium 63.5x46.6mm; Sizes: Large 80x51mm; L.297 – L.408 Full colourdesign,largesquare Full colourdesign,Smallsquare Full Colour,design,Small Full Colour,design,Medium 52 0 Packed 500 wt. 1000Packed wt. Full Colourdesign,Large HHIVESIVES aandnLLABELSdA BBEESBEEELS information. address orother Simple whitelabelfor only. 2 linespersonalisation Any textcanbeused. background. 51mm diameter,white L402 POLISH Any weight. with 20charactersperline. Diameter 70mm.Maximum:4lines POLISH L.5 38.1mm. Square,51x51mmand4040mm. rectangular, 80mmx51mm;63.5mm46.6mmand We willprintyourhoneylabels,usingthisandanytext.Labelsare local beautyspotorlandmarksomethingcompletelydifferent. Send usaphotographorcolourdrawingofyourapiary,house, UNIQUE LABELS oihLbl Pc PackedWt. Pack Polish Labels,100 Polish Labels L5 Labels,1000 Labels Price Packed Wt. L402 Polish,Round, 1000 L402 Polish,Round,500 L4 Polish,Personalised,1000 L4 Polish,Personalised,500 L4 Polish,Personalised,100 L4 Polish,100 Polish Labels,Personalised,1000 Polish Labels,Personalised,500 Polish Labels,Personalised,100 Polish Labels,1000 Once onlyOriginationCharge Unique Labels THORNE BEEHIVES– 01673 858555 £29.70 £23.60 £23.60 £25.80 £36.40 £21.65 of 3lineswith20charactersperline. 90g. Canbepersonalised.Maximum 63mm x45mm.Wt.70g,80gor L.4 POLISH 0.6 0.5 0.5 0.8

0.5 • £33.25 £21.85 £35.50 £20.20 £57.40 £33.20 £42.35 £12.70 £6.35 £3.30 £9.30 £5.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk £49.00 £38.15 £38.15 £42.60 £63.90 0.8 0.5 0.7 0.4 0.06 0.06 0.7 0.4 0.06 0.7 0.06 0.2 1 0.8 0.8 0.8 1.2 n fteaoe 0 aesol Any oftheabove.100labelsonly Panel design,largesquare Panel design,Smallsquare Panel design,Small Panel design,Medium 60mm x49mm. Oval labelis 51mm diameter. Round labelis L.402 Round/Oval and BfD20cents. Also availableBfD15c is giventoBfD. Thornes sothetotalcost printed anddonatedby x 21.2mm.Thelabelsare Each smalllabelis38.1 Labels, 65persheet. Bees forDevelopment BfD 10p BfD TAMPER and alltheirgoodwork. Improve yourhoneysaleswiththeselabelssupportingBeesforDevelopment BEES FORDEVELOPMENT nqeLbl 50 akdw. 00 Packedwt. 1000 Packedwt. 500 Panel design,Large Unique Labels L402, OvalorRound,500 Labels Price Packed Wt. L402, OvalorRound,1000 f aes rc PackedWt. Price BfD RectangularLabels BfD Labels BfD TamperLabels, 100 BfD TamperLabels,50 BfD Labelsarealsoavailablein French,German,Dutch,Spanish, Italian, Portugese,DanishandRussian. • [email protected] £22.70 £18.35 £18.35 £19.75 £26.30 0.6 0.5 0.5 0.5 £17.50 0.5 £12.00 £33.25 £21.85 £6.00 £6.50 0.5 £35.50 £27.90 £27.90 £30.90 £43.70 Free Free Free 0.8 0.5 1 0.8 0.8 0.8 0.8

HHIVESLLABELSAIVBEESL Saandnd BBEESEES 5353

H

T

R

Y ES A 2022 E E E Y

D N B E N O E

E E N H H H O

T E T

T

0.25 0.4

H

0.06

R E

T T T

C

O

S

W

E C

A

T F

F T

E E

R

O O

R S B

B P T E £6.00 T S O £13.10 £23.40 PR – THORNE BEEHIVES BEEHIVES THORNE THORNE – –

Any wording or weight. £2.32 £10.50 £19.60

[email protected]

N •

S

E ENT

NM E E

2023 O E ON Y

D E IR H

N V B E N E G

E N

W U H I

E E T

A N H

R

T T

Q

N S O

I

T C

F

I

C

E E

W

E

A

T B T D

B

W

E O

A R

T

S

E R O P

B

S E E PR

oz. H

2 T ⁄ 1 L.11 ENVIRO L.11 EARTH L.11 BABY L.11 RH L.11 AWARD L.11 Special L.11 C8 L.11 B22 L.11 B23 L.11 C8 L.11 QU L.11 SSH L.11 L.11 Labels, 500 L.11 Labels, 1000 Labels Standard Special Packed Wt. Packed Special Labels Standard L.11 Labels, 100 Printed with “Pure Honey” and 28g. 1oz.; 42g. 1 or 57g. 2oz. Also available: Direct from the Producer; The whole world loves honey; Pure min wt 170g 6oz; Best before end 2018; Best before end 2019; Best before end 2022; Soft set honey, easily spreadable; Pure Honey with added pollen. 0.06 0.25 0.4 BEST BEST £4.30 www.thorne.co.uk www.thorne.co.uk BEFORE BEFORE £12.85 £21.40 END 2020 END 2022 •

Wording of your choice. £2.32 £10.50 £19.60 BEST BEST BEFORE BEFORE END 2023 END 2021 01673 858555 L.17 HB L.17 SPECIAL L.17 SSH L.17 HH L.17 JAR SS L.17 L.17 CH L.17 BA L.17 B23 L.17 CR L.17 B21 L.17 B22 L.17 C8 L.17 B20 L.17 SERVINGSERVINGYEARS YEARS 100 100 OVER OVER FOR FOR WORLDWIDE WORLDWIDE BEEKEEPERS BEEKEEPERS L.17 Labels, 100 Labels Standard Special Packed Wt. Packed Special Labels Standard L.17 Labels, 500 L.17 Labels, 1000 Diameter 31mm. White circular label with bee in centre. Diameter 32mm. Also available: Best before end 2018; Best before end 2019; Pure Comb Honey, min wt 170g 6oz; with added pollen; Blossom Honey; Honey Soap; Propolis; Lip Balm; Honey Hand Cream; Pure Beeswax Polish; Heather Comb Honey; This product contains nuts; Cappings; Borage Honey; Spreads easily; Soft set easily spreadable. 54 HHIVESIVES aandnLLABELSdA BBEESBEEELS 100mm. Co-ordinatewithyourlabelorusequeenmarkingcolourcodes. Hexagon fitsontothecentreoflidwithtailsealingjar.30mmacrosshexagon,overalllength L.12 TamperEvidentLabel granulation labelontheother. by theproductlabelononesideandperhapsa to fitbothsidesofajar.Thetailsbeingcovered This extralonglabel,162mm,hasbeendesigned L.32 DOUBLEENDED All exceptclearandtartancanbepersonalisedonthetailwithyourowntext. L.12 PERSONALISED L.12 BEE .2 e rhv,50 N/A N/A L.32, beeorhive, 1000 L.32, beeorhive,500 L.32, beeorhive,100 L.12, Clear,1000 L.12 Clear,100 L.12, Tartan,1000 L.12 Tartan,100 or plain,1000 L.12 bee,skep,hive or tartan,500 L.12 bee,skep,hive or tartan,100 L.12, bee,skep,hive Labels Plain Personalised Packed Wt. THORNE BEEHIVES– 01673 858555 BEST BEFOREEND2021 Yellow/Green Green/Green White/Green White/Gold Gold/Black £30.00 £28.30 £19.00 £19.00 £4.00 £3.35 £2.80 £2.80 • THE COMPLETEEQUIPMENTSUPPLY COMPANY 0.06 N/A 0.06 N/A 0.7 N/A 0.7 N/A www.thorne.co.uk Not availablepersonalised. to themarketingofyourhoney. north oftheborder.AddsacertainScottishflavour Produced speciallyforheatherhoneyproducers L.12 TARTAN tamper label.Excellentwithdecoratedlids. Impossible tophotograph!Cleartransparent L.12 CLEAR £63.25 £38.75 £12.40 £35.00 £23.20 £7.10 0.06 CONTAINS POLLEN 0.7 0.4 0.06 0.7 0.4 Purple/Black White/Black Blue/Green Red/Black L.12 SKEP L.12 PLAIN L.12 HIVE • [email protected] Yellow/Black White/Green White/Gold Gold/Black White/Red Natural Yellow White White Gold HHONEYONEY CCONTAINERSONTAINERS 55 ages. 0.15 0.15 0.2 0.2 0.1 1 18 0.25 1.5 0.65 1.3 1.3 2.6 0.15 £89.50 £56.45 £37.25 £50.24 £40.85 £36.30 £101.50 £2.90 £2.70 £1.30 £1.45 £1.50 £6.00 £1.70 £5.84 £8.20 £8.20 £2.60 £15.35 £16.00 £100.00 – THORNE BEEHIVES THORNE – [email protected]

• oz. (42g) Gold lacquered twist oz. (42g) Gold lacquered twist 2 ⁄ 1 £92.00 £80.00 £51.70 £32.50 £45.50 £36.10 £31.55 lb Jars, 10 2 ⁄ 1 Jute Bags, 3 Small Jars Green or Natural Gift Boxes, 2 Jars Green or Natural Gift Boxes, 3 Jars Jar Safe Plastic Mini Pots, 100 Plastic Mini Pots, 2000 Mini Pail, each Mini Pail, 10 Presentation Racks for 2 Round Presentation Racks for 2 Hexagonal 8oz Jars, 10 Presentation Racks for 2 x 1lb Jars, 10 Jute Bags, 2 Jars Jute Bags, 3 Jars Honey Containers Presentation Racks for 3 Glass Mini Pots, 10 Price Packed Wt. A two-part cube of polystyrene with cavity for standard 1lb. A two-part cube of polystyrene with cavity for standard tion for posting honey as a gift or (454g) jar. The perfect protec included.) ing to a show. (Jar not port trans PLASTIC MINI POTS 1oz. (28g) capacity. White snap on lid. Opaque sides with clear hexagon “windows”. Very light. Suitable for catering, hotels, samples, etc. MINI PAIL A small attractive container with lid. Plastic handle. Holds approximately 4lb. of honey. Becoming more and more Becoming more now available in popular and (113g), 8oz three sizes: 4oz (340g). All (227g) and 12oz twist off take gold lacquered follows, 48mm, lids, sized as 58mm, 63mm. GLASS MINI houses, airlines, samples, lid. Suitable for hotels, guest used with our presentation etc. The perfect gift when racks. JAR SAFE HEXAGONAL GLASS JARS GLASS HEXAGONAL One size only – circular 1

£75.00 £63.00 £43.20 £24.00 £37.00 £27.60 £23.05 www.thorne.co.uk www.thorne.co.uk • lb Jar, the lid is the 63mm twist lb Jar, the lid 2 ⁄ 1 N.B. All glass jars are sent at consignees risk. We regret neither ourselves or the carrier can accept responsibility for break N.B. All glass jars are sent at consignees risk. 01673 858555 lb Jars, with gold twist lids, 112 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS 2 ⁄ Hexagonal Jars, 12oz, 60 1½oz Glass Mini Pots, 100 Hexagonal Jars, 4oz, 72 Hexagonal Jars, 8oz, 90 1lb Jars, with white plastic screw lid, gross 1lb Jars, with white plastic screw lid, gross 1 1lb Jars, with gold metal screw lid, gross and Islands and Glass Honey Jars Collected Including Carriage Including Carriage to England, Wales and South Scotland Scotland, N. Ireland to Highlands of NATURAL GIFT BOXES GREEN GIFT BOXES JUTE BAGS PRESENTATION RACKS For the HONEY JARS HONEY popular jar screw lid is still the most 1lb jar with gold lacquered The traditional Lids are 70mm in diameter. in use today. Natural kraft gift box designed to hold two or three 1lb or 12oz jars (could also take smaller jars), made from a durable and attractive open fluted material. Cut out window flaps that push in to create jar dividers and allows the labels of the jars to be displayed. Dark green gift boxes designed to hold two or three 1lb or 12oz jars (could also take smaller jars), made from quality board that has a dark green textured finish. Cut out window flaps that push in to create jar dividers and allows the labels of the jars to be displayed. Small jute bags made of natural hessian that is both biodegradable and Small jute bags made of natural hessian that is both clear plastic windows reusable. This jute bag has two padded cotton handles, sizes to hold two or three and has an internal waterproof lining. Three different 1lb or 12oz jars and three 8oz or 4oz jars. Made in rough sawn pine to give that rustic effect. The triple rack is supplied only in the flat and will hold 3 x 1½oz. (42g) glass mini jars. Pins for assembling are NOT able for 2 x ½lb. (227g) included. Also avail jars or 2 x 1lb. (454g) jars, standard type, and 2 x 8oz. hexagonal jars. design. 56 HHONEYONEY CCONTAINERSONTAINERS pattern downeachside.500gcapacity. hexagonal patterndowneachside.500gcapacity. stored up-sidedown. Hexagonal peripheraldesign.500gcapacity.Designedtobe silicone sealinattractivelydesignedcap. design, 1lbcapacity. over closure.Slimskepshaped silicone sealwithinscrewlid.Snap over closure100gcapacity. silicone sealwithinscrewlid.Snap CATERING COMBHOLDER pattern oneachside.500gcapacity. container withscrewcap.70mmrecessedhexagonal HEXAGONAL PETCONTAINERS PET5 PET4 PET3 PET2 PET1 PET HONEYCONTAINERS 16oz. serving. Inthreesizes8oz.12oz.and Silicone valves,cleancut-offwhen Everyone's favouritehoneycontainer. SQUEEZE BEARFAMILY shoulder ofeveryjar. twist lid.Stylishcellpatternembossedaroundthe and inexpensivetotransport.Bothjarstakea63mm 227/250g and454/500gcrystalclearplasticjars.Light PET JARS width from170to100mmforstability. 400mm wide,500mmhighandtapered unwired andusethinfoundation. bowl orjar.Framesideallyshouldbe the run-offofliquidhoneyintoanother stainless clamps.Angleddriptraywilltake Frames aresecurelyheldinplacewith or deepframe(Smithframesaswell). Each holderwilltakeeitheraBSshallow toast orcroissantisaspurepossible! in theknowledgethathoneyontheir the breakfastbuffet.Guestscanbesafe with yourlocalhotelorguesthouseat all stainlesssteel,stylish,combholders greater. Toassistinmarketingtrythese produced honeyhasneverbeen The demandforpure,qualityhome Per 50 Per 10 E oe oties rc Packed Wt. Price PET1, per10 PET HoneyContainers Each Squeeze 8oz12oz 16oz Wt. PackedWt. Bear Each PET Jars,packof50 PackedWt. Honey Containers Each Catering CombHolder Comb Containers Hexagonal, per 10 PET5, per10 PET4, per10 PET3, per10 PET2, per10 tall,clearplasticcontainerwithscrewcap.Hexagonal clearplasticcontainerwithscrew-ongoldcap, clearplasticcontainerwith clearplasticcontainerwith clearplasticcontainerwith THORNE BEEHIVES– 01673 858555 £20.25 £4.50 £0.50 AttractiveHexagonal

£24.30 PET5 £5.40 £0.60

PET1 • £30.00 £70.00 £3.20 £3.60 £4.00 £5.00 £4.00 £3.50 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk PET2 £28.35 NEW £6.30 £0.70 0.7 0.7 0.7 0.7 0.7 0.5 3 5 3.8 0.8 0.15 PET3 PET4 large varietyofjamjars,coffeepickleetc. to themessageofrecyclingandtheselidswillfita with atwist-offneck.Beekeepersarenoexception Purple orgold. provides clarityforthecomb. sections. Clearcellophanewindow The traditionalpackagingfortimber SECTION CASES COMB CUTTER 4C CRYSTAL COMBCONTAINERS pots, andofcourse seals. Thesewillfithexagonalglassjars,mini 70mm. Allaregoldlacqueredandhaveflowedin In fivesizes–43mm,48mm,58mm,63mmand TWIST LIDS diameter. one poundhoneyjar.70mm only thescrewnecktraditional metal andwhiteplastic.Fit Available ingoldlacquered SCREW LIDS 85x65mm, approx.8oz. plunger actionaidscombrelease.Cuts ensures acleancuteverytime.Springassisted Heavy gaugestainlesssteel.Honedcuttingedge or blue. Purple, gold,green,red and boldcelldesign. Container. Modern the CrystalComb Box tofitaround See page48forSTHComblabel. 8oz comb,usingtheCombCutterbelow. the topandbottom.Hingedlid.Willhold container withbeeandcelldecorationon old boringmargarineboxshape.Clear Show. Ahugeimprovementonthe Prize winneratthe2011NationalHoney 70mm, 100 63mm, 100 58mm, 100 48mm, 100 White PlasticLids,72 Section Cases,50 Section Cases,10 Comb Cutter 4C, 50 Crystal CombContainers,840 ws is PackedWt. 43mm, 100 Twist Lids PackedWt. Price Gold LacqueredLids,72 Screw onLids PackedWt. Crystal CombContainers,50 Comb HoneyContainers 1 ⁄ 2 lb. and1lb.regularhoneyjars • [email protected] £16.50 £15.00 £14.00 £13.50 £12.50 £15.00 £15.00 £28.00 £94.50 £8.00 £4.00 £9.00 £7.50 1.4 1.1 1 0.7 0.7 1 1.1 1 0.2 0.5 1 6 1 TTESTING,ESTING, SSHOWINGHOWING aandnd MMARKETINGARKETING 57 0.25 1.1 1.1 0.06 0.06 1.1 0.06 2 2 2 2 2 0.5 0.3 £5.00 £2.50 £2.50 £4.00 £9.60 £28.45 £10.00 £12.30 £27.40 £28.80 £30.30 £30.30 £30.30 £14.40 – THORNE BEEHIVES THORNE – [email protected] • Timber Honey Sign Honeycomb Honey for Sale Sign Local Honey Sign Jar Honey Sign Classic Sign Frame Showcase, BS Shallow Frame Showcase, BS Deep Frame Showcase, BS Shallow Frame Showcase, Langstroth Shallow Frame Showcase, Dadant Shallow Frame Showcase, Commercial Section Showcase Judges/Stewards Trilby Selling Price Packed Wt. Packed Selling Price Self Adhesive Honey Sign Showing Price Packed Wt. Packed Price Showing Honey Taster Self Adhesive vinyl. 20½” x 6” 520mm x 152mm. An attractive timber sign with a 3D WBC hive in profile. White vinyl weatherproof letters on each of three lifts. 300mm wide, 350mm high. HONEYCOMB HONEY FOR SALE SIGN A great new addition to our selling range of products. This square sign has a bright vibrant image of cells and bees with the wording 'Honey For Sale'. Made from thick cardboard - not suitable for outdoor use, but ideal to put inside a window. 400mm x 400mm. LOCAL HONEY SIGN A pressure sensitive plastic sign for use on glass to face outwards. 200mm across point to point. JAR HONEY SIGN Eye catching self cling on sign, suitable for windows to face outwards. 230mm wide x 248mm high. CLASSIC SIGN A classic, engraved Honey For Sale sign. Available in White, Red or Yellow. Made from aluminium composite board. Weatherproof. 315mm x 365mm. Complete your judging or stewarding apparel judging or stewarding apparel Complete your washable and with these lightweight, S, M, and L. hygienic trilbys. SIGN SELF ADHESIVE HONEY TIMBER HONEY SIGN JUDGES/STEWARDS TRILBY JUDGES/STEWARDS 0.3 0.6 1 www.thorne.co.uk www.thorne.co.uk £30.00 £45.00 £180.00 • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Grading Glasses Testing Price Packed Wt. Packed Price Testing Refractometer Digital Refractometer Made in clear pine, suitable for showing a fully drawn frame. Slots for glazing. (Glass not supplied). In BS shallow and deep, Commercial, Langstroth and Dadant shallow. A stiff white card box with perspex panels on both sides for showing sections. Conforms to National Honey Show regulations. Using medicinal liquid paraffin smear a small amount on the prism. This should Using medicinal liquid paraffin smear a small amount is set/adjusted to calibrate to 24.5% on the water scale. Once the refractometer water content. this figure all honey samples will also show the correct An aid to calibration. You will see 3 scales. Read off the figure against the right hand scale where the light meets the dark, this is the percentage of water present in the honey. Ignore the other two scales. Ready calibrated. Simply smear a small drop of honey on the prism and look through the eyepiece towards the light. Test the water content of your honey with this accurate refractometer. A 5” long glass rod with paddle and ball end suitable for use when tasting or judging honey. Full instructions supplied. A reliable electronic refractometer. Very easy to use, lightweight and compact. SECTION SHOWCASE FRAME SHOWCASE HONEY TASTER DIGITAL REFRACTOMETER REFRACTOMETER BD HONEY GRADING GLASSES GRADING BD HONEY on the market, At last, back Bernard thanks to Mr Honey Diaper. National pair of Show approved Use to be grading glasses. entering your sure you are right class; light, honey in the medium or dark. Complete with a protective wallet. 58 PPOLLEN,OLLEN, RROYALOYAL JJELLYELLY aandnd PPROPOLISROPOLIS assembled only. with ease.National standard solidfloor The floorrevertstoa the floorby110mm. Integral steellegsraise is easytoremove. plastic drawerwhich caught inaventilated pollen dry.Pollenis trap whichkeepsthe An all-weatherpollen FLOOR POLLENTRAP from thepollentrap. very rigidandthereforelendsitselftoeasyremoval long, 35mmwideand3mmthick.Thispollenstripperis This isthestripweuseinourfloorpollentraps.510mm RIGID POLLENSTRIP pattern. pollen stripperthanthetraditionalround thick. Thestarpatternisamoreefficient Each stripmeasures340x55mmandis1mm STAR POLLENMESH 1mm thick. wide. Wecanthereforecuttoanysizerequired. This Germanmademeshissuppliedonaroll1m For thosewhowishtomaketheirownpollentrap. PLASTIC POLLENMESH National andLangstrothsizesonly. hooks andscrewssupplied. of ahiveusingthebrass drawer. Fitontothefront mesh grillintoaplastic falls throughtheseven dislodges thepollen.This mesh mountedvertically removable 5mmplastic damp conditions.A be leftonthehivein good weather,cannot Designed forusein FAIRWEATHER POLLENTRAP Floor PollenTrap Pollen Packed Wt. Rigid PollenStrip Star PollenMesh Plastic PollenMesh,squarefoot Fairweather PollenTrap Ulster BeekeepersSpringConvention,Greenmount College,Antrim,9th–10thMarch THORNE BEEHIVES– SHOWS AND EXHIBITIONS 01673 858555 PLEASE CONTACT USIFYOUWISH TOCOLLECTANYTHING FROMTHEABOVEEVENTS National HoneyShow, SandownParkRacecourse,Portsmouth Road,Esher, BBKA SpringConvention, HarperAdamsCollege,Shropshire 14th April Bee Tradex,StoneleighPark,Warwickshire, CV82LG,3rdMarch Welsh BeekeepersSpringConvention,Builth Wells,24thMarch You willfindusrepresentedatthesebeekeeping events: Surrey, KT109AJ,25th –27thOctober • £24.85 £40.00 £1.70 £7.00 £7.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.15 0.15 0.15 2 3 PROPOLIS SCREEN a 16mmbar. be clippedto holder whichcan neatly intothecup row ofcupswhichslot Make collec tion easywiththis ROYAL JELLYCUPSANDHOLDERS POLLEN PICKER potassium hydroxide. rinsing. Precautionsrequiredduringapplication.Contains water. Forstubbornareasleavefor10minutesbefore and leaveforafewminutesthenrinsewithcold way. 500mlbottlewithtriggerspray.Applytopropolis anti-bacterial andveryeconomictouse,alittlegoeslong gloves (carryoutatestfirst)andhivetools.Itis especially stainlesssteelandplastic.Greatforcleaning This productwillremovepropolisfrommostsurfaces PROPOLIS REMOVER off. propolis willdrop hands andallthe the meshinyour hours. Screwup approx. twelve freeze untilbrittle, mesh anddeep full, removethe to propolise.Once leave forthebees of yourhiveand the crown board glass meshunder Propolis iseasilygatheredbyapplyingoneofoursimplescreens.Placethefibre over thecellandpushtipintopollen. tasting samplesofpollen.Simplyplace A neatdeviceusefulfortakingand Propolis Remover Propolis Screen Royal JellyCupHolder Royal JellyCups olnRylJlyPooi Packed Wt. Pollen Picker Pollen//Propolis • [email protected] £12.00 £6.00 £3.30 £1.00 £1.00 0.8 0.06 0.06 0.06 0.06 WWAXAX EEXTRACTIONXTRACTION 59 NEW 25 27 0.1 0.1 8 10 7 1.5 25 8 12 3.5 15 17 £9.15 £10.25 £36.00 £42.00 £66.50 £351.50 £385.10 £220.00 £304.00 £381.40 £221.70 £144.20 £257.60 £291.20

– THORNE BEEHIVES THORNE – [email protected] • Large Steam Wax Extractor with steam generator Spare bag, large Spare bag, small Kochstar Wax Melter I Kochstar Wax Melter II Enamel Insert for Kochstar Stainless Steel Bucket Large Solar Metalwork only Small Solar Metalwork only Small Steam Wax Extractor without steam generator Small Steam Wax Extractor with steam generator Large Steam Wax Extractor without steam generator Wax Extraction Large Solar Wax Extractor, fitted with glass Small Solar Wax Extractor, fitted with glass Price Packed Wt. ENAMEL INSERT FOR KOCHSTAR Manufactured to ensure that the maximum amount of wax can be melted at one time in the Kochstar Wax Melter. Holds 12 kgs of wax. How to use: Pour water into the melter, approximately half full. Lower the insert with the wax carefully into the melter. Switch on and the wax will melt. STAINLESS STEEL BUCKET For the larger scale wax producer. This stainless steel pail is ideal for carrying large quantities of liquid wax safely. Holds approx. 9kgs of wax. Will not discolour wax like the galvanised equivalent. Solid stainless steel handle. 230mm high, 260mm diameter. KOCHSTAR WAX MELTER II KOCHSTAR WAX MELTER and clean This wax melter will liquefy using the up to 15kgs of wax on water off liquid wax sedimentation principle. Tap from the upper tap and drain water from the lower. Makes wax melting for the candle maker a dream. Stainless steel tank with plastic lid and handles. Two chrome plated brass ball valves with positive cut off. 1800W heater controlled by a thermostat with a range between 30°C and 100°C. 220-240V AC. 120 minute timer. 365mm diameter, 480mm high. KOCHSTAR WAX MELTER I MELTER WAX KOCHSTAR appliance is invaluable to This versatile candle makers alike. beekeepers and steel boiler with plastic Heavy duty stainless controlled 1800W lid. Thermostatically so cannot come into sealed heater wax, honey or water. contact with 30°C and Calibrated to operate between light, 120 minute 100°C with neon indicator high. Full timer. 365mm diameter, 480mm supplied. instructions for wax melting www.thorne.co.uk www.thorne.co.uk • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS The large extractor will take all sizes of comb plus frame, approximately seven BS, Langstroth or Commercial deep and diagonally it will take two 14x12, Dadant or Langstroth Jumbo. Dimensions are 305x305mm square and 670mm high. Stand is 230mm high. Linen scrim bag included. Integral lifting handles. The small version will hold approximately 5 BS brood combs (not including wooden frame). Dimensions 230x230mm square, 460mm high. Stand is 230mm high and made from powder coated mild steel. Linen scrim bag included. Integral lifting handles. Made in our own metalwork shops at Rand, these machines are efficient and Made in our own metalwork shops at Rand, these generator. They consist rapid wax extractors using external steam from a steam body, robust inner of six elements, steam generator, stand, snug fit base, easy to use and, once perforated stainless steel cage and lid. They are very in seconds. The steam has been generated, they will melt comb/cappings/wax front spout. The condensate liquid wax runs into the integral tray and out of the is collected under the tray and runs out of the central base spout. Great for all sorts of wax rendering from full cappings to old combs. NB: ensure water levels are maintained. Same principle as above but produced in composite timber with galvanised trays. 405mm wide, 760mm long, 405mm high. Supplied complete with sealed double glazed unit in safety glass. Tray sizes: 320x520x130mm deep and 300x110x70mm deep. LARGE AND SMALL STEAM WAX EXTRACTORS SMALL SOLAR WAX EXTRACTOR LARGE SOLAR WAX EXTRACTOR SOLAR LARGE steel scraps of wax into the stainless cappings and any odd Place old combs, the wax. This the double glazed lid melts heat from the sun through tray and the Strong timber a separate receiving tray. the removable strainer into runs through with sealed x 230mm. Supplied complete insulated base 810 x 685 construction, Tray may be purchased separately. unit in safety glass. Trays double glazed deep; receiving 600x160x80mm 660mm square, 130mm sizes: main approx. deep. 60 WWAXAX EEXTRACTIONXTRACTION aandnd PPOLISHOLISH method isapprox.105°C. the framesandbroodbox.Temperaturereachedinboxusingthis from theoldcomb(approx.90%byourcalculations)butithasalsosterilised all thatremainsisthepropolis.TheEasi-steamhasnotonlyextractedwax be onthemeshbaseandcandiscarded.Theframesaretotallyfreeofwax, bars andofcoursethewirefromfoundation.Themajoritycocoonwill empty framesapartfromsomecocoonthathaslodgedontheframebottom generator andcarefullyremovesteelcover.Inthehiveyouwillfindcompletely wax willfloatontopofthewaterproducedbycondensedsteam.Switchoff wax andwaterwillrunoutofthefronthive.Leavetosettlecool.The generator andwait.Afterabout20minutes ice creamcontainer,switchonthesteam next totheoutlet,e.g.oldbucketfeederor top ofthefloor.Placeasuitablereceptacle supplied) andthewoodenekeplacedon and gridareplacedonasolidfloor(not a broodbox(notsupplied).Thesteeltray (3m inlength).Thiscoverfitssnuglyover attached toasteelcoverviasteamhose capacity, 1800W,cablelengthis3m) An electricsteamgenerator(4litre in theopen. especially asthe‘messy’bitcanbeoutside This steamextractorisdefinitelyawinner, EASI-STEAM that isonlyfoundcommerciallyinN.E.Brazil. waxes. Itisobtainedfromtheleavesofapalmtree has thehighestmeltingpointofallnatural a qualityhardenedpolish.Carnaubaiswaxwhich Add approx.10%byvolumetoyourmixproduce CARNAUBA WAX Ideally suitedforusewithbeeswaxtomakepolish. Pure GumTurpentineina500mlplasticbottle. PURE TURPENTINE See YouTubevideo:http://bit.ly/2vaTk6C THORNE'S SALEDAYS THORNE BEEHIVES– 01673 858555 and Saturday,11thAugust,9.30amto11.30am Saturday, 15thSeptember,10.00am to1.00pm Saturday, 8thSeptember,10.00am to1.00pm Friday, 10thAugust,3.00pmto5.00pm RAND OPEN ANDSALEDAY Saturday, 13th October, from10.00am STOCKBRIDGE SALEDAY NEWBURGH SALEDAYS WINDSOR SALEDAY • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk POLISH CONTAINERS display. Eachcontainerholdsapprox.70gofpolish. cream, yellow,brownandblack.Mixmatchtopsbasesforacolourful without anydistortion.Availableingold,silver,red,green,blue,white,beige, wearing, virtuallyunbreakable,willtoleratehotwaxandpureturpentine An excitingadditiontoourrange.Thesemulticolouredcontainersarehard Polish Containers,10 Polish Containers,each Carnauba Wax,500g Carnauba Wax,250g Pure Turpentine Steam Generatoronly Dadant, Smith Easi-steam, Langstroth,Commercial, Polish Containers,100 a etn oih rc Packed Wt. Price Easi-steam, National Wax Melting/Polish • [email protected] NEW £110.00 £38.00 £94.30 £22.00 £0.26 £9.00 £6.00 £9.00 £2.40 0.06 0.6 0.3 0.8 2.5 7 7 2 0.3 WWAXAX / SSOAPOAP MMOULDSOULDS 61 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 £5.75 £6.50 £6.50 £6.50 £6.50 £6.50 £6.50 £6.50 £6.50 £5.75 £5.75 £5.75 £5.75 Leaf 115g 60 x 80mm 3 cavities Chunky Bee 45 x 45mm 6 cavities NEW Golf 80g 70mm dia. 3 cavities WBC Hive 170g 150 x 120mm Single cavity 1kg Wax Mould Large 1.8kg 260 x 210 x 40mm deep Single cavity Flower 30g 60mm dia. N.B. Medium skep, flower and hexagon form one mould, 1 cavity of each design – THORNE BEEHIVES THORNE – [email protected] • Filigree 90g 75mm dia. 3 cavities Lovers 120g 65 x 90mm 3 cavities Small Queen Bee 28g Point to point 70mm 3 cavities Cricket 60g 65mm dia. 3 cavities Hexagon 40g 55mm across N.B. Medium skep, flower and hexagon form one mould, 1 cavity of each design Bee on Flower 80g 3 cavities Large Skep Lovers Leaf Clover Roses Sun Fairy Filigree Chunky Bee Skep with Bees Small Skep Cells Wax/Soap Moulds WBC Hive Price Wt. Packed Fairy 60g 60 x 70mm 3 cavities Large Skep 90g 65 x 85mm 3 cavities Bienenwachs 28g 78 x 25mm 5 cavities Comb 100g 65 x 90mm 3 cavities Bee on Comb 70g 3 cavities Geisha 60g 60mm across 3 cavities 0.15 0.2 0.2 0.25 0.15 0.15 0.25 0.15 0.15 0.15 0.15 0.15 Sun 120g 80mm dia. 3 cavities Cells 20g 35 x 50mm 6 cavities £4.20 £5.75 £5.75 £8.90 £4.20 £4.20 £8.90 £4.20 £4.20 £4.20 £4.20 £4.20 www.thorne.co.uk www.thorne.co.uk • The Boss 100g 50 x 75mm 3 cavities Hexagonal 28g Point to point 53mm Two designs, 3 cavities of each design Valentine 70g 65 x 80mm 3 cavities Cire d' Abeilles 28g 78 x 25mm 5 cavities 115g 80mm dia. 3 cavities Roses 15g 40 x 45mm 6 cavities Small Skep

01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

Hexagonal Bee on Comb or Bee on Flower Rectangular or Cire d'Abeilles or Beinenwachs Small Queen Bee Large Queen Bee Maiden or Valentine Geisha Hexagon/Flower/Medium Skep The Boss or Comb Cricket or Golf Bears 1kg Wax Mould Wax/Soap Moulds Price Packed Wt. 28g 78 x 25mm 5 cavities Clover 115g 60 x 80mm 3 cavities 230g 150 x 150mm Skep with Bees Bears 200g 70 x 70mm 3 cavities Medium Skep 40g 65 x 55mm N.B. Medium skep, flower and hexagon form one mould, 1 cavity of each design Maiden 80g 60 x 90mm 3 cavities Rectangular

Wax must be poured at approx. 70°C. Wax must be WAX / SOAP MOULDS WAX of easy wax or chocolate. The secret Use them for soap, in our workshop at Rand. of rigid plastic moulds made A wide range silicone liquid or spraying with the mould with washing-up when it is cool. Wiping pour the wax into the mould release is to approximate. and sizes below are in release. Resulting weights will also assist 62 HHIVESIVETTHESH aandEn QQUEENd UBBEESEEEENS the magneticdiscattachestonib.Sparenumbersavailable. Simply placethetipof'catcher'penoverqueenand therefore magnetic.Thekitiscompletewithaphialofglue. Each kithas20numbereddiscsmadeofsteelandare capturing andretainingaqueen. New fromGermany,thisnoveltoolwillassistgreatlyin egg, grubsorlarvaefromcells. angled tips.Suitableforremoving Stainless steeltweezerswithfine, for insecttagging.Glueavailableseparately. extensively onuniversityandlaboratoryfieldtrips marked 1–99.Withapplicatorandglue.Used Five cardseachwithdifferentcoloureddiscs colours. mixes paintpriortouse.Inallfiveinternational Very easytoapply.Willnotdryout.Builtinagitator Water based,nontoxic,fadeandquickdrying. the fiveinternationalcolours.Markasfollows:- A quickdryingnon-toxicwaterbasedpaintin plunger pushingqueenuptomarkingmesh. close flexibleshutter.Useforefingerofsamehandtodepress Ingenious device.Placeopenendofchamberoverqueenand into thebestpositionformarking. marking. Theplungercanthenbetwisted,turningthequeen technique tomovethequeendowntubeenable A niftynewdeviceformarkingyourqueen.Usestheplunger rests againsttheplasticmesh. queen gentlyupthetubeonfoamuntilherthorax in diameterholdsasoftfoamcoveredplunger.Pushthe examination. Aclearplastictube75mmlongand40mm A gentlewayofholdingthequeenformarkingand in thehive.Coverslides easilyinasinglehandedoperation. 85x40x20mmdeep. the queenother willallowveryCloseContactbetween queenandworkers over candycompartments,onecompartment willrelease attendant workers.Plasticbreakoutcover compartments andlargeareafor ventilated coverwithtwocandy introduction cage.Clearplastic A largerthannormalqueenshipping/ cages. the queenandattendantsintopostal the queenandalsoforintroducing For anundisturbedexaminationof Mark carefullythroughthethreadedtop. marking. Placeoverthequeenwhilstsheisoncomb. provide a90%openareaforclearqueenobservationand needles. StrongThreadissecuredaroundtheneedlesto A hardresinring50mmdiameterholdinghardenedsteel PRESS-IN CAGE IC QUEENCAGE PLASTIC QUEENCATCHER MAGNETIC QUEENMARKINGKITANDCATCHER TWEEZERS MARKING KIT MARKING PEN MARKING PAINT ONE HANDEDQUEENCATCHER TURN ANDMARKCAGE MARKING CAGEWITHPLUNGER r0 Blue 5or0 Green 4or9 Red 3or8 Yellow 2or7 White 1or6 Year ending THORNE BEEHIVES– 01673 858555 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk introduction. 55x40x20mm. candy togateentranceandusefor queen duringmanipulationsoradd adjustable entrance.Useittoretain Accurately madebamboocagewith For transportingandintroducingqueens. between twoframes.100x20x12mm. Place cagepaperenddownjammedtightly end andholdinplacewithanelasticband. method. Simplywrapnewspaperoveropen The simplestandmostpopularintroduction excluder sizeslots. bees arealsogatheredtheycanescapethroughthequeen Place overthecombandpickupqueen.Ifworker Press betweenthumbandforefingertoopenthecage. have everknown,sheisimmediatelyaccepted. beneath thecageandbecausesheisonlyqueenthesenewlyhatchedbees their waythroughthefondanttowardsqueen.Sealedbroodemergesfrom the colonyachancetogetusedherpheromones.Meanwhile,workerseat laying queenistrappedbetweensealedbroodandtheQuintrexcage.Thisgives first untiltheyare‘worked’.Thenew, Please notethegateswillbestiffat is forplacingfondantinthefeedtunnel. for introducingthequeenandother holes coveredwithswivelgates:oneis using ondifferenthives.Therearetwo and canbesterilisedinboilingwaterif cage ontothecomb.Itisverystrong edges whicharenecessarytosecurethe over sealedbrood.Thecagehassharp cage isdesignedtointroduceaqueen cage. Madefromexpandedmetal,this We arepleasedtoofferthisniftyqueen it willbecomecomfortabletouse. the componentsrapidlyagainsteachotherand to use.Whennewitmaybestiff,simplymove The ergonomicshapemakesitparticularlyeasy marking, trappingandgatheringsamplebees. A multi-usecageforposting,introduction, QUEEN INTRODUCTIONCAGE BUTLER CAGE CLIP QUEENCATCHER QUINTREX CAGE QUEEN GUARDCAGE BAMBOO QUEENCAGE h ue Pie PackedWt. Price Press inCage The Queen h ue Pie PackedWt. Price Butler Cage The QueenCatcher IC QueenCage Plastic QueenCatcher Spare numbers and Catcher Magnetic QueenMarkingKit Tweezers Marking KitSpareGlue Marking Kit Marking Pen,each Marking Paint,each One HandedQueenCatcher Turn andMark Marking CagewithPlunger Quintrex Cage Queen GuardCage Bamboo QueenCage Queen IntroductionCage • [email protected] £25.00 £72.00 £27.00 £3.00 £1.00 £3.00 £1.00 £3.00 £5.00 £1.20 £7.50 £3.00 £3.00 £6.00 £6.00 £1.00 £0.50 £0.60 £2.00 0.1 0.06 0.15 0.4 0.4 0.06 0.06 0.06 0.06 0.06 0.1 0.15 0.15 0.1 0.4 0.06 0.06 0.06 0.06 NEW HHIVESTTHEHIVEE QQUEENS UaandEnEdN BBEESEES 6363 0.2 0.2 0.2 12 12.7 15 14 15 0.1 1 1.2 1.8 1.5 0.06 NEW £9.00 £9.00 £9.00 £2.60 £19.00 £37.70 £42.50 £70.90 £63.75 £102.50 £122.20 £160.40 £128.10 £128.10 – THORNE BEEHIVES BEEHIVES THORNE THORNE – –

