FEZ2 Rabbit Polyclonal Antibody – TA333948 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA333948

FEZ2 Rabbit Polyclonal Antibody Product data:

Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-FEZ2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FEZ2. Synthetic peptide located within the following region: IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 40 kDa Gene Name: fasciculation and elongation protein zeta 2 Database Link: NP_005093 Entrez Gene 9637 Human Q9UHY8 Background: This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin II, which can bind to synaptotagmin. Synonyms: HUM3CL Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Horse: 86%; Mouse: 79%

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 FEZ2 Rabbit Polyclonal Antibody – TA333948

Product images:

WB Suggested Anti-FEZ2 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell