Product datasheet Anti-SYNPO Antibody Catalog Number: A03154-1

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Basic Information Product Name Anti-SYNPO Antibody Name SYNPO Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P,ICC/IF,FCM Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human Synaptopodin/SYNPO (EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE). Purification Immunogen affinity purified. Observed MW 99KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section IHC-(P)： 1:50-400 Immunocytochemistry/Immunofluorescence (ICC/IF): 1:50-400 Flow cytometry (FCM)： 1-3μg/1x106 cells

Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing

Background Information The spine apparatus(SA) is a specialized form of endoplasmic reticulum(ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding synaptopodin(which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to 5.

Reference

Anti-SYNPO Antibody被引用在0文献中。

暂无引用

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-SYNPO Antibody Catalog Number: A03154-1

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Selected Validation Data

Figure 1. Western blot Figure 2.IHC analysis analysis of anti- SYNPO using anti- SYNPO antibody (A03154-1). The antibody (A03154-1). sample well of each lane detected in paraffin- was loaded with 50ug of embedded section of rat sample under reducing brain tissue. Biotinylated conditions.Lane 1: rat goat anti-rabbit IgG was brain tissue lysates,Lane used as secondary 2: mouse brain tissue antibody. The tissue lysates,Lane 3: human SH- section was developed SY5Y whole cell lysates. using Strepavidin-Biotin- Use rabbit anti- SYNPO Complex (SABC) (Catalog 1:1000, probed with a # SA1022) with DAB as goat anti-rabbit IgG-HRP the chromogen. secondary antibody. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002). A specific band was detected for SYNPO at approximately 99KD. The expected band size for SYNPO is at 99KD.

Figure 3.IHC analysis Figure 4. IHC analysis using anti- SYNPO using anti- SYNPO antibody (A03154-1). antibody (A03154-1). detected in paraffin- detected in paraffin- embedded section of embedded section of human renal cancer mouse brain tissue. tissue. Biotinylated goat Biotinylated goat anti- anti-rabbit IgG was used rabbit IgG was used as as secondary antibody. secondary antibody. The The tissue section was tissue section was developed using Strepavi developed using Strepavi din-Biotin-Complex din-Biotin-Complex (SABC) (Catalog # (SABC) (Catalog # SA1022) with DAB as the SA1022) with DAB as the chromogen. chromogen.

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2

Powered by TCPDF (www.tcpdf.org)