£134.55 £156.30 £201.30 £163.00 £163.00 [email protected] • Langstroth Nursery Frame Langstroth Nursery Frame Dadant Nursery Frame Commercial Nursery Frame Individual Nursery Cage Push-in Cell Protector, 100 Top Bar Cell Protector, 100 Langstroth Dadant Commercial 14" x 12" Health Price Packed Wt. Packed Health Price JZ-BZ Base Mount Cell Cup, 100, Green, orange, blue, red or grey Health Price Packed Wt. Nucleus Hives National Packed Assembled Flat Wt. Packed Health Price MJT Punch Nursery Frame BS Nursery Frame Price Packed Wt. JZ-BZ TOP BAR CELL PROTECTOR MJT PUNCH A novel little stainless steel tool to help with simple and small scale Queen rearing. Simply warm cutter, insert into cell, turn and push to remove the cell. Comes with full instructions. JZ-BZ BASE MOUNT CELL CUP Supplied in the five queen marking colours. These cell cups are easy to install in grooved top bars by pushing and twisting for a friction fit. JZ-BZ PUSH-IN CELL PROTECTOR For securing and protecting queen cells on to drawn comb. Lugs on both sides means you can protect the queen cell and hang it vertically between frames. Made in all sizes. Made in all sizes. holds The National 16 cages, Langstroth and 20; Dadant 30 Each Commercial 27. in cage is covered a wire mesh with wooden cell cup in the top and exit “door” in the base. NUCLEUS HIVES The regular pattern is supplied in B.S., Langstroth, Dadant, Commercial and 14” x 12” sizes. They will all accommodate five frames and have extra deep roofs suitable for a small contact feeder. Made in Western Red Open mesh floor Cedar, each hive comprises: with entrance block, brood body, crownboard with feed hole and roof. All hive floors are now Open Mesh. See YouTube video to assemble a: Nucleus Roof: http://bit.ly/2nsGe1N • Nucleus Brood Body: http://bit.ly/2FsVx1T • NURSERY FRAME AND CAGE FRAME NURSERY 0.06 0.06 0.06 0.06 0.06 0.06 3.5 0.2 0.1 £0.40 £2.00 £3.50 £9.00 £3.60 £3.00 www.thorne.co.uk www.thorne.co.uk £10.00 £38.30 £19.00 • 01673 858555 Cell Protector Tempqueen, pack of 5 Stainless Steel Grafting Tool Chinese Grafting Tool Cloake Board Wax Cell Cup Mould Wooden Cell Cups Mandril SERVINGSERVINGYEARS YEARS 100 100 OVER OVER FOR FOR WORLDWIDE WORLDWIDE BEEKEEPERS BEEKEEPERS Economy S/Steel Grafting Tool The Queen Price Packed Wt. TEMPQUEEN Store in a freezer. Complete instructions provided. Improve queen rearing success, hold queenless splits and nuclei or use as a temporary queen replacement. Prevents the bees from tearing down a “ripe” queen cell. Place over cell and fix to comb with wire spike. The tin slide is used to contain the cell, once removed. CELL PROTECTOR MANDRIL A shaped piece of hardwood which is used for forming a wax cup in the base of the wooden cell cups. WOODEN CELL CUPS The traditional queen rearing cups. For use with a nursery frame and cages. Flat tops for smearing with wax and fixing to underside of bar in rearing hive. WAX CELL CUP MOULD Simple and efficient method of producing wax cell cups. Readily accepted by the bees. Pour molten wax at approx. 80°C into the mould, scrape off excess of the and allow to cool. When set, the cups will drop out cavities. CLOAKE BOARD The Cloake Board is used to split The Cloake Board is used for and populate a colony ready queen rearing. Invented by New Zealand beekeeper Harry Cloake and now used extensively all over the world. Delicately manufactured in the far east with spring eggs off the flexible spatula tip. 100 mm long. loaded plunger for sliding Chinese Grafting Tool This double ended, shaped tool, This double ended, shaped in stainless steel has accurately knurled machined tips with a double the tool centre section to prevent slipping. Stainless Steel Grafting Stainless Tool An inexpensive single ended An inexpensive tool 160mm long, stainless steel for a sure grip. hexagonal shaft GRAFTING TOOLS GRAFTING Grafting Tool Economy 64 TTHEHE QQUEENUEEN NB CUPKIT cell carriers.Fullinstructionssupplied. cup holders,1celltransfertool,40ribbed and plugs,115browncellcups, contains 1combbox,10hairrollercages Similar totheCupkitmethod.Eachkit JENTER SYSTEM NB: notcompatiblewithJenterKit. of instructions. carriers, 1alloycellholderbar,Set 60 cellcupholders,ribbed 10 hairrollercages,60cellcups, Each kitcomprises:Combbox, style queenrearingkit. A comparativelyinexpensiveJenter TJ CUPKIT instructions. cell barblocks,10cupcapsandfull hair rollercages,100browncellcups,10 Each kitcontains:1plasticcombbox,10 Similar totheNBCupkit. NICOT CUPKITSYSTEM 10 cellbarblocks,cupcapsandfullinstructions. Each kitcontains:1plasticcombbox,10hairrollercages,32purplecellcups, introduction. emerging virginsarecontained.Thesecagescanthenbeusedfortravellingand When thequeencellsaresealed,hairrollercagescanbeslippedover,sothat off withacellcupcapwhichpassesontobarfittedblocks. of thecups,eachinapin-prickroyaljelly.Veryeasily,cellcupislifted On the4thdays,verysmall,newlyhatchedlarvaecanbeseenthroughback the nextday. cups. Shecanbereleasedmanually continues tolayeggsintheartificial excluder. Assheisinfulllay, front ofthecageunderaqueen comb, andthequeenisputin has previouslybeenfixedinabrood the backofcombboxwhich 32 purplecellcupsareplacedin grafting withoutthedifficulties. process, achievingthebenefitsof encompasses everyaspectofthe This cleverandverysuccessfulsystem etrSse Pie PackedWt. Price Complete Jenter System PackedWt. Price TJ Complete TJ CupkitSystem PackedWt. Price Complete Nicot CupkitSystem PackedWt. Price Complete NB CupkitSystem JN PlainCellCarriers, 40 JN RibbedCellCarriers,40 JN BrownCellCupHolders,115 JN BrownCellCups,115 JN HairRollerCagesandPlugs, 10 TJ RibbedCellCarriers,60 TJ CellCupHolders,60 TJ BrownCellCups,60 TJ HairRollerCages,10 Nicot CellBarBlocksandCaps,10 Nicot BrownCellCups,100 Nicot HairRollerCage,10 NB CellBarBlocksandCaps,10 NB PurpleCellCups,100 NB HairRollerCage,10 THORNE BEEHIVES– 01673 858555 • £40.00 £60.00 £25.00 £10.00 £10.00 £10.50 £78.00 £7.00 £7.00 £8.00 £4.00 £4.00 £2.00 £7.50 £5.50 £4.00 £5.00 £2.50 £3.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.06 0.06 0.06 0.06 0.1 0.6 0.06 0.06 0.06 0.1 0.5 0.1 0.06 0.1 0.5 0.1 0.06 0.1 0.5 ● ● ● ● ● ● Requires 3AAAbatteries. up well. comb andtheyreallydoshow in cells.Justwaveitoverthe confirming newlylaideggs This torchisveryusefulfor A verybrightLEDtorch. entrance. from underneath.Adjustabledisc means avirgincanbeintroduced strip. Removablefloorventilator two framesandembossedstarter 170x125x120mm. Suppliedwith you wishtohaveabankofnucs. are required,theystackableif nuc. Onlyasmallnumberofbees A small,compact,queenmating MICRO MATINGHIVE encourage combbuilding. disc entrance.Catenaryshapedinsideto adjustable underfloorentranceaswell and removablefeedcompartment, 4 groovedwoodentopbars,separate 275x218x175mm high.Contains WARNHOLZ MATINGHIVE Internal sizeis155x100120mmdeep. cover isparticularlygood. so appealingtomice!Theadjustablebase and insulatedhardplastic,thatisnot being madefromrigid,doublewalled They areincrediblystrongaswell, hardboard cover. three framesand Complete with fraction ofthecost. Apidea hiveata dimensions tothe identical internal mating boxeshave These colourfulqueen RAINBOW MATINGHIVE ● This isthetechnique: that, buteachmini-nuccanlookafteranumberofqueensinsuccession. have givenusthemini-nuc,whichusesonlyacupfulofbeesattime.Not only one queen.Modernplastics,andadifferentapproachtocreatingminicolony, queen, effectivelytakingalotofbeesouthoneyproduction,justtosupport tradition ally beendonebymakingupanucleus, with fullsizeframes,foreach Once queencellshavebeenraised,thevirginstobemated.Thishas Rainbow. Followtheinstructionsbelowfortrouble-freequeenrearing. We offerseveraltypesofpolystyrenematinghive,Warnholz,Microand MATING HIVES ICE TORCH ICE Torch Micro MatingHive Warnholz MatingHive Spare Frameforabove h ue Pie PackedWt. Price Rainbow MatingHive The Queen Checkintwoweeks forsignsoflaying. Releasethebeesatchosensite. Leaveinacooldarkplacefortwoorthreedays. Leaveforaboutanhour,untilthebeesroarinpanic,thenrunavirginqueen Droponelargecupfulofsticky,wetbeesintothemini-nuc,andcloseup, Shakeyoungbeesintoaboxandspraythemwithsugarsyrup. Assemblethemini-nucwithastrip offoundationonly,nocomb,ineach in. making surethatventilationisclear. frame. Fillthefeedercompartmentwithcandy. • [email protected] £15.00 £18.00 £4.00 £0.36 £9.00 0.2 0.75 1 0.1 1 TTHEHE QQUEENUEEN 65 3.0 0.5 3.0 0.35 18 2.8 4.5 1.3 1.3 3.5 £8.00 £25.00 £13.00 £47.50 £36.20 £60.50 £18.85 £24.90 £29.75 £219.60 – THORNE BEEHIVES THORNE – [email protected] • QRN Feeder BiVo Box BiVo Frame Floor, assembled Brood Body, empty, assembled Crownboard, pair Travelling Screen, pair Feeder The Queen QRN – Queen Rearing Nuc Price Wt. Packed National Twinstock Hive Complete, assembled (no frames) Price Packed Wt. BiVo BOX The National Twinstock is The National 12 full designed to hold self-spacing size B.S. brood (if you Hoffman frames on plastic space your frames it will only or metal ends 10 frames). accommodate The floor is a standard type with two diagonally opposite is corner entrances. The brood completely divided by a rigid, board, removable plastic division close twin nucleus crownboards top of off each half of the box. On access, rapid feeder; once empty if one of the clear this you can place a double one of the nucs can access the whole feeder for covers is removed bees from whole hive is protected with a standard 4” National any remnants of syrup. The are also available. Roof. Half size travelling screens floor, split brood box with plastic division board, The complete hive comprises two half size travelling screens, full size double two half size crownboards, All parts are available separately. Assembled only. access rapid feeder, 4” roof. Frames not included. QRN – QUEEN REARING NUC NATIONAL TWINSTOCK NATIONAL A double polystyrene mating nuc with a difference. This hive is ingenious as it takes both BS and Langstroth frames by simply using a conventional brood frame and folding it into three. Once the queen has mated and the frame is no longer required it can be removed, opened up and introduced into a conventional full size brood box. By moving internal divisions it is possible to use the BiVo Box with both BS and Langstroth frames at the same time. It is complete with mini disc entrances on opposite sides, floor ventilation and a feed compartment for both nucs. 310mm square. A popular, European, Queen Rearing Nuc. Solid polystyrene construction with separate floor with mesh cover and inbuilt feeder. 300x300 mm square, 275mm high. Complete with 6 plastic Hoffmann half frames. Clear plastic inner cover included. Suitable for overwintering queens. 6.0 5.0 2.2 3.9 2.0 4.0 5.0 5.0 5.0 www.thorne.co.uk www.thorne.co.uk £59.50 £52.20 £20.00 £30.00 £13.50 £46.50 £52.00 £57.20 £56.40 • 01673 858555 eke. blocks. feeder(capacity 2.2litre) and float. 40mm eke. SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING Polynuc The Queen Price Packed Wt. Everynuc 6 - Smith Everynuc Feeder Polynuc Feeder Everynuc 1 - Langstroth Everynuc 2 - BS Everynuc 3 - Commercial Everynuc - Dadant & Langstroth Jumbo Everynuc - 14x12 EVERYNUC FEEDER This feeder fits snugly over the Everynuc and hold 3 litres of syrup. Expanded mesh keeps the bees away from the risk of drowning. 6. and rebate Smith 5 frame nuc with wooden feeder(capacity 2.2litres), float NB to preserve the Everynuc we recommend painting with our Beehive Paint. 5. nuc with wooden feeder(capacity 2.2litres), float and 60mm 14x12 5 frame 3. 5 frame nuc with wooden feeder(capacity 1.2 litres), float and Commercial 4. Langstroth Jumbo 5 frame nuc and 60mm eke. Dadant and 2. nuc with wooden BS 5 frame 1. 5 frame nuc. Langstroth The beauty of this polynuc however is its versatility in the following formats. It has a separate, mesh, sloping floor with removable inspection tray and 175mm wide entrance, top bee space brood body with stainless steel runners and roof. Walls are 40mm thick. Made in Germany by one of the oldest established firms in Europe we can showcase this all hive sizes Polynuc. EVERYNUC POLYNUC FEEDER A large capacity feeder (approximately 8 litres) A large capacity feeder (approximately A securely fitted that fits snugly over the polynuc. the bees from perspex viewing panel prevents drowning in the syrup. NB to preserve the Polynuc we NB to preserve the Polynuc our Beehive recommend painting with Paint. POLYNUC by experts in polystyrene Made in Germany is for many years. This nuc nucs and hives with an integral mesh floor. top bee space or 5 if a frame It hold 6 BS frames It can be easily feeder is utilised. Smith frames. adapted to take adjustable entrance. 155mm wide Walls Smooth plastic frame runner. are 22mm thick. 66 HHEALTHEALTH aandnd MMAINTENANCEAINTENANCE with concrete. Put2or3ofourabsorbentfumepadssaturated Place aclosedhiveflooronearth/ grass/ wooden board–not every 4weeks.Alsopreventspollengoingmouldy. high (1stripisenoughfor3supers).Repeattreatment and light,closingthetopwitharoof.Stacksupers6 on thetopwithasulphurburnerinside.Insert2strips supers readyfortreatmentplaceanemptybroodbody How touse:Onceyouhaveyoursealedstackof FUMES. Packof500g,approx.20strips. centrally intheburner.NB.DONOTINHALEGAS A hookinthelidisusedtosuspendsulphurstrip through thepileofsupersandframesbeingtreated. sulphur dioxide,thisheavierthanairgasthensinks and honey.Whenignitedthestripsgiveoffnoxious fat solubleandposesverylittlerisktobees,wax of controllingwaxmoth.Itishighlyvolatile,not Sulpher dioxideisoneofthemosteffectivemethods 120ml plasticbottle,enoughfor120frames. moths. Itwillnotharmyou,yourbeesorwaxhoney.In The onlybiologicallarvaecideavailableforthecontrolofwax CERTAN –B401 odours. Totallybio-degradable.Bagof1kg. gloves, andevenyourbeesuit,cleanfreefrom low costmethodofkeepingyoursmoker,hivetools, conceivable environment;thisisaneffectiveand Soda crystalsareanestablishedcleanerinevery SODA CRYSTALS returning yourhivetoitsnaturalcolour. Use forcleaningweatheredcedarassistingin OXALIC ACIDDI-HYDRATECRYSTALS ACETIC ACID SULPHUR BURNERANDSTRIPS mask. Collectiononly. quickly. Alwayswearoveralls,rubberglovesandasuitable Note: Acetic acidishighlycorrosive.Itwillremoveskinvery necessary torepeattheprocessevery2or3weeks. nosema andallstagesofwaxmoth.Itwillhoweverbe Acetic acidusedinthiswayisveryeffectivetreating one week. Seal thetopwitharoof.Fumigationshouldtakeapprox. Repeat thisforasmanyboxesneedtobefumigated. bars oftheboxbeforeplacingafurtherbroodontop. full offramesontop.Putanothersoakedpadontothetop Certan, 120ml Health Price Packed Wt. Soda Crystals,1kg Oxalic Acid,Di-hydratecrystals 500g Oxalic Acid,Di-hydratecrystals 100g Acetic Acid1litre Sulphur Strips Sulphur Burner 1 ⁄ 4 THORNE BEEHIVES– 01673 858555 pintofaceticacidontothefloor.Placeabroodbox • £18.00 £16.00 £1.50 £8.00 £2.50 £7.00 £9.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 1.2 0.75 0.2 0.5 0.6 0.25 cut tosize.Meshapertureis3mmx4mm. wishing tomaketheirownfloorsorscreens.Canbe Acid resistant,strongandrigidmeshforthose to size.Meshapertureis3mmx4mm. make theirownmeshfloorsorscreens.Canbecut Very strongandrigidmeshforthosewishingto The designisslightlydifferentfortheWBChive. entrance. Availableinallsizes. collection area.Abovethescreenisnew void belowthescreennowbecomessample solid floorandplacescreenontop.The leading edge.Simplyreverseyourexisting Stainless Steelwovenmeshwithalloy VARROA SCREEN result andhasbeenvalidatedwith98%+accuracy.Forsingleuseonly. Diagnostic Kittakesjust3minutestogivea in thesameapiaryandthosenearby.The spreads quicklytootherhealthycoloniesboth through thecolonyand,ifleftunchecked, brood diseases.AFBdisseminatesrapidly destructive andwidespreadofthehoneybee Paenibacillus larvaevarlarvae.Itisthemost disease causedbythespore-formingbacterium (AFB)isaninfectiousbrood AFB TESTKIT to givearesultandhasbeenvalidatedwith98%+accuracy.Forsingleuseonly. flow. TheDiagnosticKittakesjust3minutes frequently disappearingoncethereisanectar makes EFBdifficulttoidentifywithcertainty; of pollen.Symptomscanbevariablewhich to becausedbystressinthecolonyandlack summer duringbroodrearingandisthought occurs mostfrequentlyinthespringorearly being thebacteriumMelissococcuspluton.It disease causedbyseveralagentsthemain European Foulbrood(EFB)isabacterialbrood EFB TESTKIT Full instructionssupplied. vermiculite. Form: 3.70g menthol. thymol, 16gEucalyptusasanessential oil,3.70gCamphor, Composition: which isatotallydifferentproduct. Varroa treatmentfromItaly.NottobeconfusedwithApivar, A VMD(VeterinaryMedicinesDirectorate)approvedallnatural APILIFE VAR EXPANDED STAINLESSSTEELMESH EXPANDED GALVANISEDMESH Varroa Screen AFB TestKit Apilife Var Health Price Packed Cut tospecialsize,Sq.Ft. 18" Square 12" Square Health Galvanised Mesh Wt. Steel Expanded Stainless EFB TestKit Health Price Packed Mesh Weight Packed Wt. An 11gevaporatingbiscuitwithproduct suspendedin 100g ofproductcontains:76.60gpure • [email protected] £5.50 £5.50 £2.50

£17.50 £3.00 £9.00 £9.00 £20.00 £20.00 £9.50 0.06 1.8 0.06 0.06 0.25 0.5 0.25 HHEALTHEALTH aandnd MMAINTENANCEAINTENANCE 67 0.8 0.9 1.5 0.2 0.75 0.75 0.5 £7.30 £27.80 £11.40 £10.00 £25.00 £16.80 £19.99 – THORNE BEEHIVES THORNE – samples of 200 or 300 bees samples of 200 or 300 [email protected] easy counting of mites directly in the device easy counting of mites and easily transportable

• that allow detached mites to that allow detached mites allows

is an essential new labour-saving is an essential 60secs of shaking for convenient and comfortable use for convenient and comfortable Quick to use: in the bottom AND Reliable: Numerous holes sides of the basket fall more easily A tight lid Robust, solid material Transparent bowl • • • • • Two molded guide lines allow • Apiguard Rim, flat Apiguard Rim, assembled Thymol Crystals, 500g Thymol Frame Health Price Packed Wt. Packed Health Price Apiguard, box Thymol Price Packed Wt. Packed Price Thymol Thymol Crystals, 100g Health Price Packed Wt. Packed Price Health Varroa Easy Check See YouTube video: http://bit.ly/2GvJbaT THYMOL FRAME APIGUARD Apiguard is a varroa treatment based on natural ingredients that are efficient, safe and beneficial for honeybee colonies. It is the best weapon to fight resistant mite strains. Box of 10 trays, sufficient for 5 treatments. APIGUARD RIM Varroa EasyCheck Varroa mite who want to monitor tool for beekeepers easier and colonies quicker, infestations in than ever before. more reliably makes varroa monitoring The Varroa EasyCheck by all that can be performed a simple practice to unique design is the key beekeepers. The EasyCheck's reliability: the 200 or 300 bees and shake them for 60 seconds in Beekeepers simply collect solution of alcohol or winter windshield washer fluid. EasyCheck shaker with a and fall to the bottom of the transparent bowl Mites separate from the bees reused. where they can be easily counted. The liquid may be THYMOL CRYSTALS VARROA EASY CHECK EASY VARROA Made in cedar, this simple 40mm deep frame acts as a small eke above the brood body for holding trays of Apiguard, packs of fondant or Nektapoll pollen patties. Apiguard not included. Available in 100g and 500g sizes. Used extensively as a fungicide in syrup feeds. Developed in Germany, use this frame to administer thymol crystals safely. Use 12g per treatment. Full instructions supplied. 1 0.5 1.5 2 2 2.0 2.0 2.1 £7.20 £7.49 www.thorne.co.uk www.thorne.co.uk £12.50 £51.00 £58.50 £63.55 £19.00 £11.50 • 01673 858555 trapped again. to them. varroa mites trapped with the only brood available SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Sugar Dusting Grid Health Price Packed Wt. Packed Health Price DN1 Brood Frame Traps Price Wt. Packed Bailey Board Bailey Board Price Packed Wt. 500ml Trigger Spray Health Price Packed Wt. Packed Price Health Sugar Dusting Measure and Brush DN4, Commercial or Langstroth Dadant or 14" x 12" 1 litre Concentrate Use to measure out 100g of icing sugar for use with above grid. The advantages of this system are obvious. It is pretty quick, it can be done at any time of year, there is no withdrawal period and it is perfectly safe for you and your bees. Simply insert a collection tray/board on to, or under, your floor (whether solid or open mesh. Remove hive parts to the brood body. Smoke bees and add the dusting grid. Scoop up 100g approx. of dry icing sugar scatter over mesh and brush all over with our adapted bee brush. Remove grid and gently dust sugar on the top bars into the seams of bees. Within minutes mites will be dropping onto the floor of your hive for disposal. If you operate a double brood, use twice as much sugar. The sugar will drop very quickly through two brood boxes. Visit www.scientificbeekeeping.com for full details of likely results and technique. A simple 460mm square of nylon mesh trapped in a softwood frame. SUGAR DUSTING MEASURE AND BRUSH SUGAR DUSTING GRID Frame not included. Made in all standard sizes. 3. full of After 18 days, both frames will be full of sealed brood and, hopefully, 4. Remove both frames and destroy. 1. Confine the queen on an empty comb and place in the trap. 2. the queen After 7 days, remove the frame and substitute another frame with BROOD FRAME TRAP varroa control. New and improved brood frame trap for bio-technical BAILEY BOARD which makes A simple easy to use board technique all the Bailey Frame Change size only. the more simple. National BEE CARE AND HIVE WASH AND BEE CARE Based on a NHS approved formulation but approved formulation Based on a NHS bee for the complete specifically designed including hives, frames, tools, environment The the honey production area. clothing and sanitiser is a tried and tested concentrated virucidal and fungicidal product. bactericidal, to to use. Do not allow No residue. Simple come in contact with bees. 68 HHEALTHEALTH aandnd MMAINTENANCEAINTENANCE APIVAR beekeeper 2fillsthesyringes. beekeeper 1treatsthehive, beekeepers workinpairs, seam ofbees.Quiteoften will beenoughtotrickleone Sold inpairs.Eachfullsyringe 5ml SYRINGE scale. capacity syringewithgraduated A basic,allplasticlarge60ml SIMPLE SYRINGE comfortable tohold. has averysmoothaction, with graduatedscale.Plunger 50ml capacity.Clearacrylictube COMFORT SYRINGE Use totrickleyourApi-Bioxalsolution.Practicewithwater. TRICKLE 2EMPTYBOTTLE Wear suitablesafetyequipment. Sachet treats10hives,50or100hives. suitable foruseinvapourisers. seams ofbeesbetweenframes.Also dissolve insyrupandtrickle5mlonto against varroa.4.2%solution.Simply UK licencedOxalicacidbasedtreatment API-BIOXAL instructions andmeasuringscoop. is 85"long.Completewithfull to heattheApi-Bioxal.Cable battery toprovidethepower battery, suchasacar vaporiser requiresa12v This new,affordable, VAPMITE a shelflifeofonly12months.Apivarhas24 Not tobeconfusedwithApitraz,whichisatotallydifferentformulationandhas the brood. for between6and10weeksdependingonthesizeof (supers mustnotbeonthehives).Thestripsareleftin and otherproducts.Itcanbeusedatanytimeofyear are notemperatureconstraintsastherewithMAQS One singleapplicationhasefficacyupto99%andthere off thebees. Amitraz whichparalyzesthevarroamitecausingittofall or bentaswithApitrazstrips.Theactiveingredientis neatly betweentheframeswithouthavingtobecut hives, eachstripis210x40mmwideandthereforefits ourselves. Inpacksof10strips.Eachpackwilltreatfive for useintheUKandisexclusivelyavailablefrom The EuropeanVarroatreatmentofchoiceisnowlicensed Apivar Health Price Packed Wt. 5ml Syringe Simple Syringe Comfort Syringe Trickle 2EmptyBottle Api-Bioxal, 350g Api-Bioxal, 175g Api-Bioxal, 35g Vapmite THORNE BEEHIVES– 01673 858555 • £10.00 £85.00 £48.00 £12.00 £35.00 £31.00 £1.40 £1.60 £1.00 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.06 0.2 0.3 0.1 0.5 0.3 0.1 0.8 0.2 NEW Vaporiser. power supplytoyourSublimox You nowhavea240Volt inverter andswitchon. Plug theSublimoxinto cable tonegative. the 12Vbatteryandblack Clip theredcabletopositiveon the correctPPE...... gloves,gogglesandmask. We adviseallbeekeeperstoresearchtheirproductofchoiceandALWAYSwear the vapoursfurtherintohive. Once AttainedtheSublimoxretainsit’sheatandcontinuallypulsesprojecting as theelectroniccontrollerindicatescorrectworkingtemperatureisattained. This isachievedbyloadingthedeviceupsidedownandtheninvertingitassoon up. throughout thehivewithouthavingtowaitforchemicalchamberheat It’s neatdesignmeans,onceloaded,thatthevapoursareinstantlydispersed Europe. The Sublimoxisnowthevaporiserofchoiceformanybeekeepersthroughout Italy. The APF-PlusSublimoxisaprofessionalpieceofqualityequipmentmadein SUBLIMOX battery. Fullinstructionsprovided. hives totreat.Runsoffa12Vcar very quickmethodifyouhavemany for useduringthewintermonths.A broodless periods,idealtherefore 2.3g. Particularlyeffectivein crystals. Onetreatmentusesjust today forvaporisingoxalicacid The mostsuccessfultoolinuse VARROX VAPORISER 12V DCINVERTER 12V DCInverter Sublimox Varrox Vaporiser Health Price Packed Wt. Convenientcarryingcase • Twoceramicdosingchambers • mainsor12voperationwithpowerinverter(notsupplied) • Quick,easyandcontinuoustreatment • Ruggedconstruction with stainlesssteelcrucible • AninnovativePIDcontroller withthermocoupleforautomaticcontroland • NEW temperature maintenance. • [email protected] £360.00 £115.00 £22.99 1.2 4 0.8 NEW HHEALTHEALTH aandnd MMAINTENANCEAINTENANCE 69 0.1 0.1 2.0 4.5 2 £1.50 £1.25 £6.60 £49.98 £13.50 – THORNE BEEHIVES THORNE – NEW [email protected] • ® fill the Blaster reservoir with vegetable oil Autumn: 2 parts white sugar to 1 part hot water, then leave Feed concentrated syrup: September, so that the brood nest, to cool, OR Ambrosia Fondant, in August/ which is now emptying, fills with stores for winter. Feed 2 or 3 gallons, or until the bees stop taking the food down. Winter: If there is doubt about the quantity of stores available in the winter, do NOT feed syrup which will distress the bees in the long periods of bad weather. Spring: A vulnerable time in the beekeeping calendar as the increase in brood rearing can rapidly run down stores. Give small amounts of a weaker (1:1) syrup. The extra water aids the development of the brood nest. Pollen Substitute: The bees which have survived the winter have to produce 2 or 3 generations of brood to get the colony off to a good start. In a poor spring lack of pollen can hold up development. Nektapoll provides the nourishment necessary for those old bees to raise brood. 3 Beetleblaster, Nucleus size 2 Dose pack Health Price Packed Wt. Wt. Packed Packed Price Health Beetleblaster, Regular size Feeders Price Feeder Eke Bucket MAQS® MAQS 10 dose bucket Bucket Per Per Wt. ⁄ and fit in between top bars of frames. Beetles are attracted to this. Once inside beetles cannot escape. Dispose of in un-recyclable waste. Available in regular and nucleus sizes. FEEDER EKE Made from British cedar. 70mm deep eke will provide extra space for feeding. Now available for all types of Hive. FEEDING YOUR BEES BEETLEBLASTER 2 MAQS The core is a plant based gel containing Formic Acid. It has a high proven efficacy and no resistance has been observed. There is no residue in honey or wax so it can be used with supers on at any time of the season. fits The strip is 6mm thick so easily in the bee space between for 7 days. hive parts. Use two strips Full instructions for use included. highs should be between 10 – 29.5°C on day of Outside daytime temperature the entire 7 day treatment application. The bees should not be disturbed during period. For more information see www.maqs.co.uk 0.75 0.15 0.1 0.3 0.8 3.0 0.1 £1.30 www.thorne.co.uk www.thorne.co.uk £20.00 £22.00 £16.50 £60.00 £14.99 £144.00 • ). This pest, if it reaches our shores and Oudemans on honeybees. Each Aethina tumida 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS varroa jacobsoni Hive Alive, 100ml Health Price Packed Wt. Packed Health Price Apistan Trap Hive Alive, 500ml Hive Alive, 2 litre Bee Gym Acid Safety Kit can survive our conditions could prove quite a challenge to beekeepers. The trap is therefore for monitoring purposes. Simply place inside the hive on the floor to one side. The beetles prefer the dark, hence the black CORREX, and hide in the flutes. Remove and check contents at every hive inspection. If you are seriously concerned with what you find send to the National Bee Unit, Central Science Laboratory, Sand Hutton, York YO41 1LZ for examination. SMALL HIVE BEETLE TRAP APISTAN Apistan is a slow release polymer strip formulation specifically designed for use in beehives for the control of This kit comprises 1 pair of industrial rubber gloves, 1 pair of safety goggles and 1 moulded face mask (FFP3 S/L rated). ACID SAFETY KIT Organic Acids are dangerous: it is therefore essential that the correct safety measures are taken when handling them. BEE GYM HIVE ALIVE HIVE aid A chemical free grooming and for honey bees. It has wires mites flippers which dislodge varroa or other parasites. Bees voluntarily rub their backs and abdomens against the gym and the mites fall through the open mesh floor. See video for more information. www. vita-europe.com/products/bee-gym Hive Alive is proven to be highly beneficial to the health of Hive Alive is proven to be ingredient in ensuring a good honey bee colonies and is a key harvest: Hive Alive ingredients are all GRASS (Safe for human Hive Alive ingredients are consumption). Hive Alive is a new nutrional supplement developed by a new nutrional supplement Hive Alive is 100ml, 500ml and in Ireland. Available in Advance Science add hive alive to with full instructions. Simply 2 litre bottles Hive alive can also be in your autumn feed. your sugar syrup on weaker colonies. feeds, or sprayed/drenched used in spring bottle will treat 50 will treat 10 colonies, 500ml 100ml bottle colonies. A very simple yet effective device for trapping small hive beetle ( NB. There are pockets of resistance to the active ingredient of Apistan in the UK. Check with your local association or monitor mite-fall carefully during the first days of treatment with Apistan. It is recommended to rotate between treatments of different chemical classes every two to three years packet will treat 5 hives. 70 FFEEDINGEEDING FEEDBEE 2.5 litre(3.5kg)jerry cansorwecandispenseintoyourown containers. colonies. Availablein17.5litre(25kg), 9litre(12.5kg)or contributes tothecreationofhealthyand strongSpring HMF content.ThepHvalueisadjusted tosuitbeesand syrup isabalancedliquidpreparedfood withalow dry weight)preventscrystallisation.Ambrosia beefood degradation. Itsveryhighfructosecontent (40%on concentration itisnotsusceptibletomicrobiological fructose, glucoseandsucrose.Becauseofitsveryhigh comes veryclosetonaturalbeenutrition.Itconsistsof Ambrosia beefeedsyrupisaliquidpreparedfoodwhich AMBROSIA SYRUP Available in2.5kg.bagsormultiplesof12.5kgs. fructose andglucose.Perfectforwinterfeeding. A ready-to-usefondantpasteconsistingofrefinedsugar, AMBROSIA FONDANT based protein. with addednonanimal APICANDY PROTEICO, Handy 1kgpack. low temperatures. homogenous evenat digested bybeesandstayssoft sucrose, glucoseandfructose.Itiseasily genetically modifiedsugarsincluding fondant beefeedmadefromnon- APICANDY isapurecarefullyformulated A 1.5kgs, 500g. Sold infoursizes,20kgs,3kgs, artificial nutrients. chemical, preservativesor soy products,animal mites. Doesnotcontainpollen, against commondiseasesand that alsohavehighresistance the populationofhealthybees natural pollen.Itincreases the samestructureastheir nutrients inFeedbeehave during allstagesoflife.The required byhoneybees it providesallnutrients research onbeesnutrition, the 2004after12yearsof of GuelphinCanada Developed attheuniversity pesticides ormodifications. materials, freefromany 100% non-agriculturalplant Feedbee. Itismadefrom highly regardedandpopular We arenowstockingthe Apicandy, 1kg Feeding Price Packed Feedbee 20kgs Wt. Feeding Price Packed Wt. Apicandy Proteico,1kg Feedbee 500g Feedbee 1.5kgs Feedbee 3kgs PI C ANDY THORNE BEEHIVES– 01673 858555 ANDA PI C ANDY P ROTEICO • £13.80 £65.00 £3.25 £2.50 £3.80 £7.40 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 1.1 1.1 1 2 3.5 20 NEW 1 gallonContactFeeder ½ gallonContactFeeder oEgad ae toHighlandsof Scotland,N.Ireland andSouthScotland toEngland,Wales and Islands BUDGET WOODENFEEDER Central feedholewithclearplasticcover. glue/ wax priortouse.Holds2gallonsofsyrup. untreated andwillthereforerequiresealingwith National sizeonly–Thistimberfeederissupplied hives. 180mmdiameter,50mldeep. 500ml Rapidfeederidealfornucleus NUC FEEDER RAPID FEEDER ENGLISH FEEDER CONTACT FEEDERS ASHFORTH FEEDERS 3 sizes. Langstroth sizesonly. be takenbythebees.National/Commercial,WBCand should tipslightlyforward)allthesyrupthen end. Placeonhivewithaccesstothefront(a with threecoatsofpaint.Beesaccessisatone Red Cedar.Alljointsarewellglued.Finished the broodchamber.ManufacturedinWestern Two galloncapacity.Coversthewholeareaof the hive. refilled witheasewithoutremovingitfrom Centre coverpreventsbeesescaping.Canbe Plastic feederholdingapprox.4pintsofsyrup. with easewithoutremovingitfromthehive. in thecrownboard.Capacity6litres.Canberefilled into allstandardhives.Noneedtomakeanewhole the feeder.Sizeis330x390m71mm.Itwillfit the centralareabutpreventsbeesfromescapinginto dome. Acupoverthedomeallowsfeedtoflowinto hole. Beescomeupthroughtheholeandover “Rapid” typeplasticfeederandlidwithonecentral fit insideanemptysuper. the feedholeoncrownboardof hive.Ourhalfgalloncontactfeederwill completely full.Presslidonfirmlyandquicklyinvertthefeederplaceover Continue addingwateruntil and continueuntilfullydissolved. release airtrappedinthesugar top andaddwarmwater.Stirto with sugartoabout1”fromthe otc edr ec Pce t Pr1 PackedWt. Per10 PackedWt. each ¼ gallonContactFeeder Contact Feeders Own container,kg Syrup, 3.5kgJerrycan Syrup, 12.5kgJerrycan Syrup, 25kgJerrycan Fondant, 12.5kgs Fondant, 2.5kgs Ambrosia English Feeder Feeders Price Packed Wt. Budget WoodenFeeder Ashforth Feeder Nuc Feeder Rapid Feeder 1 ⁄ 4 gal., olce IcuigCrig IncludingCarriage IncludingCarriage Collected 1 ⁄ 2 gal.,1gal.Fill £29.00 £54.25 £31.00 £1.80 £8.50 £6.75 £6.35 £5.30 £4.40 • 6m 10mx 95mmx 140mmdia. 140mmx 200mmdia. 240mmdia. 160mmx [email protected] NA N/A N/A 1.3 0.75 0.5 £15.58 £36.08 £61.33 £38.00 £13.83 £20.70 £52.00 £10.50

£5.00 £3.50 £56.00 £47.50 £39.60 3 4 0.5 0.6 1.5 6 4 2.5 £28.23 £50.65 £81.66 £42.00 £17.79 FFEEDINGEEDING 71 1.2 0.6 1.2 0.1 0.3 0.6 0.4 1.25 0.3 0.15 0.2 0.1 1.2 0.7 0.3 £7.00 £8.40 £1.80 £2.25 £1.00 £7.00 £8.00 £18.00 £30.00 £14.00 £30.00 £62.00 £25.99 £11.16 £110.00 – THORNE BEEHIVES THORNE – [email protected] • pints. Complete pints. Complete 2 ⁄ 1 Plastic Entrance Feeder, 400ml Plastic Entrance Feeder, Plastic Entrance Feeder, 800ml Water Feeder BS Frame Feeder Mini Ashforth Feeder Apifit, 500ml Apifit, 1000ml Nozevit+, 200ml Nozevit+, 500ml Nozevit+, 1000ml Feeding Price Packed Wt. Packed Feeding Price Nektapoll Feeding Apifit, 200ml Health Price Nozevit+, 50ml Packed Wt. Price Feeding Packed Wt. Vitafeed Nutri Price Wt. Packed Feeders Price Packed Wt. Packed Price Feeders Wooden Entrance Feeder Nektapoll is a ready-to-feed pollen substitute/fructose syrup patty. Use from early March to stimulate your bees if there is a shortage of pollen. Feed between 250g and 500g per colony by splitting plastic sleeve and slicing patty with a sharp knife. Place on top of brood frames, ideally inside a small eke or our Apiguard Rim. NOZEVIT + VITAFEED NUTRI VitaFeed Nutri is a protein-rich feed that boosts honey bee health, increases brood area and increases honey production. It is a rigorously tested, GMO-free nutritional supplement that can be used at almost any time of year to promote controlled colony growth. Scientifically formulated and packed with an optimum blend of vitamins and crude amino acids specifically developed to boost your bees. NEKTAPOLL MINI ASHFORTH FEEDER feeder. A small capacity (2 litre) plastic nucs. 2 Hinged lid, suitable for feeding litre capacity. APIFIT or as a feed Apifit is used to strengthen colonies during the spring It is a perfect supplement in the summer during nectar shortages. and filtered mixture of essential oils, plant polyphenols, sucrose or sprayed water. It can be added to sugar syrup, a pollen patty directly on to the combs. Packed in 200ml, 500ml or 1000ml bottles. oils and This improved formula Nozevit contains vitamins, essential with greater citric acid. Bees are noticeably stronger and healthier The disease resistance and tend to be calmer during manipulations. digestion citric acid content stabilizes intestinal pH and improves per hive. and recovery. Use four times annually, 1ml per application Available in 50ml, 200ml, 500ml and 1000ml bottles. FRAME FEEDER FRAME our popular frame BS size only, available in feeder is now easy clean plastic. hardwearing, 3 Holds approx. float. with wooden 0.1 0.3 2 5 5 0.3 £2.50 £3.40 £2.20 www.thorne.co.uk www.thorne.co.uk £20.00 £75.00 £36.00 • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS 1lb Jar Attachment Feeder Feeders Price Packed Wt. Packed Price Feeders 1lb Jar Attachment Feeder with Jar Flow Feeder only Framed Flow Feeder, Rectank & Tubing Robson Feeder Board Clear Feeder Reaches 10cms into the hive. Bottle not included. The feeder can also be used for feeding syrup if necessary, and as it reaches 10cms into the hive the bees do not have to venture too far during cold snaps. This little feeder is the answer. Very simple to use without disturbing the hive, taking virtually all makes of compact water bottle found on supermarket shelves. We all need water to live and bees are no exception. The instances of bees struggling to find water in periods of drought are commonplace. WATER FEEDER PLASTIC ENTRANCE FEEDERS 400ml and 800ml. Place on the alighting board of the hive with the feed channel under the entrance. Alighting board must be horizontal. Simply push into the hive entrance. A further development from the jar attachment feeder. Ideal for nuclei or full colonies for supplying water, syrup and honey. Not suitable for WBC hives. WOODEN ENTRANCE FEEDER CLEAR FEEDER ROBSON FEEDER BOARD A small, clear and inexpensive plastic feeder that will hold 1 litre of feed. It can also be used for fondant, Nektapoll or FeedBee. 255x155x45mm deep. Bees access from directly underneath and the feed is kept warm, fresh and moist by the heat generated foam and from the colony. The feeders are encased in insulation This feeder will only fit covered above by a snug fit chip foam insulated quilt. National Hives. Based on an idea given to us by Willie Robson of Chain Bridge Honey Farm. The feeder has two, clear plastic, 1 litre compartments with hinged lids. Both can be used for syrup or fondant, pollen feeding or a combination. It is very easy to install and It is very easy to install and means you do not have to feed. open the hive to add extra the Connect the clear pipe from the push feeder to the reservoir using outlet is fit connectors. Ensure reservoir as the feeder is gravity higher than floor entrance Syrup flows through the pipe into the central, fed. Open valve on reservoir. to can be adjusted on either side of float ‘ball valve’ ribbed, chambers. Baffles insulated ensuring syrup is relatively liquid at all times. adjust flow. The feeder is Reservoir will hold 10 litres of feed. This feeder fits inside your existing This feeder fits inside your must mesh or solid floor (floor have been made by us). FLOW FEEDER 1LB JAR ATTACHMENT FEEDER ATTACHMENT 1LB JAR jar into a very 1lb. (454g) glass honey Turns the standard honey or syrup to full Ideal for feeding back efficient feeder. bronze gauze. or observation hives. Phosphor colonies, nuclei on one side. Available plastic lid with bee space Easy to clean glass jar. with or without 72 FFEEDINGEEDING ASIAN HORNETTRAP(VESPA-CATCH) Start hangingthewaspinatorsinearlyspringtodeterallyearround. waspinatir isavisualdeterrent,thewaspsmustbeabletoseeithanging. Simply hangmorewaspinatorstocoverthewholeareaaffectedbywasps.The Tests showthewaspinatorworkswithina10mradiusofwhereitishung. flowers andkillingaphidselsewhere. used byhumansbutwhichleavesthemfreetodotheirworkofpollinating deterrent whichwilleradicatewaspsfromthegardenareas defenders. Waspinatorisanutterlyeffectivenaturalwasp real waspsnestforfearofbeingattackedbythenest’s they willkeepwellawayfromwhatthinkisa think thereisalreadyawaspsnestinresidence.Then just hangupaWaspinatorandforagingwaspswill of waspsfromtheseareasthehomeandgarden, want tostopbeingbotheredbywaspsandgetrid areas ofyourgardenwhichyouwanttouse.If wasps’ territorialnaturetorepelthemfromthe Waspinator isanaturalwasprepellentutilising your garden. wasps andwithoutdisturbingtheinsectworldin Waspinator createsalargewaspfreezonewithoutkilling WASPINATOR litre bottle. pack of10attractantsand,forthelargeruser,aone Available asasingletrapwith5attractants,refill an averageoftwotrapsperfivehives. access it.Refilltheattractanteverythreeweeks.Use branch orothersupportsothehornetscaneasily hornets escaping.Hangthetrapfromatree scents, shieldsnaturallightandprevents covered withatunnelthatfocusesanddirect Hornets. Thelidhastwoentrances,both yellow bowlcolourisknowntoattractAsian to sugarandwaterpourintotrap.The (and notbees).Addthenaturalattractant A simpleandeffectivetraptoAsianhornets THORNE BEEHIVES– 01673 858555 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk RECORD CARD reducing robbingintheapiary. replace. Retaintheupperchamber.Greatfor if ourexperienceisanythingtogoby!)simply lower chamberisfullofwasps,(anditwillbe efficient trap.Atwopartdevice.Whenthe Keep waspsundercontrolwiththishighly WASP BANE a writeon-wipeoffsurface. colony management.Canbelaminatedtoproduce colony behaviour,honeyyield,etc.Vitalforgood Stiff A4cardtokeepnotesondisease,feeding, Wasp Banerefill Wasp Bane Waspinator Bottle Attractant 10 Refillsonly Laminated RecordCard Record Card Asian HornetTrap+5Refills Health Price Packed Wt. • [email protected] £25.00 £33.00 £16.80 £4.99 £5.00 £6.00 £1.80 £0.80 1.5 0.15 2.0 0.25 0.6 0.1 0.06 0.6

FFEEDINGEEDING 73

if a lack of pollen combination of vitamins and amino acids amino and vitamins of combination pollen of lack a if

Vitafeed Nutri Stimulatory feed especially As required 5-10 grams in 1 litre of 2:1 sugar syrup, Spring and Summer None Can be be Can None Summer and Spring syrup, sugar 2:1 of litre 1 in grams 5-10 required As especially feed Stimulatory Nutri Vitafeed used during honeyflow during used

in syrup feeds. syrup in

also an effective fungicide 8g per treatment in crystal form crystal in treatment per 8g fungicide effective an also

hmlCytl Vro n hlbod ek/eet seta i fTye pigadAtm D o s uighnyfo Very flow honey during use not Do Autumn and Spring Thyme of oil Essential weeks/repeat 3 Chalkbrood and Varroa Crystals Thymol temperature dependent temperature

– THORNE BEEHIVES THORNE – strips 2

Sulphur Strips Wax Moth 4 weeks/repeat Sulphur impregnated board Autumn/winter months None Highly dangerous fumes dangerous Highly None months Autumn/winter board impregnated Sulphur weeks/repeat 4 Moth Wax Strips Sulphur

decahydrate. 150g to 500ml hot water hot 500ml to 150g decahydrate.

oaCytl Gnrlcenn gn A eurd oimCroae srqie Nn Irritant None required As Carbonate Sodium required As agent cleaning General Crystals Soda

Nosema Cerana 10 days apart 1ml per 200ml of syrup of 200ml per 1ml apart days 10 Cerana Nosema oei Nsm ps ramns Esnilol,ntrligeins pigadAtm None Autumn and Spring ingredients natural oils, Essential treatments 2 Apis Nosema Nozevit

[email protected]

stimulates breeding 250-500g per colony per 250-500g breeding stimulates •

Nektapol Pollen Supplement As required Pollen substitute/fructose patty. From early March None Keep free from frost from free Keep None March early From patty. substitute/fructose Pollen required As Supplement Pollen Nektapol

and colony agitation, highly dangerous fumes dangerous highly agitation, colony and

MAQS Varroa 7 days 2 formic acid impregnated pads Anytime during the season None Possible bearding, loss of young brood young of loss bearding, Possible None season the during Anytime pads impregnated acid formic 2 days 7 Varroa MAQS

NHS approved form approved NHS

Hive Wash Sanitiser As required Concentrated solution of a Any time N/A Avoid contact with bees, highly corrosive highly bees, with contact Avoid N/A time Any a of solution Concentrated required As Sanitiser Wash Hive

100ml to 1 litre water litre 1 to 100ml

ieAie edsplmn 3wesi pae Age ewe,tyo Atm None Autumn thymol seaweed, Algae, sprayed if weeks 3 supplement Feed Alive Hive

carbohydrates, sugar and minerals and sugar carbohydrates,

Feed-Bee Pollen supplement As required Mixture of protein, fat, Spring None Can be used at any time any at used be Can None Spring fat, protein, of Mixture required As supplement Pollen Feed-Bee

10 average sized frames sized average 10

10ml to 200ml of water for water of 200ml to 10ml

Certan Wax Moth Various Biological Larvicide Spring and Autumn None Very short shelf-life when mixed when shelf-life short Very None Autumn and Spring Larvicide Biological Various Moth Wax Certan

Apivar Varroa 6-10 weeks Amitraz impregnated strips Early Spring and Autumn Do not use during honey flow Do not store above 30° above store not Do flow honey during use not Do Autumn and Spring Early strips impregnated Amitraz weeks 6-10 Varroa Apivar C

acquatic life acquatic

Apistan Varroa 6-8 weeks 2 fluvalinate impregnated strips Spring and Autumn Do not use during honey flow Possible resistance, e resistance, Possible flow honey during use not Do Autumn and Spring strips impregnated fluvalinate 2 weeks 6-8 Varroa Apistan xtremely dangerous to dangerous xtremely

4 strips strips 4

Eucalyptus oil, Camphor, Menthol and colony agitation, temperature dependant temperature agitation, colony and Menthol Camphor, oil, Eucalyptus

Apilife Var Varroa 4 weeks Thymol impregnated foam, Once only, Spring OR Autumn Do not use during honey flow Possible bearding, Possible flow honey during use not Do Autumn OR Spring only, Once foam, impregnated Thymol weeks 4 Varroa Var Apilife loss of young brood young of loss

and colony agitation, temperature dependant temperature agitation, colony and

Apiguard Varroa and Acarine 4 weeks 2 thymol gel trays Spring and Autumn Do not use during honey flow Possible bearding, loss o loss bearding, Possible flow honey during use not Do Autumn and Spring trays gel thymol 2 weeks 4 Acarine and Varroa Apiguard f young brood young f

www.thorne.co.uk www.thorne.co.uk

Nectar shortage Nectar •

Spring build-up, winter preparation sucrose. 5ml per litre of sugar syrup sugar of litre per 5ml sucrose. preparation winter build-up, Spring

Apifit General supplement Variable Essential oils,plant polyphenols Anytime None Nozevit can be added to Apifit to added be can Nozevit None Anytime polyphenols oils,plant Essential Variable supplement General Apifit

Api-Bioxal Varroa 15 minutes per hive Oxalic Acid dihydrate in powder form When colony is broodless Do not use during honey flo honey during use not Do broodless is colony When form powder in dihydrate Acid Oxalic hive per minutes 15 Varroa Api-Bioxal w Very short shelf life when mixed with syrup with mixed when life shelf short Very w

on stores on

5-10 litres per colony depending depending colony per litres 5-10

Ambrosia Syrup Feed As required Fructose, glucose and sucrose. Autumn, late Spring and Summer None Keep free from frost from free Keep None Summer and Spring late Autumn, sucrose. and glucose Fructose, required As Feed Syrup Ambrosia

Ambrosia glucose. 1-2kgs per colony per 1-2kgs glucose. Ambrosia

Apicandy/ Feed As required Refined sugar, fructose and Winter, early Spring None Keep free from frost from free Keep None Spring early Winter, and fructose sugar, Refined required As Feed Apicandy/

sugar feed supplement brewers yeast extract yeast brewers supplement feed sugar

Apicandy Proteico Protein enriched As required Refined beet sugar and Spring and Autumn None Keep free from frost from free Keep None Autumn and Spring and sugar beet Refined required As enriched Protein Proteico Apicandy

against wax moth and Nosema absorbent pad absorbent Nosema and moth wax against

Acetic Acid Fumigation of stored hive parts 1 week/repeat 80% solution. 125ml on an Autumn/winter None Highly corrosive, dange corrosive, Highly None Autumn/winter an on 125ml solution. 80% week/repeat 1 parts hive stored of Fumigation Acid Acetic rous fumes rous

rdc Ueg Drto ftetet plcto n anigeins ieo er ihrwlpro Notes period Withdrawal year of Time ingredients main and Application treatment of Duration Useage Product

HIVE HOUSEKEEPING – – HOUSEKEEPING HIVE A useful guide to medicines, cleansers, feed and supplements and feed cleansers, medicines, to guide useful A 01673 858555 SERVING BEEKEEPERS WORLDWIDE FOR OVER 100 YEARS 100 OVER FOR WORLDWIDE BEEKEEPERS SERVING 74 BBOOKSOOKS See www.thorne.co.ukformoretitles. be pleasedtoadviseonthemostsuitabletitlesavailable. largest rangesofbooksonbeekeepingintheU.K.andwould good bookispurchasedonthesubject.Wehaveoneof Before youstartbeekeeping,wealwaysrecommendthata BOOKS ABC &XYZofBeeCulture Honey Marketing Honey Farming Honey Days Honey Cookery Honey Cookbook Honey Bee,Biology&Beekeeping(Caron) Honey BeeDisease,IdentificationCards The HoneyBee,insideout(Davis) The HoneyBee,aroundandabout Hive andtheHoneybee Haynes BeeManual Handbook ofBeekeeping Guide toBeesandHoney Fun withBees-Allan Frow -Lincolnshire'sGreatestBeekeeper For theLoveofBees The HistorieofBees The FeminineMonarchieor Dr Sara'sHoneyPotions Collecting HoneyPots Buzzing withIdeas,THEWBCHive Buckets ofHoneyfromBoxesBees Breeding theHoneybee Breeding SuperBees Bella, theQueenBee Beeswax -Coggshall&Morse Beeswax -Brown,4thedition Bee-sentials, AFieldGuide(Connor) Bees atthebottomofGarden Bees atLaw Bee SexEssentials(Connor) Bee MastersofthePast Microscopy CertofBkgStudyNotes Husbandry Certificate Beekeeping StudyNotes,Mod5,6,7,8 Beekeeping StudyNotes,Mod1,2,3 Beekeeping ForAll Beekeeping atBuckfastAbbey Beekeeping, aPracticalGuide(Patterson) Beekeepers Toolbox-Allan Beekeepers FieldGuide The BeeHouseBook The BeeFriendlyGarden Beauty andtheBees(Robb) Beautiful QueensandHoneyToo! BBKA GuidetoBeekeeping(Davis) (Bull Turnbull) Bad BeekeepersClub,paperback Background toBeeBreeding(Atkinson) At theHiveEntrance The AsianHornet Apis throughtheLookingGlass An IntroductiontoBeesandBeekeeping An IntroductiontoBeeHouses(Bates) Anatomy oftheHoneyBee(Snodgrass) Alphabetical GuideforBeekeepers(Stevens) Dad’s Re AB ColouringBook Books Price Packed Wt. THORNE BEEHIVES– 01673 858555 cipe Book £11.00 £40.00 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk £12.99 £10.95 £25.00 £12.00 £19.00 £11.00 £14.00 £20.00 £10.99 £18.50 £35.00 £16.00 £12.00 £19.95 £35.00 £30.00 £11.00 £18.99 £10.95 £14.99 £12.50 £18.99 £26.00 £13.50 £27.50 £16.99 £30.00 £30.00 £40.00 £12.95 £11.00 £20.00 £20.00 £45.00 £22.99 £12.95 £2.00 £1.00 £2.00 £2.99 £5.40 £3.50 £9.95 £9.95 £9.95 £9.99 £1.00 £2.00 £9.99 £6.00 £4.99 £7.35 £1.50 £5.99 £4.00 0.2 0.25 0.5 0.3 0.1 0.3 1.5 0.1 0.6 0.6 2.0 0.75 0.5 0.75 0.06 0.06 0.4 0.7 0.3 0.2 0.2 0.5 0.4 0.3 0.4 0.15 0.4 0.3 0.4 0.4 0.7 0.4 0.4 0.3 0.75 1 1 0.6 0.4 0.3 0.06 0.4 0.4 0.75 0.2 0.06 0.6 0.7 0.5 0.2 0.4 0.6 0.2 0.2 0.6 0.75 2 Honey RecipesforMicrowaveCookery Books Price Packed Wt. Your Health,howbeescanhelp Why notTopBarHives? The WorldofaBeeFarmer The WildGardenandtheHoneybee Understanding BeeAnatomy Sweet andSavoury Swarming, ItsControl&Prevention Starting Out-Allan Splits andVarroa Hesitant QueenRearer Some AlternativePathwaysforthe Social OrganisationofHoneybees Small HiveBeetle Skep-Making (Brekelmans) Scientific QueenRearing The RoseHiveMethod Reflections onBeekeeping(Robson) Recipes usingBeeswax Simplicity Recycling &WorkingBeeswaxwith Queen RearingSimplified(Cook) Queen RearingEssentials Queen Rearing-Snelgrove How togetbetterbees Queen BreedingandGenetics- Woodward Queen Bee,Biology,BreedingandRearing- Propolis (Nowottnick) Producing RoyalJelly(vanToor) Principles ofBeeImprovement (Maurer) Practical MicroscopyforBeekeepers Heather Honey A PracticalGuidetoProducing Practical Beekeeping Pollen Microscopy Pollen IdentificationforBeekeepers Pollen IDCards Plants forBees Plants andHoneyBees Planting forHoneybees Pheromones ofsocialbees Observation Hives(Webster&Caron) The ObservationHive Natural BeekeepingwiththeWarreHive My firsthoneybeebook Mites oftheHoneybee(Webster&Delaplane) Medical AspectsofBeekeeping Mead Making Manipulations -Allan The LifeoftheBumblebee Keeping HealthyHoneyBees (Bleasdale) Keeping BeesWithoutFussorChemicals Keeping BeesandMakingHoney The JeffersonBeekeepingGuide Introduction ofQueenBees(Snelgrove) Insect BitesandStings-DrHarryRiches In searchofthebeststrainsbees Increase Essentials(Connor) Queen How toKeepBeeswithoutfindingthe • [email protected] £9.95 £1.50 £25.00 £19.95 £12.00 £19.95 £15.50 £12.00 £12.00 £17.25 £10.95 £10.95 £12.00 £16.00 £14.99 £14.00 £11.00 £13.00 £15.00 £29.00 £10.50 £17.00 £14.50 £17.50 £15.50 £15.00 £18.00 £19.95 £15.99 £12.00 £17.50 £24.95 £21.00 £12.50 £4.00 £1.50 £9.95 £5.00 £4.00 £6.00 £5.50 £9.50 £9.95 £1.50 £1.50 £9.95 £8.95 £5.00 £3.99 £1.50 £2.50 £9.95 £9.95 £8.95 £4.00 0.2 0.3 0.5 0.4 0.6 0.06 0.3 0.06 0.2 0.2 0.3 0.4 0.06 0.4 0.3 0.3 0.06 0.06 0.2 0.4 0.6 0.6 0.5 0.3 0.6 0.3 0.4 0.2 1.2 0.4 0.4 0.4 1.5 0.75 0.5 0.5 0.5 0.4 0.4 0.3 0.75 0.3 0.25 0.06 0.4 0.75 0.3 0.4 0.2 0.5 0.2 0.6 0.4 0.3 0.15 EEDUCATIONDUCATION 75 0.5 0.5 £5.00 – THORNE BEEHIVES THORNE – £15.00 [email protected] • Picture 13 3D Pictures Each, picture 1-12 Price Packed Wt. Picture 13 3D PICTURES Clever 3D pictures made from very strong plasticised material – plasticised material – made from very strong Clever 3D pictures talking point. to make a really nice could be framed 13, size 490 x 235mm. 12, size 490 x 345mm. Picture Pictures 1 to 6.8 0.7 3.6 0.5 0.3 www.thorne.co.uk www.thorne.co.uk • £3.00 £25.50 £54.35 £15.75 £109.70 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Full Set of 9 Posters Photographs only Virtual Hive Price Packed Wt. Each Royle Posters Price Packed Wt. Photographs in Frames Complete Brood Body Photographs were taken by Simon Croson, winner of Gold Medal, Apimondia, Photographs were taken by Simon Croson, winner (Beehives) Ltd. Argentina, 2011. Copyright S. Croson and E.H. Thorne The virtual hive provides a comprehensive photographic guide to the frames The virtual hive provides a comprehensive photographic typical brood box at and conditions that can generally be found within a may not be found within various times of the season. Some of the conditions queen cells, and the same brood box at the same time, eg laying queen, will learn to relate sporadic drone brood. Study this guide and the beekeeper any actions required. and identify conditions within their own hive and take on card 0.5mm. Eleven 343x203mm matt finish high resolution photographs size to use in an assembled Photographs are printed back to back. The correct frames or as a complete DN4 frame. Also available in eleven assembled DN4 each frame. national brood body. Complete with notes detailing VIRTUAL HIVE THE ROYLE POSTERS THE ROYLE Each has measuring 595mm x 425mm. plasticised posters, Nine really affordable or beekeepers Great posters for beginners photos and advice. useful information, Copyright E.H. aids for training courses. experience, and essential of many years Ltd and G Royle. Thorne (Beehives) 76 DVD -TheHoneybee DVD -Honey,ABeekeeper'sGuide EEDUCATIONDUCATION procedures atallstagesofthehive’ssummercycle.2011. allows theviewertimetostudyindetailcorrecthandling is carefullyexplainedanddemonstratedatapacethat April totheonsetofwinter.Themanagementhive control, hetakesusthroughthebeekeepingyearfrom and equipment,aswellthelatestadviceondisease Norfolk. Withnewandupdatedsectionsonchoiceofhive For muchofthattimehewastheBeekeepingAdviserfor Paul Metcalfehasbeenkeepingbeesforalmost50years. mead. 2011. a demonstrationonhowtoturnhoneyintoprizewinning best toexhibithoneycatchthejudgeseye;andthere’s nectar sourcesarediscussed;there’sasectiononhow bottling andpreparingitforsale.Differenthoneys honey fromthehive,extractingcomband DVD describingindetaildifferentmethodsofremoving PAUL METCALFE A NEWINTRODUCTIONTOBEEKEEPINGWITH DVDs all associations. handles. Amustfor Strong carrying the tall,thinvariety. transport, unlike Very easyto feeder andglass. crownboard, frame a nucleusroof, complete with floor. Supplied mesh ventilated because ofthewire closed allday happy toremain The colonyisquite excluder. above thequeen servicing thequeen, syrup feedand processing the away quitehappily nuc bodywork The beesinthe section. the frameintop frame feeder.Place and replacewitha queen fromthenuc the framewith etc., simplyremove visiting aschool, hive. Then,when apiary asanucleus Keep itinyour demonstrations. trouble-free livebee to easyand effective answer The simpleand MOBILE NUC/OBSERVATIONHIVE THE HONEYBEE HONEY, ABEEKEEPERSGUIDE survival ofthebeesthroughwinter.2009. for food,waterandpropolis,defence,diseasethe the excitementofswarm,waxproduction,foraging and drones,featuringcommunicationwithinthenest, previously unseencloseupfootageofthequeen,workers The Honeybeeisthestoryoflifeacolonywith with PaulMetcalfe DVD -ANewIntroductiontoBeekeeping Education Price Packed Wt. THORNE BEEHIVES– 01673 858555 –43minutes

– 114minutes

– 120minutes • £13.00 £23.90 £23.90 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.2 0.2 0.2 glazed glass. Deep andtwoShallowframes.Fittedwithdouble that alsoactsastheswivelaxis.HoldsoneBS window framewillneedtobedoneoncethehiveisinsitu. Similarly theactualfittingofentrancebetweenhiveandoutsidewallor The hivewillneedmounting/boltingtoastrongplinth(fittingsnotsupplied). We canmanufacturetosuitanyframetype. The pictureshowsatripleframed14x12hive. hive andnottrappedintheentrancerun. the outsideandensureallbeesarein enabling thebeekeepertoclosehive ‘Airlock’ chamberwithinternalgates Jar ofhoneyorsyrup,lockabledoor. Feed chamberwithaswivelclosure,for1lb. heavy hiveat40kgs.) Sturdy uprightsforeaseofcarrying.(Thisisa Hinged andlockabledoorsonbothsides. variety ofinterestingfeatures. brass fittings,sealeddoubleglazedunitsanda furniture. MadefromAmericanWhiteOak, These observationhivesarepiecesof BESPOKE OBSERVATIONHIVE observation hive. plastic pipeandprovidesflexibilitywhenpositioningthe This clear19mmdiametertubeissuitableforfixingtothe TRANSLUCENT TUBE 1 National sizeonly.Completewithshuttersand OBSERVATION HIVES secured (additionalpairofscrewsanddiscentrancesupplied). top andbyusingthescrewholesfornormallidspringfastenercanbe If youalreadyhaveoneofourtravellingboxesthisFrameHolderwillfiton busy andstimulated. Replace theselectedframewithafeeder(notincluded)tokeepyourbees a pairofspringfastenersandtheframelidisheldinplacewithtogglefasteners. transit. Thetopissecuredtothebaseusing out whenhiveisnotbeingusedorin queen. Blackcorrexshutterskeeplight crystal clearobservationofthe polycarbonate sidesallowing marine plyFrameHolderwith On topofthisisfitteda with arotatingdiscentrance. frame, plywoodtravellingbox hive consistsofastandard6 cedar MobileNucHives.The fraction oftheprice and entertainingaidata able toofferthisteaching CNC machineryweare fete’s etc.Usingournew schools, colleges,shows, observation hive,greatfor Standard Deepframe A basic,singleBritish ICB HIVE ⁄ Bespoke ObservationHive bevto ie Pie Packed Wt. Price ICB Hive Mobile Nuc/ObservationHiveNational Observation Hives Translucent Tube,permetre BS ObservationHive,fittedwith glass Mobile Nuc/ObservationHiveDadant Mobile Nuc/ObservationHiveCommercial Mobile Nuc/ObservationHiveLangstroth Mobile Nuc/ObservationHive14"x12" ICB HiveFrame Holder Only 4 galloncontactfeeder.Centralbaseentrance • [email protected] £266.00 £481.20 £442.40 £442.40 £442.40 £367.00 £41.50 £72.50 £8.00 POA 0.15 5.0 10.0 15 15 15 15 15 12 EEDUCATIONDUCATION 77 0.3 £21.50 – THORNE BEEHIVES THORNE – [email protected] • – For those interested in pollen identification. Details are – Specifically on honey bees. This excellent chart gives details of – Specifically on honey bees. This excellent chart gives – This is on bees in general and covers solitary bees, (mining bees), social solitary bees, (mining bees), bees in general and covers – This is on Wallcharts Price Packed Wt. Packed Wallcharts Price Wallchart, each given of the following pollens, inclu ding electron micro scope illustra tions and scope illustra electron micro ding given of the following pollens, inclu herb, horse chestnut, oil-seed rape, white clover, willow dandelion, blossom time: blackberry, thistle, lime, borage, balsam, ling heather and ivy. 840 x 595mm. Pollen in Honey Bees Honey Bees WALLCHARTS are all bees (honey bees). Included bees) and advanced social bees (bumble x 595mm. nature and habitat. 855 aspects of their features and details of the various castes with close-ups of various anatomical their brood development from egg to adult. 855 x 610mm. 0.2 0.2 0.06 0.2 £2.50 £2.50 www.thorne.co.uk www.thorne.co.uk £10.00 £19.00 • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Honey Bees and Beekeeping CD ROMs Price Packed Wt. Cardboard Model Hive Education Price Packed Wt. Packed Price Education Pollen Identification Secrets of the Beehive CD ROM – Pollen Identification An illustrated key to accompany Rex Sawyers book. The CD to a certain extent replaces Sawyers work as it contains a spreadsheet that not only sorts the pollen but allows the beekeeper to view an image of each pollen type. Also included are pictures of common pollen that were not in the original book. Topics include: Introduction to Honey Bees; Where Honey Bees Live: Trees, Apiaries, Queen, Workers and Drones; How a Honey Bee Grow - Ages & Stages; Flowers & Bees, Pollination; Bee Dances; Role of the ; Swarming; Stings; The Honey Factory; Pollen, Propolis and Water; Brood Food, Royal Jelly and Wax; Apiaries, Equipment and Costs; Bees in Danger. The presentation contains over 100 slides based on the book 'Honey Bees and Beekeeping' by Pam Todd. An excellent aid for introducing bees and beekeeping to children and adults. Recommended for children aged 6 years and older the CR Rom contains two presentations. The first is a self contained presentation to be used by individuals or small groups. The second is for use by a beekeeper wishing to give presentations to interested groups. CD ROM – Honey Bees and Beekeeping - An Introduction CD ROM – Honey Bees and Beekeeping A4 in size, produced on stiff art A4 in size, produced on stiff card, brass fastener provided. A cut out and colour teaching aid for children. Well illustrated, it shows the life aid for children. Well illustrated, it shows the A cut out and colour teaching egg history of a honeybee from for to foraging worker. A must all primary schools and young budding beekeepers. SECRETS OF THE BEEHIVE CARDBOARD MODEL HIVE MODEL CARDBOARD tool. Press-out, A useful educational parts form a brood fold and stick super and box, excluder, and super roof plus brood from stiff frames. Made colour. card and in full The hive when assembled is 65mm high and 50mm square. 78 EEDUCATIONDUCATION several halfsizeframes. is complementedwiththeinclusionof crownboard andmetalcoveredroof.It entrance block,broodbody,twosupers, The Nationalcomprisesfloorwith MODEL HIVES Rule, AFBEFB,Varroa,SHBTropilaelaps, Swarming. Uncapping Fork,ApiguardApi-life-Var, Trickle2,Foragecalendar,Beekeepers Label, GranulationPolish L11BeeswaxLabel,SealedBrood,Plastic Label, L.30L.12TamperSeals,L.17 JARLabel,L.17B14CR Converter Clip,L.1Label,L.20L.25 Label,L.26L.27L.40 Cage, BeePin,ClipQueenCatcher,ButlerCappedHoney,Hoffman Grafting Tool,HairRollerCage,CellProtector,QueenPuzzlePress-in Wooden CellCup,Mandril,NurseryCage,ChineseGraftingToolEconomy Slotted SteelQueenExcluder,RigidPollenStrip,Eggs,JenterBrownCellCup, Brood, StandardMouseGuard,WireQueenExcluder,Plastic Rhombus Escape,CanadianConeWBCSealed&Unsealed Dance, NarrowPlasticEnds,Pollen,EndsPorterEscape,Curtain End, WidePlasticSectionRings,Covers,HoneyComb,Waggle Dummy Board,HiveTool,ToolandFrameLifter,Foundation,WideMetal Floor, CrownBoard,LockSlides,SpringFasteners,CornerSupports,Plastic Castellated Spacers,PlasticFrameRunners,MetalOpenMesh subject. beekeeping withintendifferentframes.Invaluableforaseriousspeakeronthe A Nationalbroodbodycontainingorpicturedeveryitemaspectofbeesand TRAINER'S BOXOFTRICKS rie' o fTik Pie Packed Wt. Price Trainer's BoxofTricks WBC ModelHive Education Price Packed Wt. National ModelHive THORNE BEEHIVES– 01673 858555 exhibitions. for demonstrations,displaysand two furtherliftsandaroof.Useit and porchwithentranceslides, The WBCconsistsoffloor,lift throughout inWesternRedcedar. Both hivesarehalfsizeandmade £280.30 £105.35 £350.00 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 6 3.7 10 or officeguillotine. and old.Suppliedonamagneticsheetreadyforcuttingoutusingsharpscissors hive rooforevencarbonnet!Idealfortrainingbuddingbeekeepersbothyoung swarming. Itcanbequicklyarrangedonamagneticwhiteboard,fridgedoor, strips, coveringmanyaspectsandconditionsofbeekeeping,suchasartificial A veryeasytouseandintuitiveeducationaltool.Simple,printed,magnetic HIVE SIMULATOR ONE DAYCOURSES ieSmltr rc PackedWt. Price Hive Simulator Hive Simulator All coursesarerunby SimonCroson,BBKA For moredetails see ourwebsite Qualified Beekeeper, andareheldinour training roomandour apiaryatRand. includes atwohourpracticalsession includes atwohourpracticalsession An Introductionto An Introductionto Saturday 16thJune, Saturday 26thMay, Light refreshmentsincluded. 9.00am to5.30pm 9.00am to5.30pm or call01673 858555 Beekeeping – Beekeeping – • [email protected] –––– –––– £50.00 1.5 GGIFTSIFTS 79 NEW 0.4 2.0 0.15 0.4 0.15 0.2 0.15 0.2 0.4 0.2 0.1 0.3 0.1 0.3 0.8 0.3 0.2 0.06 0.06 £7.50 £3.40 £5.50 £3.40 £4.20 £3.20 £5.00 £7.00 £7.00 £4.50 £5.00 £6.50 £5.00 £3.50 £6.00 £9.00 £16.00 £10.00 £10.00 – THORNE BEEHIVES THORNE – [email protected] • NEW Chalkboard Magnetic List Cube Sticky Notes Wiro Book Slant Pad Mug Pen Tin Pencil Case Money Tin Torch Square Notebook Set of Boxes Little Tray Little Tin Bee Ribbon, 25 metres x 24mm Bee Ribbon, 25 metres PB Stationery Scribbler Price Packed Wt. Bee G Gifts Jotter Pad Price Packed Wt. Gifts Price Packed Wt. Packed Price Gifts x 10mm Bee Ribbon, 25 metres PB STATIONERY 25 metres yellow bee ribbon. 10mm high with bee every 30mm. bee ribbon. 10mm high 25 metres yellow 24MM BEE RIBBON 24mm high with a bee every 25mm. 25 metres gold bee ribbon. BEE G GIFTS BEE RIBBON 10MM BEE RIBBON 0.5 0.5 0.06 0.15 0.1 0.1 0.1 1.2 0.2 0.5 0.06 0.06 0.06 0.6 £0.19 £4.32 £3.99 £0.85 £0.53 £2.00 £9.00 www.thorne.co.uk www.thorne.co.uk £17.00 £10.00 £14.56 £10.00 £10.00 £10.00 £10.25 • 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Bee Pencil Photo Card 24 Bee Pens 24 Bee Pencils Greatest Beekeeper Mug Bee Pin, each Gifts Price Packed Wt. Packed Gifts Price Baby Bee Bib Gifts Price Packed Wt. Packed Gifts Price Shopping Bag Gifts Price Packed Wt. Packed Price Gifts Bee Pen Gifts Price Packed Wt. Packed Price Gifts Umbrella Gifts Price Packed Wt. Packed Price Gifts Bee Pin, 100 Baby Bee Hat Baby Bee Vest Cuddly Bee Pillow Use pins for decora tions for candles, floral tions for candles, floral Use pins for decora ments, displays, etc. arrange BEE PINS CUDDLY BEE PILLOW Blue, pink or cream bibs and hats. Cream vest with yellow trim in sizes 0/3 months and 3/6 months. BABY'S BIB, HAT AND VEST Cloth shopping bag with Belinda Bee image and the slogan Protect the Bees, Protect the Earth shown on both sides. 38cm x 40cm. SHOPPING BAG Pottery mug. A great gift. WORLD'S GREATEST BEEKEEPER BEE PHOTO CARD BEE PEN AND BEE PENCIL BELINDA BEE UMBRELLA BELINDA Belinda Bee umbrella has This bespoke of transparent plastic eight deep panels image of Belinda Bee. with the cute part to see through in There is a clear It has a black ‘U’ shaped very heavy rain! press stud fastening. handle and a 80 GGIFTSIFTS Environment 105mmdiameter. Bumper size500x100mm. SLOGAN STICKERS latest designs. Check outourwebsiteforthe kitchenware. cushions, even place mats, wrap, coasters, bags, gift journal, gif cards, notepads, updated rangeof and constantly A largevariety AC RANGE diameter. Self-adhesive vinylinthreesizes.1½”,3”and6” BELINDA BEESTICKERS A4 sheetofpeeloffselfadhesivebees. CAR /NURSERYSTICKERS Width 330mm;Pointtopoint375mm. Flying Beewithfullpollensacs. VAN DOORSTICKER CRne rc PackedWt. Price Card AC Range Bumper Sticker Gifts Price Packed Wt. Bees TeaTowel Bees TeaCosy Bees Apron Double OvenGloves Medium/Bottle GiftBag Small GiftBag Magnetic Notepad 5 Notelets Cushion Spiral Journal Sparkle Card Belinda BeeSticker,6" Belinda BeeSticker,3" Belinda BeeSticker,1 Car /NurseryStickers Van DoorSticker Enviro Sticker THORNE BEEHIVES– 01673 858555 ½ " • £12.00 £22.99 £5.00 £8.50 £9.50 £2.50 £1.60 £2.50 £4.50 £6.50 £2.20 £1.60 £1.20 £0.60 £0.45 £4.20 £6.00 £1.99 £3.24 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.1 0.2 0.2 0.2 0.15 0.15 0.15 0.15 0.3 0.3 0.1 0.1 0.06 0.06 0.06 0.1 0.25 0.06 0.1 UW RANGE Honey scentedhandsoap.100gbar. HONEY SOAP 23mm x160mm. the drips.Onehoneyservermeasures23mmx Turned beechwood.Serveliquidhoneywithout WOODEN HONEYSERVER passport. Novelty passportholder.Idealforachild’s Stick isshapedasacutelittlebee. Always handytohave-thisUSBMemory USB STICK/PASSPORTHOLDER Flexible cartoonbeeonkeyring. useful torch.Batteryincluded. Little smokeronakeyringwhichisalso SMOKER KEYRING/BENDY Honey Server,1000 Honey Server,500 Honey Server,250 Honey Server,100 Honey Server,25 Passport Holder USB Stick Bendy Keyring Billy BeePegBag Packable Bag Bees andHivesLinenTeaTowel Jobs fortheBeesPVCApron Honey Soap Gifts Price Honey Server,each Gifts Price Packed Packed Wt. Wt. Smoker Keyring Gifts Price PackedWt. Price Packed Jobs fortheBeesLinenTeaTowel UW Range Wt. • [email protected] £192.00 £102.00 £54.00 £22.80 £10.99 £12.00 £1.50 £6.00 £0.30 £2.50 £1.49 £2.99 £7.99 £4.60 £7.99 £5.99 7.5 4.5 3 1.5 0.8 0.06 0.06 0.06 0.1 0.06 0.2 0.2 0.4 0.2 0.2 0.2 CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 81 – THORNE BEEHIVES THORNE – ” 4 5.1 6.4 3.5 4.3 5.1 6.4 5.1 3.5 4.3 / ll ages. No molten wax used. Uses only wax used. Uses only ll ages. No molten 1 £8.00 £5.70 £9.50 ” longer 2 £11.30 £15.85 £13.90 £15.85 £23.15 £16.90 / 1 the finished diameter of your candle (One 16” x 8” sheet, when rolled lengthways, has a diameter of just over 1”). of square braided wick one size smaller than the diameter of your finished candle. in from one edge. turn up the edge of the wax and fold over the wick. rolling, ensuring the ends of the candle are square. If you roll out of square, simply unroll and start again. by warming the wax gently near a radiator and pressing carefully with the fingertips. Alternatively, a few small spots of wax glue can be used along the length of the edge. than the sheet and place it for at least 24 hours before use to ensure the wax is supple. sheet close to a hairdryer or radiator for a few seconds. an angle. can be achieved by dipping the tip in molten beeswax. sheets into the rolling process. [email protected] The sheets should be kept at room temperature Work in a warm room. Alternatively, hold the To make tapered candles, cut the sheet slightly at To finish the top of the candle, a pleasing effect To make candles with a larger diameter, add extra • ◆ ◆ ◆ ◆ ◆ The easiest and safest way to make beeswax candles. safest way to make beeswax The easiest and Suitable for a ROLLED CANDLES ROLLED beeswax sheets and the appropriate wick. beeswax sheets Instructions: on 1. Decide 2. Use the size 3. Cut the wick 4. Carefully 5. Begin 6. The final edge of the sheet can be secured Tips and Ideas: Violet Peach Soft Pink Berry Red Pale Green French Blue Light Brown ”. Please note that ”. Please note 4 ⁄ 3 ” x 10 4 ⁄ 3 Black Sky Blue Pale Lilac Bright Red Lime Green Olive Green Acid Yellow Salmon Pink ” x 8” and 16 0.06 0.1 0.75 1.0 1.25 1.7 0.75 1.0 1.25 1.7 1.25 16 ⁄ 7 Each www.thorne.co.uk www.thorne.co.uk Mint ” x 5”, 13 Rubine Orange Lavender Pale Blue 16 ⁄ • Dark Green Dark Brown 7 Cerise Purple Cream Chestnut Dark Red Navy Blue £16.30 Sandalwood £23.75 " Christmas Green 4 £5.85 £9.85 ⁄ " 3 4 £17.50 ⁄ £8.50 £14.30 3 £11.65 £16.40 £3.00 £9.00 " x 5" " x 8" " x 10 " x 5" " x 8" 16 16 4 ⁄ ⁄ ⁄ " x 10 7 7 3 4 16 16 ⁄ ⁄ ⁄ 7 7 3 Russet Amber Natural Burgundy Rose Pink 01673 858555 Reflex Blue Vivid Purple SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Emerald Green Wax Dye, 50g Natural 16 Cream 13 Cream 13 Cream 16" x 8" Cream 16 Coloured 16" x 8" Wax Dye, 10g Natural 13 Natural 16" x 8" Natural 13 Beeswax Sheets 10 Sheet Rate Packed Weight 100 Sheets or more (per 10 sheets) Weight Sold in packs of 10 sheets, either all the same colour or mixed. of 10 sheets, either all the Sold in packs Synthetic, granular dyes are also available in the colours. Packed in 10g pots or 50g bags. in the colours. Packed dyes are also available Synthetic, granular due to the nature of beeswax there can be shade variations. of beeswax there can due to the nature A range of coloured sheets made from pure beeswax. 16” x 8” packed in multiples of 10. Natural and Cream packed in multiples of 10. pure beeswax. 16” x 8” sheets made from A range of coloured sizes: 13 available in the following sheets are also Beeswax Sheets and Dyes Sheets Beeswax 82 CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT Not suitableforuseonaninductionhoborAga. time totime. NB: ensurewaterinjacketistoppedupfrom Complete withstainlesssteellid. water boilsthepotwillwhistlelikeakettle. wax willquicklybecomeliquid.Whenthe as required,preferablyinsmallpieces,the your hotplateorgasring.Addbeeswax side ventuntilfull,fitthecapandplaceonto 2.5kg capacity.Simplypourwaterinatthe BAIN MARIE the wax. The woodenarmholdsuptothreejigs forcooling COOLING ARM Forlargerdiametercandles, threadthewickover 4. Whenthedesireddiameter isreached,trimthe 3. Diptoreleaseairbubbles, thendipandcool 2. Adjustthecollarsfor requiredcandleheight. 1. framework. Fullyadjustable.Makescandlesupto17”high. Make 4-8candlessimultaneously.Allstainlesssteel DIPPING JIG a rigidplasticsheath. Inexpensive glassthermometerwitharangefrom-10°Cto+100°C.Suppliedin THERMOMETER handle toaidpouring. handling thistubewhenhotandfullofwaxwecanalsosupplyahandyclipon The smalltubewillworkverywellinakitchensaucepan.Toassist Medium S/Steel87mmx330mmhigh;Smallaluminium224mmhigh. Dipping tubescanbepurchasedseparately:LargeS/Steel110mmx430mm; used fordippingcandlesofdifferentsizesandcolours. dipping stainlesssteeltubes,87mmindiameterand330mmhigh.Eachcanbe The KochstarDippingStationusestheWaxMelterasitsbase.Ithassix KOCHSTAR DIPPINGSTATION Please seepage59forourrangeofKochstarWaxMelters,insertandbucket. WAX MELTING Bain Marie,2.5kg Candlemaking Price Packed Wt. Thermometer Candlemaking Price Packed Wt. Kochstar DippingStation6 Candlemaking Price Packed Wt. Cooling Arm Dipping Jig Clip onhandle Dipping Tube,small Dipping Tube,medium Dipping Tube,large 6 holelidonly every secondhook. base ofthecandlesawayfrombottomcollar. alternately. Thread thewickaroundhooksandtension. Small Tube THORNE BEEHIVES– 01673 858555 Six holelid Handle £455.80 • £26.90 £32.30 £48.00 £20.00 £27.25 £7.30 £7.50 £5.40 £9.25 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk Dipping Station6 1.5 1.1 0.1 0.1 0.5 2.5 2.5 1.3 18 1.5 flame. Canbeblendedwithparaffinwaxorbeeswax. container candles.GMfreeandburnswithabright,clean completely fromsoyabeansandspeciallyformulatedfor CB-135. Alowmeltingpoint(47°C)vegetablewaxderived CONTAINER BLENDSOYWAX dipped candles. Suitable formouldedor ivory andnatural. orange, violet,brown, yellow, green,red,pink, blocks inblack,blue, We producebeeswax BEESWAX BLOCKS Use tospraythepolycarbonateorglassmouldforeasyrelease.Seepage20. SILICONE SPRAY price tablebelowforavailablesizes. follow instructionscarefully.Usewithbeeswax,soywaxorparaffinwax.See Made fromlaboratorygradeheatproofglass.Excellentresultseverytime.Please GLASS MOULDS Soy Wax,containerblend,50lbs Coloured orIvoryBeeswax,500g Coloured orIvoryBeeswax,30g Natural Beeswax,10kg Natural Beeswax,500g Glass Mould,18" x1¼" Glass Mould,18"x1" Glass Mould,12"x1¼" Glass Mould,12"x1" Glass Mould,12"x Glass Mould,12"x¾" Glass Mould,12"x½" Glass Mould,8"x1" Glass Mould,8"x Glass Mould,8"x¾" Soy Wax,containerblend,500g Candlemaking Price Packed Natural Beeswax,30g Candlemaking Price Wt. Packed Wt. Glass Mould,8"x½" Candlemaking Price Packed Wt. Glass Mould,8"x1¼" 7 ⁄ 8 7 " ⁄ 8 " • [email protected] £120.75 £93.00 £12.60 £22.00 £18.10 £16.65 £18.45 £11.30 £10.25 £3.30 £1.40 £8.40 £1.20 £9.80 £8.75 £7.00 £9.25 £8.60 £6.90 25 0.6 0.6 0.1 13 0.6 0.1 0.8 0.7 0.5 0.5 0.5 0.5 0.5 0.4 0.4 0.4 0.4 0.4 CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 83 with Bees TS19 Textured Skep TS41 Thatched Skep TS31 Tall Hexagonal Honeycomb with Bees TS9 Honeycomb Globe Light with Bees Honeycomb TS8 Honey Bear TS40 Bee Topped 200 0.5 200 0.5 60 0.4 20 0.15 115 0.4 25 0.15 TS30 Hexagonal Bee – THORNE BEEHIVES THORNE – TS18 Large Honeycomb ½ ½ ½ ¼ ½ ½ Honeycomb TS7 Framed Skep TS39 Honeycomb Sunflower and Bee [email protected] TS29 Small Hexagonal TS17 Large Honeycomb • 165 2 300 0.75 2 300 165 80 2 80 150 2 0.45 200 150 ¾ 0.45 80 45 1¼ 50 1¾ 0.25 60 185 0.6 0.7 105 1 105 105 1¼ 120 1 0.4 0.5 88 80 2 100 1¾ 165 0.6 0.75 235 105 2 0.3 65 28 2 50 1 25 1 0.75 65 335 165 2 2 80 2 0.75 30 2 300 165 155 1 0.45 and Bee with Bees £9.25 Honeycomb £36.90 £30.75 £23.60 £23.30 £19.50 £29.00 TS38 Sunflower TS28 Tall Hexagonal TS16 Small Honeycomb Each Height Wick size Candle wt. Packed See YouTube video to make a: See YouTube side): http://bit.ly/2DLLVid has a split down one • TS mould (mould • TS mould: http://bit.ly/1voSsdo £32.30 £22.00 £22.00 £28.90 £29.75 £8.95 £16.80 £5.40 £17.45 £36.60 £20.50 £5.80 £37.60 TS Moulds TS33 TS34 TS35 TS36 TS37 TS38 TS39 TS40 TS41 TS23 TS24 TS25 TS29 TS30 TS32 TS26 TS27 TS28 TS31 TS22 TS37 Rolled Skep TS5 Bear and Smoker Belinda Bee TS6 TS27 Golf Ball and Bee TS15 Small Honeycomb candle mm inches grams Weight grams inches mm candle and Bee with Bee TS14 Woven Skep TS36 Comb Block TS4 Bear and Skep 2 TS26 Round Bee Light Skelter TS13 WBC Hive www.thorne.co.uk www.thorne.co.uk TS25 Skep and Bees TS3 Bear and Skep 1 TS35 Tapered Helter • 55 0.5 50 0.3 100 0.4 100 0.4 95 0.4 65 0.75 ½ ½ ½ ½ ½ ½ TS24 Bee Oval Bees and Skep TS12 Tree Bears Honeycomb with TS34 Small Hexagonal TS2 Bear and Honeypot 90 1 95 130 1¾ 220 1 0.65 130 1¾ 220 0.65 50 1¾ 55 0.15 0.3 30 20 75 1 60 ¾ 16 0.4 60 ¾ 16 50 1¾ 70 0.4 55 1¾ 75 0.5 50 1¾ 55 0.4 140 1¼ 130 1 0.3 60 20 45 1 1 95 1 70 1¼ 50 0.5 65 1¼ 50 0.5 65 1¼ 40 0.4 0.5 90 70 75 1 1 0.5 60 80 1 with Bees TS21 Small Button TS23 Large Button TS11 Textured Skep TS1 Bear and Comb TS22 Medium Button TS33 Small Hexagonal Each Height Wick size Candle wt. Packed £14.70 £33.25 £34.85 £14.24 £4.00 £9.43 £18.76 £18.76 £17.93 £14.86 £45.10 £12.30 and Bee

£24.00 £19.36 £12.46 £14.86 £20.00 £14.86 £20.90 £31.50 £20.50 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS

TS20 Bee Plaque TS Moulds TS6 TS14 TS16 TS17 TS18 TS19 TS20 TS21 TS9 TS10 TS11 TS12 TS13 TS15 TS3 TS4 TS5 TS7 TS8 TS1 TS2 TS MOULDS made at our branch in at Rand and carefully detailed moulds are developed These highly All are pre-holed for results time after time. moulds produce excellent Newburgh, these when pouring wax. Made to keep them erect with a wick-laying channel wicks and come will last several years. and the moulds, with care, rubber. Very easy to use from silicone TS10 Honeycomb Globe Theme Bee

candle mm inches grams Weight grams inches mm candle and Skep TS32 Tall Hexagonal Honeycomb with Bees 84

candle mm CCANDLEMAKINGANDinches LEMAgrams KINGWeight EEQUIPMENTQUIPMENT Animals TS60 TS58 TS57 TS56 TS54 TS53 TS52 TS51 TS50 TS47 TS45 TS42 TS61 TS59 TS55 TS49 TS48 TS46 TS44 TS43 TS42 FlowerwithBee TS Moulds TS55 BeeonBottle TS109 Frog THORNE BEEHIVES– 01673 858555 ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each £13.75 £25.26 £16.30 £17.30 £17.95 £16.70 £15.20 £30.35 £19.70 £16.40 £16.40 TS43 PlainwithBees £6.85 £8.66 £9.10 £6.80 £7.70 £6.07 £5.44 £6.07 £9.91 TS110 Ermintrude TS56 SmallSmoker TS101 BoyOwl 1 30 2 55 25 0.25 1 45 270 35 0.4 0.6 65 1¼55 45 ¾17 0.3 0.4 1 82 1¼80 25 0.5 115 1¼ 95 ¾ 50 0.45 0.45 95 115 1¼ 95 33 ¾ 15 0.25 1 50 290 40 0.4 1 75 2 55 170 55 0.4 0.15 1 45 1¼35 80 1 30 NEW TS45 LargeVintageSkep TS44 SmallVintageSkep S1 ilOlTS112GirlPiglet TS111 GirlOwl TS57 LargeSmoker TS102 BoyPiglet NEW ½ ½ ½ ½ ½ ½ 0.35 ½ 85 ½ 25 0.25 25 0.25 30 0.2 20 0.3 40 0.6 130 0.4 70 0.15 24 TS47 LargeWBCHive TS46 SmallWBCHive • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk Hexagonal Tealight TS103 BrownOwl TS58 Medium NEW TS49 LargeClassicSkep TS48 SmallClassicSkep TS113 Gorilla TS59 LargeHexagonal TS104 CartoonPup candle mm inches grams Weight Tea light NEW TS50 TinySkep TS114 Jungle TS107 TS115 TS110 TS108 TS104 TS62 TS118 TS117 TS116 TS114 TS113 TS112 TS111 TS109 TS106 TS105 TS103 TS102 TS101 TS63 TS Moulds £41.80 £26.85 £23.60 £16.40 £30.50 £20.50 £17.74 £12.30 £28.70 £20.39 £26.40 £12.92 £24.39 £31.37 £10.55 £34.29 £16.14 £13.32 TS60 MediumRound TS105 Daisy Tea light ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each NEW TS51 Honeycomb £21.11 £21.11 TS115 Koala Flowers 10 ¼ 5 0.6 45 0.75 1¼ 80 1¼ 30 100 0.5 75 1¼80 1 60 1 30 100 0.4 60 290 0.5 0.6 0.4 80 1¼70 100 2 75 150 90 0.3 1 90 1 800.6 115 1 55 0.6 100 95 2 95 0.3 1 70 1¼50 105 0.4 80 1¼70 80 160 0.4 0.5 60 1¼55 0.5 60 1¼55 TS61 LargeRound TS106 Dolphin TS52 HoneycombHeart • Tea light TS116 OldEnglish [email protected] NEW ½ ½ ½ ½ ½ TS107 DumpyOwl TS62 Hexacomb 20 0.5 120 0.6 120 0.5 70 0.4 65 0.75 115 TS53 LoveBirds TS117 Penguin NEW TS54 HeartwithBee TS108 ElegantCat TS118 PensiveCat TS63 Hexacomb with Bee NEW CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 85 NEW TS209 Hiker TS140 Cute Chick TS130 Sticky Bear TS150 Spiky Hedgehog NEW TS139 Hound Dog 95 0.7 115 0.75 62 0.35 70 0.4 TS208 Girl with Teddy TS149 Cuddly Penguin – THORNE BEEHIVES THORNE – ½ ½ ½ ½ NEW TS148 Mole ‘Speak No Evil’, TS129 Wise Monkey – ‘See No Evil’ ‘Speak No Evil’, TS129 Wise Monkey – ‘See No TS138 Plump Owl TS207 Farmers Wife [email protected] TS127 Wise Monkey – ‘Hear no Evil’, TS128 Wise Monkey – TS127 Wise Monkey – ‘Hear no Evil’, TS128 Wise • 30 1¾ 35 0.4 110 1 110 100 1 65 0.5 1 85 70 1¼ 90 1¾ 0.4 115 0.6 120 1¼ 120 1 105 65 45 0.6 1¼ 0.4 0.6 50 50 1 90 0.75 80 1¼ 85 0.5 0.35 26 60 1 0.35 25 45 1 0.5 45 75 50 2 1 0.6 73 50 2 0.75 65 70 2 0.4 25 55 1 70 1¾ 70 0.4 70 1 NEW £9.25 £12.16 £24.60 £11.50 £13.85 £24.40 £30.75 £33.00 £10.55 £14.71 £15.35 TS206 Farmer TS147 Unicorn TS137 Proud Cat Each Height Wick size Candle wt. Packed £36.40 £37.40 £26.34 £27.00 £14.35 £28.45 £43.80 £19.20 £16.50 TS126 Curvy Owl 3 TS Moulds TS201 TS202 TS203 TS204 TS205 TS206 TS207 TS208 TS209 TS141 TS142 TS143 TS145 TS146 TS147 TS148 TS149 TS144 TS150 TS140 TS124 Curvy Owl 1, TS125 Curvy Owl 2, TS136 Wise Owl TS146 Hedgehog 3 candle mm inches grams Weight grams inches mm candle Baby Frog TS204 Clown TS205 Face TS123 Terrier 2 TS135 Mum and TS145 Hedgehog 2 TS134 Frog TS122 Terrier 1 www.thorne.co.uk www.thorne.co.uk TS203 Chinaman TS144 Hedgehog 1 • 40 0.5 40 0.5 52 0.4 70 0.35 ½ ½ ½ ½ Pensioner TS143 Pig TS202 Chelsea TS133 Cat with Bow TS121 Teddy in Bow-Tie 65 1¼ 70 0.5 0.4 45 50 80 1 1 0.7 75 80 80 2 1 0.7 95 ¾ 60 75 1 30 0.4 30 75 1 80 1¼ 55 0.4 105 80 1¼ 50 1¼ 0.4 75 55 0.45 100 1¾ 140 1 0.8 0.75 65 70 1 75 1¼ 70 0.6 70 1 30 0.7 30 70 1 60 85 1¼ 45 1 0.5 0.6 70 80 1 0.6 70 85 1 1 100 45 0.5 150 1¼ 110 0.9 TS142 Panda TS201 Beefeater £15.60 £17.60 £32.90 Each Height Wick size Candle wt. Packed £17.60 £36.40 £35.24 £26.35 £22.35 £23.90 £20.00 £21.95 £44.95 £20.80 £51.25 £16.60 £20.40 £21.50 £17.95 £28.20 £31.00 £23.95 TS132 Nelly

01673 858555 TS119 Skippy TS120 St. Bernard

TS141 Penguin SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS TS131 Bear and Posy TS Moulds TS121 TS131 TS135 TS136 TS137 TS138 TS139 TS127 TS128 TS129 TS130 TS132 TS133 TS134 TS120 TS122 TS123 TS124 TS125 TS126 TS119 People candle mm inches grams Weight grams inches mm candle TS314 LargePineCone 86

candle mm CCANDLEMAKINGANDinches LEMAgrams KINGWeight EEQUIPMENTQUIPMENT TS305 TS301 TS225 TS224 TS220 TS217 TS213 TS211 TS210 TS304 TS303 TS302 TS223 TS222 TS221 TS218 TS216 TS212 TS Moulds TS222 FourFaces TS305 Floating TS210 Lovers Christmas THORNE BEEHIVES– 01673 858555 £17.95 £43.80 £42.24 £7.70 £9.44 £24.60 £18.45 £13.30 £17.20 £68.00 £13.40 £21.40 £35.90 ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each £11.20 £25.20 £23.75 £10.55 £22.85 TS315 SmallPineCone TS306 Madonnaand TS223 Prosperity TS211 Skull 4 2 40 0.8 130 1¾125 2 95 1 40 1 40 0.5 55 ¾16 0.4 65 1¼ 95 140 0.6 100 1 54 1 65 1 85 0.5 95 155 100 0.5 70 1 80 1 170 1 70 175 0.5 75 700.75 145 1 Child TS316 Traditional TS224 Marriage TS307 Parcel TS212 Sleep Pine Cone ½ NEW ½ ½ ½ ½ ½ ½ ½ ½ ½ 30 0.4 90 0.4 90 1 350 0.3 40 0.3 40 0.5 65 0.5 65 0.55 80 1.3 155 0.6 140 • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk TS317 FatherChristmas TS213 TheKiss TS225 Gnome TS308 Santa NEW Christmas TS309 ChristmasTree TS318 IcedChristmas TS216 Two-faced candle mm inches grams Weight Pudding TS317 TS316 TS315 TS314 TS308 TS306 TS322 TS321 TS320 TS319 TS318 TS313 TS312 TS311 TS310 TS309 TS307 TS Moulds £34.60 £22.00 £35.90 £46.10 £7.20 £6.85 £7.20 £23.00 £20.50 TS319 SmallChristmas £34.70 £24.60 TS310 Snowflake TS217 ValleyGirl TS301 Bell1 ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each Tree £23.40 £11.00 £12.50 £11.70 £9.25 £9.85 40 1 20 0.3 0.5 35 2½65 58 1 26 0.4 70 ¾25 0.35 0.35 60 1½70 1 60 126 0.35 110 1 70 1 125 2 90 0.3 25 1¾30 0.3 25 1¾35 30 235 0.3 900.5 115 2 500.75 1 150 1 60 0.4 60 1¼40 TS320 Snowman TS218 Warrior TS302 Bell2 TS311 Holly • [email protected] TS312 SmallPoinsettia TS321 LargePonsettia TS220 PrayingHands ½ ½ ½ ½ ½ TS303 Christmas 135 0.75 135 0.6 90 0.8 140 0.8 210 0.5 70 TS322 TinyChristmas TS313 SantaHead TS221 Ghost TS304 Decorated Christmas Tree Tree CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 87 TS415 Castle TS525 Russian TS508 Decorated Stick TS524 Ribbed 80 0.5 200 0.6 60 0.9 60 – THORNE BEEHIVES THORNE – TS507 Candle Stick ½ ½ ½ TS414 Telephone Box TS405 King Tut’s Coffin TS406 King Tut’s Mask Pyramid Pyramid [email protected] TS506 Cone • TS404 Eiffel Tower TS413 Seated Chief TS520 Small Stepped TS519 Large Stepped 90 1¼ 65 0.4 260 1¼ 135 1.1 160 ¾ 120 50 1¼ 110 90 0.75 1¼ 0.6 55 60 2 45 1¼ 50 0.4 0.6 75 0.4 55 80 1 2 77 ¾ 30 0.5 77 ¾ 30 0.3 25 45 1 100 1 65 0.4 80 1¾ 80 0.75 0.5 95 ¼ 25 1 150 50 0.75 1 105 60 0.4 260 115 1 80 0.5 £7.70 £15.90 Each Height Wick size Candle wt. Packed TS412 Pisa TS502 Banana 1 TS403 Cleopatra TS518 Small Scent TS517 Large Scent £42.10 £26.24 £19.15 £59.00 £28.00 £24.25 £17.20 £23.60 £14.50 £16.90 £17.80 £18.74 £37.60 £17.84 £49.70 £25.10 TS Moulds TS515 TS516 TS517 TS518 TS519 TS520 TS524 TS525 TS419 TS502 TS506 TS507 TS508 TS509 TS510 TS514 TS418 TS512 candle mm inches grams Weight grams inches mm candle TS402 Bricks TS516 Small Obelisk TS515 Large Obelisk TS411 Ornate Pyramid Decorative Shapes TS514 Lantern TS419 Oriental Scene TS410 Macchu Picchu The World www.thorne.co.uk www.thorne.co.uk • 45 0.4 240 0.75 115 1 75 0.5 75 ½ ½ ½ ½ TS409 Lima TS325 Angel TS418 Dragons TS512 Herringbone 75 1 25 0.5 25 75 1 0.5 100 110 1 90 1¼ 75 0.4 110 ¾ 105 100 1 40 0.6 35 ¾ 0.6 60 0.5 95 ½ 65 0.5 95 ½ 65 75 1¾ 80 0.6 85 1 115 ¾ 105 25 150 0.6 1 60 2 165 2 180 1.3 180 165 2 0.25 22 50 1 105 0.5 90 90 1 1¼ 85 0.45 90 2 130 135 1¼ 0.8 55 1.2 TS408 Liberty TS417 Pagoda TS324 Small Snowman £19.70 £21.85 £71.00 £10.25 £20.50 £13.30 TS510 Dipped N’Carve Each Height Wick size Candle wt. Packed £15.30 £27.70 £25.50 £39.80 £52.70 £20.30 £24.80 £16.50 £31.70 £20.40 £43.40 £27.14 £45.30 Tree 01673 858555

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS TS407 Letterbox

TS Moulds TS408 TS410 TS411 TS412 TS413 TS414 TS415 TS416 TS417 TS406 TS407 TS409 TS324 TS325 TS402 TS403 TS404 TD405 TS323 TS323 Large Christmas TS416 Lighthouse candle mm inches grams Weight grams inches mm candle TS509 Diamond Faces 88

candle mm CCANDLEMAKINGANDinches LEMgrams AKINGWeight EEQUIPMENTQUIPMENT TS526 SaltandPepper TS546 TS545 TS544 TS542 TS540 TS538 TS537 TS536 TS535 TS534 TS533 TS532 TS530 TS529 TS526 TS547 TS543 TS539 TS Moulds TS548 FlowerBlock TS538 Rose TS557 Dice THORNE BEEHIVES– 01673 858555 £37.34 £36.90 £19.34 £18.00 £18.25 £25.85 £6.40 £21.74 £23.40 £6.90 £37.50 £36.60 £29.00 £26.24 £32.80 £23.15 £10.55 ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each £19.00 S5 cd Cupcake TS558 Iced TS539 Pineapple TS549 Cupcake TS529 Textures 10 2 120 1 70 0.4 67 770.4 1¼ 110 1 0.5 100 150 1¾ 75 1 75 0.25 37 1¼33 2 85 150 0.50 30 0.3 25 1¾30 0.6 65 100 2235 0.7 0.7 ¾ 100 1¾200 0.55 155 145 1¾ 90 650.6 130 1 0.5 140 650.4 1¾ 110 1 85 0.3 65 1¼60 S4 ml oeTS542Valley TS540 SmallRose TS559 Faberge TS530 Turkish TS550 Celtic ½ ½ ½ ½ 420 0.8 420 0.75 77 0.5 100 0.5 60 • TS532 Violin THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk TS560 Contemporary TS551 Hug Hexagon TS561 LargeSunflower TS543 RoseColumn TS533 FlameBurst candle mm inches grams Weight TS552 KrissCross TS550 TS554 TS548 TS553 TS552 TS551 TS549 TS Moulds TS560 TS558 TS557 TS565 TS564 TS563 TS562 TS561 TS559 TS556 TS555 TS534 LampShade £12.80 £11.45 £14.24 £8.54 £13.45 £39.80 £26.50 TS544 Pendant TS562 Poppy ah egt iksz Cnl t Packed Candlewt. Wicksize Height Each £25.80 £23.60 £21.50 £24.50 £19.00 £31.15 £13.50 £21.10 £35.80 £6.85 £7.95 TS553 Stripes 10 ¼ 5 0.3 95 1¼ 0.3 100 130 1¾ 85 0.25 125 2 65 ¾ 40 0.4 30 55 145 2310 0.8 2 1 25 2 30 2 30 2 30 2 30 1 140 1 100 2240 0.6 0.4 65 110 1¾ 50 0.25 45 1¾50 2 75 1 110 TS563 LargeDaisy TS554 Manhatten TS535 Petals TS545 Grip • [email protected] TS555 ScaryPumpkin ½ ½ ½ ½ ½ ½ ½ ½ ½ ½ TS546 BubbleCube TS536 FleurdeLys 55 0.3 210 0.75 210 0.6 145 TS564 Dahlia 200 0.5 35 0.3 60 0.5 65 0.5 50 0.5 65 0.5 70 0.3 TS565 SmallSunflower TS556 SmallPumpkin TS547 TrafficLights TS537 SmallDaisy CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 89 TS629 TS605 Shell TS638 Cracked TS616 Slim Column L TS618 Slim Column S TS617 Slim Column M TS628 Hexagonal 50 0.3 130 0.35 80 0.2 85 0.35 TS604 Polygon TS637 Scooped – THORNE BEEHIVES THORNE – 40 0.8 40 30 0.75 30 0.5 30 TS613 Fat Column L TS615 Fat Column S ½ ½ ½ ½ TS614 Fat Column M ½ ½ ½ TS627 [email protected] TS636 Golf Ball • TS603 Plain Pyramid TS612 Fluted Triangle 190 ¾ 245 40 ¾ 245 0.6 230 1¼ 160 1.4 75 ¾ 1.2 75 240 0.8 150 ¼ 65 1 15 0.15 65 25 20 2 0.7 2 30 2 195 125 50 1¼ 55 0.3 80 105 1¾ 155 1 0.6 0.7 220 115 2 0.75 300 140 2 75 1¾ 160 180 0.75 ¾ 200 50 ¾ 0.6 37 0.6 Each Height Wick size Candle wt. Packed TS635 Egg TS602 Fat Taper £44.85 £37.60 £46.60 £77.40 £49.45 £38.00 £12.50 £14.75 £4.50 £14.75 £38.15 £25.10 £12.30 £15.90 £30.25 £25.00 £17.70 £18.20 £35.65 £39.70 TS636 TS637 TS630 TS631 TS632 TS633 TS635 TS638 TS622 TS623 TS624 TS625 TS626 TS627 TS628 TS629 TS634 TS620 TS621 TS Moulds TS619 candle mm inches grams Weight grams inches mm candle TS625 TS626 Rings TS634 Trio TS601 Buttress TS610 Fluted Heart TS611 Star TS609 Heart TS624 Large Plain TS622 Small Plain, TS633 Tight Twist TS623 Medium Plain, 65 0.45 25 0.2 190 0.6 Plain Plain Shapes www.thorne.co.uk www.thorne.co.uk •

40 0.7 40 0.5 55 0.9 50 0.8 45 0.6 30 35 0.4 35

½ ½ ½ ½ ½ ½ ½ TS621 Votive TS568 Segments TS632 Tall Twist 2 TS608 Tapered Triangle 240 1 110 0.8 1 110 240 1 205 95 0.75 1 145 65 0.55 240 205 145 60 2 170 145 1¾ 155 100 0.6 0.6 125 0.25 20 ¾ 20 0.25 20 ¾ 20 0.35 20 ¾ 20 0.25 20 ¾ 20 40 1 30 1¾ 65 3 95 120 1 55 0.6 75 1¼ 70 0.75 50 2 100 0.5 TS631 TS620 Household TS607 Tapered Rings TS567 Medium Dahlia £7.70 £21.00 £29.20 Each Height Wick size Candle wt. Packed £30.25 £39.20 £26.50 £48.60 £41.80 £15.00 £10.15 £43.75 £27.14 £23.84 £10.00 £9.25 £37.25 £23.60 £31.30 £29.30 £17.40 £21.70

TS630 01673 858555 TS619 Spiral

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS TS606 Slim Taper TS566 Camper Van TS567 TS568 TS614 TS615 TS616 TS601 TS606 TS607 TS608 TS609 TS610 TS611 TS612 TS613 TS617 TS618 TS603 TS604 TS605 TS602 TS Moulds TS566 candle mm inches grams Weight grams inches mm candle 90 CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT Instructions foruseasglassmoulds. Each mouldissuppliedwithaneedlefortensioningthewick. Strong, crystalclearplasticmouldsfromSwitzerland. POLYCARBONATE MOULDS Church Mould Arch Motif Sphere THORNE BEEHIVES– Triplet 01673 858555 Cross Swirl Star ShapedCone Stepped Church Candles Twist Egg Flame Square Skep withBees 6 PointStar Rhombus Cylinder Candles Oval Discus Pyramid • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk Staggered Oval 12 PointStar Opening Bud Large Penta Fir Tree Hexagon Cone New additionstoourrangeofPolycarbonateMoulds. POLYCARBONATE MOULDS Double Spiral Double Arch Sugar Loaf Heart Straight 1,2,3,4,5and6 Wave Stepped Pyramid Trapezoidal Arch Marguerite Heart Motif Triangle • [email protected] Square Lantern Parallel Flourish Spiral Pyramid Twin Peaks Futura Steps Ray Round Lantern Saddle ShapedOval Tubular Heart Block Dome Waterlily CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT 91 Star Fish Triangle 0.4 0.06 0.2 0.06 0.2 0.06 0.2 0.06 0.3 0.06 0.3 0.06 0.3 0.06 0.3 0.06 0.2 0.15 £0.83 £7.40 £1.20 £1.40 £1.60 £3.50 £4.00 £4.00 £0.96 £8.40 £4.00 £20.00 £10.90 £14.75 £14.75 £30.40 £35.00 £35.00 – THORNE BEEHIVES THORNE – Sun Duck Flame Bee [email protected] Ship Heart • Nit-lite Flower Hexagon Maple Leaf Cotton Wick, No. 0, ¼"; 1, ½"; Cotton Wick, No. 0, ¼"; 1A, ¾"; or 2, 1"; 50 metres or Cotton Wick, No. 3, 1¼"; 4, 1½"; 5 metres or Cotton Wick, No. 3, 1¼"; 4, 1½"; 50 metres or Cotton Wick, No. 5, 1¾"; 6, 2"; 5 metres Cotton Wick, No. 5, 1¾"; or 6, 2"; 50 metres Cotton Wick, No. 7, 2½"; 5 metres Cotton Wick, No. 7, 2½"; 50 metres Cotton Wick, No. 8, 3"; 5 metres Cotton Wick, No. 8, 3"; 50 metres Cotton Wick, No. 9, 3½"; 5 metres Cotton Wick, No. 9, 3½"; 50 metres Cotton Wick, No. 10, 4"; 5 metres Cotton Wick, No. 10, 4"; 50 metres Zinc Cored Wick, any size, 5 metres Zinc Cored Wick, any size, 50 metres Candlemaking Price Packed Wt. Packed Candlemaking Price Mould Holder Candlemaking Price Packed Wt. Packed Candlemaking Price Mould Tray for Floating Candles, Any design Candle Wick 1, ½"; Cotton Wick, No. 0, ¼"; 1A, ¾"; or 2, 1"; 5 metres Price Packed Wt. MOULD HOLDER FLOATING MOULDS are very easy to use and Also made in Switzerland, these clear plastic trays hard wearing. 25 and 30g approx. Each tray has six cavities producing a candle between What a superb idea. This plastic frame will hold four polycarbonate moulds and allows the candles to be rotated on their axis and held at an angle. Great for layering different colours at different angles. Suitable for all waxes and ideal for night-lites waxes and ideal for night-lites Suitable for all core. Four because of its rigid and wick sustainers in 5m or 50m lengths. 1-1.5”, sizes available 2.5-3”. 1.5-2”, 2-2.5”, ZINC CORED WICK ZINC NB Bees do not float. 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 0.4 £13.32 £13.59 £14.00 £12.69 £12.00 £15.65 £13.59 £13.59 £14.12 £13.80 £17.00 £13.59 £12.03 £10.22 £12.69 £12.03 £10.22 £15.65 £12.03 £12.03 £15.06 £15.18 £10.80 £11.51 £12.12 £11.51 £11.51 £10.22 £9.71 £7.92 £11.59 £12.03 £8.41 £7.92 £10.80 £10.22 £8.41 £9.72 £11.00 £12.50 £12.69 £12.69 £12.00 £12.00 £13.59 £13.59 £11.10 £15.18 £13.59 £14.12 £13.55 £12.69 £12.69 £12.00 £14.00 £11.51 £12.03 £12.03 £15.65 £15.65 £15.65 £13.59 £10.22 £10.22 £11.51 £7.92 £13.59 £15.18 £15.18 £15.18 £9.04 £9.72 £10.80 £8.41 £9.71 www.thorne.co.uk www.thorne.co.uk • 01673 858555 ”, 3”, 3½”, 4” diameter. All

SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Ray 85x41 100 3” 100 Double Arch Trapezoidal Arch Parallel Flourish 190 78 270 3” 170 203 Saddle Shaped Oval 210 Pyramid 200 Double Spiral 77x44 85x41 85x50 Heart Motif 75x40 80x50 Spiral 320 190 375 Tubular Heart 320 330 Stepped Pyramid 130x65 182 2” Ray 220 2” 210 2” 2½” 77x52 850 87x70 70x60 375 2½” 360 450 2½” 2½” 3” Heart 50 105x107 200 4” 200 1½” 105x107 1000 2½” 2½” 300 300 80 Heart 50 150x40 Marguerite 40 70 Twin Peaks 2” Waterlily 40 2” Wave 190 Square Lantern 220 370 Round Lantern 400 Straight 1 135 82x40 2” Straight 2 135 125x125 2” Straight 3 2” 50x75 500 1800 Straight 4 130 220 50x70 360 150 Straight 5 350 200 Straight 6 2” 4” 1600 250 Steps 180 22 75x45 40x100 300 Block 210 22 95x45 300 4” Sugar Loaf 22 470 Triangle 200 75 22 100 Futura 215 28 125 Dome 170 28 205 ¾” 150 ¾” 190 80x60 ¾” 300 ¾” 1¼” 530 1¼” 2½” Cross 160 40x40 175 1½” 2½” 175 1½” 225 1½” 300 1½” 40x40 85 215 55x35 300 65x40 Cross 160 Penta 2” 75 240 80 175 Stepped 225 Rhombus 225 60x36 Large Small penta Swirl Twist Oval 220 125 Staggered Oval Triplet 75 220 Star Cone 75 Skep with Bees 57 340 2” 220 60x40 Opening Bud 130 70 108 Arch Motif 300 200 Flame 1½” 140 Discus, Small 75 180 Discus, Large 1½” 100 115x50 70 110 2” 170 135 Fir Tree 100 2½” 390 200 80x50 290 140 105x56 370 147x60 2½” 2” 2” 300 150 400 2” 100x40 2” 2½” 700 1½” Cone 140 60 125 1½” 1½” Cylinder 5 55 400 2” 245 125 Cylinder 6 Hexagon Square 1 60x60 170 60 220 Square 2 220 Square 3 2” 65 140 65 Pyramid 230 47 2 Cone 140 67 160 Sphere 1 220 365 Sphere 60x60 220 740 Sphere 3 50x50 Sphere 4 38x38 560 1¾” Flat Sphere 500 2½” 80 Egg, Small 310 2” Egg, Medium 100 2” 80 Egg, Large 120 1½” 60 Star, 6 point 100 96 65 Star, 12 point 120 260 125 135 510 200 70 45 200 2½” 880 200 100 55 4” 350 55 100 4” 4” 1025 230 2½” 1½” 230 4” 1½” 1½” Church 3 4 50 270 2” 140 Church 2 5 60 425 2” 2” 50 180 155 95 Church 60 550 2” 200 Church 1 Church 2 Church 6 60 300 2” 65 110 Cylinder Cylinder 45 Cylinder 3 Cylinder 4 185 100 70 120 130 1½” 70 690 80 2½” 450 635 2½” 2½” Moulds candle mm mm grams inches Weight inches grams mm mm Polycarbonate candle Moulds Church 1 Height 125 Base/Dia Candle wt. 40 Wick size Price 150 Packed 1½” sizes are in lengths of 5 metres or 50 metres. In 12 sizes for candles of ¼”, ½”, ¾”, 1”, 1¼”, 1½”, 1¾”, 2”, 2½ CANDLE WICK COTTON WICK 92 CCANDLEMAKINGANDLEMAKING EEQUIPMENTQUIPMENT candles. wick firmlyinplacewhenproducingmoulded Use thesesmallwoodenclipsforholdingthe WICK HOLDER deviations incolourshadeispossible. packs of5thesamecolour.Eachsheetmeasures200x1000.5mm.Slight Thin waxsheetsin30colours.Availablepacksof12assortedcoloursor APPLIQUE WAX candle. Thewidthofonesustaineris15mm. keep thewickinplaceatbottomofanightlight Use thesesimplediscswithsmalltubeforthewickto WICK SUSTAINERS high. Usewithwicksustainers. Clear strongglassnightlightholder.40mmdiameterx17mm GLASS NIGHTLIGHTHOLDER approx. 40mmacross.Usewithwicksustainers. Lightweight aluminiumnightlightholder.14mmdeep HEART SHAPEDMETALNIGHTLIGHTHOLDER 17mm high.Usewithwicksustainers. Lightweight aluminiumnightlightholder.37mmdiameterx ROUND METALNIGHTLIGHTHOLDER 16 cavitiesinthisplasticmould. NIGHT-LITE CANDLEMOULD WICK GRIPPER WICKING NEEDLE time. 375mmlong. spring loadedactiongripstimeafter from insideatallcandlemould.Verystrong This superlittlegadgetisgreatforgrippingwick latex orglasscandlemoulds. A 6”steelneedleforthreadingwickthrough Night-lite CandleMould Candlemaking Price Packed Wt. Wick Holder Candlemaking Price Packed Wt. Wick sustainers,100 Wick sustainers,25 Glass nightlightholder Heart Nightlightholder,50 Heart Nightlightholder,each Round Nightlightholder,50 Round Nightlightholder,each Wick Gripper Wicking Needle kn amn e Pn Pn re Cream Light Purple Black Maize Yellow-Green Blue Violet PineGreen Sun-Yellow Natural Ultramarine Grey Lilac Pink Lemon Yellow White CarmineRed Wine-Red Gentian Skin THORNE BEEHIVES– 01673 858555 • £10.80 £1.00 £0.30 £0.43 £3.33 £0.10 £3.33 £0.10 £8.00 £1.40 £0.40 THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk 0.25 0.06 0.06 0.5 0.06 0.5 0.06 0.3 0.1 0.06 0.06 BOOKS in 250gbags. colour, burningtimeandstrength.Generallyusedinquantitiesof2.5%.Packed Add toparaffinwaxforcastinginflexiblemoulds.Improvescandleopacity, VYBAR be usedwhencastinginrubberorlatexmoulds.Packed500gbags. should beusedmayvaryfromapproximately5%to30%.Howeveritnot amount ofsmokeproducedbythecandleflame.TheStearinwhich brittle. Itimprovesthecastingandburningcharacteristicsthusreducing more opaque.Itformsacrystallineframeworkwithinthewax,makingitless Add toparaffinwax.ThefunctionofStearinisthreefold.Itmakesthecandle STEARIN into packagingandusingasamouldseal. Very stickyandsoftparaffinwaxin50gblocks.Forfixingcandles WAX GLUE completely foraglossfinish.500mlbottle. clear lacquer.Foramattfinish,usebrushordipthecandle Prevent bloomandkeepyourcandlesfreshbyusingthis LACQUER and 30mmindiameter. Both labelsareselfadhesive L11 ANDL17LABELS your hobby. assist youin books to A rangeof L.17 Labels,100 Vybar Pack of12sheets,assorted Making Candles,20create Candlemaking theNaturalWay Candlemaking, 10projects Beeswax Alchemy Candles (Stavert) Stearin Candlemaking Price PackedWt. Price Packed Pack of5sheetsonecolour Applique Wax Wt. Lacquer Candlemaking Price Packed L.11 Labels,100 Candlemaking Price Wt. Packed Wt. Price Packed Making CandlesandSoapsforDummies Candlemaking Books Wt. Wax Glue uk ik ih re Mca rneGl Aluminium-Silver Bronze-Gold LightRed Mocha Red-Brown LightGreen LimeGreen Dusky Pink CarnationPink Orange • L11 [email protected] £12.99 £16.00 £13.99 £14.50 £6.00 £3.60 £9.00 £4.20 £4.30 £2.32 £2.32 £8.99 £5.99 £9.99 0.3 0.6 0.4 0.2 0.1 0.06 0.06 0.2 0.6 0.2 0.5 0.4 0.6 0.6 L17 HHOWOW TTOO OORDERRDER 93

s. 0.00 logue [email protected] United Kingdom, ROW e delivery address eliveries. For large THOUT NOTICE. New Zealand – THORNE BEEHIVES THORNE – thin 10 days of delivery. d “unexamined” – deleting the words “in good [email protected] • . BY TELEPHONE HOW TO ORDER HOW www.thorne.co.uk www.thorne.co.uk www.thorne.co.uk CARRIAGE PAID ORDERS CARRIAGE PAID • Orders sent overseas are all sent by air and should arrive in a few days. If the goods are bulky and lightweight, the Orders sent overseas are all sent by air and In the UK, goods will be delivered by our own transport or road carrier, or for small items by post. We use a next day carrier In the UK, goods will be delivered by our own You can order online – www.thorne.co.uk; by telephone in working hours 01673 858555 and by post. 01673 in working hours by telephone – www.thorne.co.uk; online can order You V.A.T. inclusive prices are calculated at the current rate of 20%. ALL PRICES IN THIS LIST ARE NECESSARILY SUBJECT TO CHANGE WI V.A.T. inclusive prices are calculated at the current rate of 20%. 0.1 2.50 2.50 2.50 4.50 4.50 4.50 4.50 4.50 3.50 3.50 3.50 5.00 0.06 5.25 5.25 5.25 5.25 5.25 0.25 3.00 3.00 3.00 5.00 5.00 5.00 6.50 0.5 3.50 3.50 3.50 7.00 7.00 7.00 7.00 7.00 13.00 7.50 7.00 7.50 9.00 2.00 10.00 10.00 9.00 9.00 9.00 9.00 0.75 3.50 3.50 3.50 9.00 9.00 1 2.00 1.25 4.00 4.50 4.00 4.50 4.00 10.00 10.00 10.00 10.00 10.00 11.00 2.00 4.50 12.00 12.00 12.00 12.00 12.00 10.00 11.00 14.50 1.5 14.50 12.00 14.50 17.50 5.00 5.00 2 5.00 13.50 13.50 13.50 13.50 13.50 17.50 13.50 20.00 20.00 4.00 6.00 6.00 6.00 17.00 17.00 17.00 17.00 17.00 20.00 17.00 25.50 25.50 4.00 3 4 4.00 5 8.50 4.00 6 8.50 7 13.25 4.00 8.50 8 13.25 13.25 8.50 9 13.25 3.00 13.25 8.50 10 18.50 13.25 13.25 8.50 15 3.00 18.50 13.25 18.50 13.25 8.50 20 18.50 13.25 8.50 18.50 13.25 3.00 25 22.50 18.50 13.25 8.50 18.50 13.25 30 13.25 22.50 18.50 4.00 8.50 22.50 18.50 13.25 13.25 22.50 18.50 13.25 8.50 22.50 18.50 42.00 13.25 25.00 18.50 8.50 17.00 22.50 18.50 42.00 18.50 13.25 25.00 53.00 17.00 25.00 18.50 13.25 42.00 20.00 25.00 57.25 18.50 21.00 25.00 23.00 42.00 20.00 25.00 21.00 60.50 20.00 25.00 25.00 42.00 25.00 21.00 40.00 63.50 20.00 25.00 28.00 21.00 42.00 25.00 43.00 25.00 50.00 67.75 30.00 30.00 42.00 25.00 48.00 25.00 32.00 55.00 72.00 42.00 32.00 40.00 52.00 25.00 60.00 77.50 42.00 35.00 40.00 55.00 81.50 40.00 65.00 42.00 38.00 100.00 60.00 40.00 40.00 70.00 70.00 122.00 45.00 63.00 75.00 70.00 66.00 138.00 50.00 80.00 85.00 159.00 55.00 85.00 100.00 115.00 60.00 120.00 140.00 130.00 160.00 180.00 UK Mainland Northern France Italy Sweden Latvia Latvia Sweden Italy France Northern Bulgaria Mainland Hungary Northern UK Scotland of USA Australia Channel Ireland Rest excluding Lithuania Spain Finland Germany Weight Northern Isle of Man Islands Ireland Belgium Czech Rep Poland Romania Europe Canada 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS All glass jars are sent at consignees risk. We regret neither ourselves nor the carrier can accept responsibility for breakages All glass jars are sent at consignees risk. We regret neither ourselves nor the carrier can accept responsibility N.B. On receipt of your order, please check the goods thoroughly. Ensure any consignment note from the carrier is clearly marke N.B. On receipt of your order, please check the goods thoroughly. Ensure any consignment note from the You can pay either by Paypal, credit card or debit card. You can see details of local and national beekeeping courses and event courses local and national beekeeping can see details of You debit card. or card credit can pay either by Paypal, You download our cata assembly instructions, special offers, also new products, sites, lots of links to useful beekeeping are There changes to show how your hive will look. changes to show how and just send us the information a course, organising If you are to your screen. your postcode and these will pop on enter Just list. we’ll put it on to the for beginners. or find information must be advised wi condition”. We regret we cannot replace any damaged goods unless this has been done. Shortages and breakages On the site, you can “Build your own National hive” – making your choice of each hive part and frame. As you do it, the picture As you do it, and frame. – making your choice of each hive part “Build your own National hive” can you On the site, Carriage Overseas – are carriage free. The exceptions to this are glass honey containers and Ambrosia. and honey containers glass exceptions to this are The free. carriage are most of the time. If not, it is advisable to use a business or work address for d has someone to receive and sign for the goods and the Scottish Highlands, there may be a higher carriage charge. items to Northern Ireland, Offshore Islands If you live in a remote area, there may be an additional charge. Please contact sale carriage may be more than the table below. for a quotation. is £100.00. the carriage free value placed online, excluding the Channel Islands. If orders are Orders to the value of £200.00 and over (excluding Ambrosia and Glass Honey Jars) are sent carriage paid to any address in the Orders to the value of £200.00 and over (excluding for goods with a packed weight of over 2kgs. This applies only to England, Wales and Southern Scotland. Please try to ensure th for goods with a packed weight of over 2kgs. Carriage/Delivery – For ease and speed, you can order from our website 24/7. If you live in the UK (excluding the Channel Islands), orders over £10 orders Islands), UK (excluding the Channel If you live in the our website 24/7. from you can order ease and speed, For Cheques should be made payable to E. H. Thorne (Beehives) Ltd. Payment can be made by Cheque, Postal Order, Cash, Mastercard, Visa or Maestro. and Scottish Luxembourg Denmark Greece Estonia Estonia Greece Denmark Luxembourg Slovakia Scottish and Islands Scotland Scilly Isles Netherlands Austria Portugal Slovenia Japan 94 BBRANCHESRANCHES SATURDAY, 9a.m.to 4.00p.m. CHILBOLTON DOWNFARM, DOWN, STOCKBRIDGE,HAMPSHIRE,SO206BU SATURDAY, 9a.m.to12noon THORNE BEEHIVES– BANK HOLIDAYS-CLOSED 01673 858555 BANK HOLIDAYS-CLOSED BANK HOLIDAYS-CLOSED TUESDAYSATURDAY, TO MONDAY TOFRIDAY, OPENING HOURS NEWBURGH INDUSTRIALESTATE,CUPARROAD,NEWBURGH,FIFE,KY146HA TUESDAY TOFRIDAY, OPENING HOURS OPENING HOURS APRIL toSEPTEMBER 10 a.m.to5p.m. BANK HOLIDAYS-CLOSED TUESDAY TOSATURDAY, APRIL toAUGUST 9 a.m.to5p.m. 9 a.m.to5p.m. OPENING HOURS OAKLEY GREENFARM,GREEN,WINDSOR,BERKS,SL44PZ 10 a.m.to5p.m. ABOUT THEBRANCHES THORNES OFSTOCKBRIDGE THORNES OFSCOTLAND Tel.: 01264 810916 [email protected] THORNES OFWINDSOR Tel.: 01337 842596 [email protected] Tel.: 01753 830256 [email protected] • THE COMPLETEEQUIPMENTSUPPLY COMPANY www.thorne.co.uk Stockbridge Entrance to Thornes of Windsor marked by awhitebeehive Salisbury Entrance toThornesofWindsor Southampton A913 marked byawhitebeehive Andover M90 andPerth Bristol Maidenhead A30 Twyford Bristol Twyford Maidenhead Lion Red Lion Red M4 B3024 M4 A3057 A308 A3057 Office Post Office Post A308 B3024 Newburgh High Street Oakley Green Oakley Green Oake Green THORNES OF Green Oake Garden Centre WINDSOR Garden Centre THORNES OF A30 Stockbridge Firth of Firth Tay SCO London TLAND School • Leckford Hut

Restaurant [email protected] A308 Station Filling Station Filling A308 Slough From theA355turn left downsliproad Slough beneath flyover Town Centre to roundabout A355 A355

Windsor

STOCKBRIDGE

THORNES OF C

e

m 6

Cupar ete 6

r y From the A355 turn left down sliproad London Town Centre beneath flyover to roundabout B3420 Windsor A913 Winchester Dundee A272 IINDEXNDEX 95 Straining cloths Straining 32 Straps Straw skep 68 Sublimox Sugar dusting equipment Sulphur Burner Sulphur strips Super Loupe Supers 44 catcher Swarm 67 lure Swarm trap Swarm 68 Syringes 26 ambrosia Syrup, 66 66 see hive pages 36 26 26 26 70 X XP & XP Plus Excluder Z Zinc cored wick 6 91 U Gloves Ultra Tuff Umbrella 79 Uncapping 37/38 Uncapping forks Uncapping knifes Uncapping roller Uncapping trays Unimel 40 Unique labels 35 Uniting Board Universal extractors Utility Uncapping Knife 37 37 V 37 Veil and Jacket Value 38 44 Valves door sticker Van 68 Vapmite 37 39 52 Easy Check Varroa 34 25 WBC Floor, Varroa screen Varroa vaporiser Varrox 34/35 Veils Clothing Ventilated 36 Ventilator 80 40 Versomel 67 VF Mini strainer 11 hive Virtual Vybar 92 66 68 W 33 charts Wall cabinet Warming kit Warming hive Warnholz hive 43 Warre bane Wasp 72 Waspinator 75 Out Wasp Feeder Water cell cup mould Wax 46 dye Wax 77 extractors Wax 46 glue Wax 64 melter insert Wax moulds Wax 15 WBC cone escapes 72 WBC hives 63 Wick 91 71 25 Wick gripper Wick holder 59 Wick sustainers 59 Wicking needle 81 Wide ends 31 92 Wildflower seeds 61 Wire crimper Wire excluder cleaner 11/12 Wire for frames Wire Queen Excluder 92 chip Wood 92 92 cell cups Wooden see hive pages 92 Stain Wood 36 28 24 16 16 63 29 8 T top adaptor Table top extractor Table labels Tamper cage Tangential 43 Tanks strainer Tap honey Taster, Towel Tea 39 plus Tetra 39 stem Thermometer, wax Thermometer, uncapping tray Thermostatic 54 42 extractors Thomas uncapping equipment Thomas crystals Thymol 43 frame Thymol 38 57 honey signs Timber 38 TJ Cupkit 82 80 fasteners Toggle 38 caddy and scrap wax Tool 41 Grip Tool Roll Tool Bar Hive Top 67 box of tricks Trainers 57 28 16 Transformer 67 box Travelling screens Travelling 32 32 Triangles 64 bottle Trickle 57 Trilby 78 34 Trousers 27 honey Trowel, 15 TS Moulds 27 escape Tunnel 32 and mark cage Turn 26 62 Tweezers 65 Twinstock lids Twist 68 45 62 83-89 31 56 – THORNE BEEHIVES THORNE – [email protected] • Pen 79 Pen 79 Pencil PET jars cuddly bee Pillow, Plastic ends Plastic Foundation Pots Polish Plastochrome gloves nails frame Pliers, labels Polish mesh Pollen Picker Pollen 79 strip Pollen 18 traps Pollen 56 moulds Polycarbonate 35 24 Quilt Polycarbonate and feeder Polynuc 16 60 Bee escapes Porter aid Pouring Inverter Power 52 90/91 Premier foundation 58 Presentation racks 58 Press bags 30 58 Press in cage 58 66 45 Propellors 30 Propolis remover Propolis screens honey Pump, 17 roof metal Punch, 68 44 55 45 62 58 58 16 41 S Safety kit honey Scoop, Screens 42 Screw lids Secrets of the beehive Section cases Section dividers Section racks Section showcase Sections 23 Seeds 36 77 45 Serrated Uncapping Knife 69 SHINS (Sustainable Hive Insulation) Shopping bag Showcases 57 56 7 56 23 Silicone foundation press Silicone spray 57 37 23 Simple syringe Sit-step-store 36 26 Skep Sloping alighting board 20 Sloping hive stands Small hive beetle trap 80 Small cell foundation frames Smith cutter scraper see hive pages Smith hives 20 baskets Smoker 24 68 bellows & cartridges Smoker 18 fuel Smoker 69 grids Smoker pellets Smoker 28/29 Smokers 29 45 Snelgrove board Snowley mouseguard magnet Snuggle Board 28 Soap moulds 14 Soda crystals 24 extractors Solar wax Soy wax 29 honey 28 Spade, 29 honey Spatula, 26 Spiral Mixer Spring fastener Spur embedder 6 Square folding veil 59 Squeeze bears 61 66 Stabiliser 42 Stainless steel band Stainless steel bucket 45 Stainless steel extractors 45 82 Stainless steel valve Stand for extractor 32 45 35 Standard foundation 16 Star pollen mesh 40/41 Release Frame Starkey 44 56 59 extractor Steam wax Stearin 92 Stick lighters 44 80 Stickers 39 conversion Straight swap 17 Strainers 43/44 27 58 59 19 29 Q Queen cages Queen catchers National Queen Excluders, see hive pages Queen Rearing Nuc and feeder glass Quilt, Quilts 36 Quintrex Cage 65 R Radial cage Radianox 41 62 62 see hive pages Rainbow Mating Hive Rampin 16 Rapid feeder Ratchet hive strap Record card 62 Rectank 43 Refractometer 57 64 Rhombus board Rhombus escape 42 Ribbon 79 Rigid pollen strip Ring veil 32 Robo-Block 25 70 Board Robson Feeder Roll pin 72 foundation Rollers, 30 Roof 31 Roof metal punch Rose OSB box 58 Rose OSB frames 71 Round sections Royal jelly cups & holders Royle posters 35 20 see hive pages 16 42 58 22 15 23 75 Hive simulator Hive simulator Hive Stand Hive straps Hive tools Hive Wash Clips Hoffman Converter Honey blade Honey buckets see hive pages Honey creamer Honey for sale signs 78 Honey House Protection 24 Honey Jars Honey press 32 Honey Processing kit Honey Pump 27 67 Honey Scoop 35 Honey spade 45 57 44 Honey Spatula 45 Honey taster Honey trowel Honey valve 10 cabinet Honey warming 55 Separator Honey/Wax 45 Horsley Board 41 45 45 45 46 57 43 45 44 25 O hives Observation Panel Observation and veil Occasional Jacket Octimel 40 One handed queen catcher Open Mesh Floor Open mesh helmet Orientation Guards 34 Oxalic acid crystals 76 62 see hive pages 5 P beehive Paint, hives Painted Tool Palm all in one Patches, 35 PB Stationary 25 heater Pedestal 66 8 34 3 27 79 46 N frame Nails, hive Nails, Narrow ends up Nassenheider Fill National Hive NB Cupkit Nektapoll 71 Night light holders Nitrile gloves No Exit Entrance Nozevit 71 46 16 Nuc feeder 16 24 Nuclei of Bees Nucleus hives poly Nucleus Hives, 3 92 hive Numbers, 64 Nursery cage Nylon double strainer 35 Nylon gears 7 Nylon straining cloths 63 & 65 65 70 9 43 36 44 63 42 Labels 47-54 Lacquer 92 Langstroth Hive Laser cut uncapping fork WBC Legs, Lids 56 Linen scrim Lint free cloths Liquid bee smoke 37 Liquid level sensor Local honey sign 13 Lug Savers M Mandril 63 Manipulation cloth 11 69 MAQS 29 Marking cage with plunger 44 8 44 Marking kit Marking paint 57 Marking pen Mating hives 62 Melitherm system 22 28 Mesh 66 Metal ends Metal night light holder Micro mating hive Micron rated straining cloth Mini centrifuge 62 62 Mini liquefier 64-65 Mini pail 62 46 92 Mini pots 44 Mini strainer Mini Tetra 64 Mixer 45 24 Mixing propellor MJT Punch hive Mobile observation 42 Model hives 46 Mordant gloves Mould holder Mouseguard magnet 55 Mouseguards 24 43 55 76 MP Floor 45 Mugs 79 38 63 35 24 78 91 7 I ICB Hive IC Honey Extractor IC Queen Cage Insulated quilt J and veil Jacket attachment feeder Jar safe Jar Jenter system 40 Langstroth Jumbo Brood Body, Jute bags 62 76 K 36 13 Kid leather gloves 71 33/34 melter wax Kochstar L 64 59 & 82 55 35 55 www.thorne.co.uk www.thorne.co.uk • H Halfcomb Sections Half Size Super Hamilton controller Hamilton Converter frame nail Hammer, Handle for extractor Hanging sections Floor Happy Keeper 23 Hat and veils Heather press bag 38 Heating cable 14 7 Heavy duty extractors 16 Helmet 35 42 Hessian sacking Hexagonal glass jars 23 3 44 Hexvalve Hive alive Hive carrier 45 39 34 Hive Glue Hive humbers 46 Hive Nails 55 29 69 32 36 16 16 G Gabled Roof Garden Hive Gauntlets 35 Gears 42 Gift boxes Glass honey jars Glass mould Glass night night holders Glass quilt beehive Glaze, Gloves 35 5 hive Glue, 12 wax Glue, 92 Goatskin gloves 55 Grafting tools see hive pages Granulation labels 55 Grub screw 82 Guard 42 frame nailing Gun, 8 35 16 49 92 63 16 42 F trap pollen Fairweather 70 Feedbee 70-71 Feeders eke Feeder Floating polycarbonate moulds Flock Lined Gloves Floor pollen trap 58 Floor scraper 91 Flow Feeder entrance closure Foam 70 Fondant board Forrest Frames Foundationless 35 silicone Press, Foundation 69 rollers Foundation 58 premier & standard Foundation, 32 cleaner Frame feeder 28 Frame 17 grip Frame 20 71 20 lever Frame Nail Hammer Frame 30 Nail pliers Frame Nailing gun Frame 20 Nails Frame Release Frame rest Frame 27 runners Frame 71 showcase Frame 16 trap Frame 27 wire Frame 28 16 16 21/22 Frames Fume board Fume pad 16 27 24 57 28 67 16 31 31 E Easi knife 60 Easi-steam Varroa Easy Check, EFB test kit Electric conversion kit Electric Smoker Electric uncapping knife Electric uncapping plane Empire smokers English feeder 67 Entrance closure 42 Entrance feeder 37 37 Entrance Slides 37 31 Escapes 66 Escutcheon pins 29 Escape Tunnels Euromel 41 28 Everynuc & feeder Excluder 70 32 Excluder cleaner 71 Expanded mesh Exterior Oil 11 Extractine 41 16 Extractor spare parts Extractor stands 31 Extractors 39-42 65 see hive pages Eyelet Punch Eyelets 16 28 66 42 8 39 16 D Dadant hive Dadant smoker Digital refractometer Dipping equipment Disc entrance Double strainer Dummy Board 41 Duomel 76 DVDs 57 29 13 82 see hive Pages 25 43 Cranked uncapping fork Cranked 45 Creamer Crimped Wired Foundation wire Crimper, Crownboard Crystal comb containers 37 Cupkit system 18 Curtain escape Cutter scraper see hive pages 56 16 64 31 45 01673 858555 SERVINGYEARS 100 OVER FOR WORLDWIDE BEEKEEPERS Cage for extractors Camouflage jackets Canadian Clearer board Canadian cone escape Candle labels quilt Canvas Cappings sack Cappings melter and honey liquefier 42 photo 31 Card, 42 33 Cardboard model hive 31 Carnauba wax Castellated spacers Castors 42 Catering comb holder 92 Caution signs fuel CC smoker 36 42 77 CD Rom Cell cup mould Cell cups 79 24 Cell protector 60 56 Centenary Hive Certan 66 Chinese grafting tool Circular bee escape 36 Circular straining cloth 29 Clamp 44 Claw hive tool 63 Valve Clean Cut 77 Cleanomel 46 63 Clear Feeder 63 63 8 Clip queen catcher 44 31 Board Cloake Coiled heater Cold uncapping tray Comb cutter Comb rake 27 44 Combi-Brush 31 Comfort syringe 62 Commercial hive Commercial Melter 71 Tray Compact Uncapping 38 63 Cone escapes 46 Conical nylon straining bags Conical tap strainer Contact feeders 56 Conversion kit 38 37 68 Cooling arm 44 14 41 Copper Roof Corkscrew mixer Corner supports Courses 78 43 31 Cover boards Cowhide gloves 70 42 5 & 11 82 45 32 30 35 C B Baby bib/hat/vest Baby bottler 41 Babymatic Baffle Clarifier Bailey Board Bain marie Ball bearing Bamboo Queen Cage Band and clamp 79 Bati Press Bee brush Bee escapes 46 Bee G Gifts 41 Bee gym 62 Bee pins 67 Bee quick 82 Bee smoke 41 44 Beehive glaze Beehive paint rule Beekeepers Bees for Development labels 41 Bees on a Budget 31 30 blocks Beeswax 79 conversion Beeswax credit Beeswax 52 69 foundation Beeswax 79 sheets Beeswax 31 29 Beginners kits 8 36 Sheets Black Foundation 8 Honey Blade, 10 Books 74 19 82 17-18 Branding iron Brood body Brood frame trap 19 18 Brush 31 81 44 Buckets Budget wooden feeder Burnett 14x12 Extension kit 9 See hive pages Bushes 42 45 Butler cage 36 67 22 70 62 Acetic acid Acid safety kit Adapta Eke Adapta Stand AFB test kit Alighting Board Allen key 33-34 All-in-ones Alpha mini uncapper 70 Ambrosia 67 Api-Bioxal 69 66 Api Candy 26 Api-charm 30 71 Apifit 4 24 29 Apifuge 66 67 Apiguard 38 Apiguard rim Api life var 42 69 Apistan 8 Apistop 68 Apivar Applique wax 70 Ashforth feeder Trap Asian Hornet 36 Aspivenin Assembled frames 67 66 92 70 72 22 A 3D Pictures 3D Pictures 4.7mm Foundation 4.9mm Foundation 18 18 75 Our head office and factory are situated on the Beehive Business Park, Rand, Nr. Wragby in rural Lincolnshire. Most of the equipment in this price list can be seen during opening hours in our 5,000 sq. ft. supermarket. RAND OPENING HOURS M62 A1 A15

Grimsby

Bridge M180 Humber 4 5 The North The M18 M1 A16

A1M A15 Louth A157 RAND Lincoln A16 A1 WRAGBY A158 A158 A46 M1 Horncastle Skegness

Newark

A15 B1183 A1 A46 A52 Grantham London London Nottingham A52 Boston A Ea n st A1 g A17 A46 lia

September to March – Monday to Friday, 9.00 a.m. to 5.00 p.m. April and August – Monday to Friday, 9.00 a.m. to 5.30 p.m.; Saturday 9.00 a.m. to noon May, June and July – Monday to Friday, 9.00 a.m. to 5.30 p.m.; Saturday 9.00 a.m. to 3.00 p.m. BANK HOLIDAYS CLOSED.

THE HOTLINES E.H. Thorne (Beehives) Ltd HEAD OFFICE: RAND Telephone: 01673 858555 Beehive Business Park (Contact: Sales) [email protected] Rand ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ ❋ BRANCHES: Market Rasen, LN8 5NJ WINDSOR (Contact: Bob) Tel.: 01753 830256 – [email protected] 01673 858555 NEWBURGH (Contact: Brian) Tel.: 01337 842596 – [email protected] www.thorne.co.uk STOCKBRIDGE (Contact: Lin) Tel.: 01264 810916 – [email protected]

GUARANTEE The material and craftsmanship of our hives and equipment are guaranteed. If you are not completely satisfied with any of our products we will send replacements or refund your money.

Cupit Print, The Ropewalk, Louth Road, Horncastle, Lincs., LN9 5ED.