
US 2008O148432A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2008/0148432 A1 Abad (43) Pub. Date: Jun. 19, 2008 (54) TRANSGENIC PLANTS WITH ENHANCED Publication Classification AGRONOMIC TRAITS (51) Int. Cl. AOIH 5/00 (2006.01) CI2N 5/82 (2006.01) (76) Inventor: Mark Scott Abad, Webster Grove, CI2N 5/04 (2006.01) MO (US) (52) U.S. Cl. ......... 800/279: 800/281; 435/419,435/468; 8OO/320.1 Correspondence Address: (57)57 ABSTRACT MONSANTO COMPANY This invention provides transgenic plant cells with recombi 800 N. LINDBERGHBLVD, ATTENTION: GAIL nant DNA for expression of proteins that are useful for P. WUELLNER, IP PARALEGAL (E2NA) imparting enhanced agronomic trait(s) to transgenic crop ST. LOUIS MO 631.67 9 plants. This invention also provides transgenic plants and 9 progeny seed comprising the transgenic plant cells where the plants are selected for having an enhanced trait selected from the group of traits consisting of enhanced water use effi (21) Appl. No.: 11/374,300 ciency, enhanced cold tolerance, increased yield, enhanced nitrogen use efficiency, enhanced seed protein and enhanced seed oil. Also disclosed are methods for manufacturing trans (22) Filed: Dec. 21, 2005 genic seed and plants with enhanced traits. Patent Application Publication Jun. 19, 2008 Sheet 1 of 3 US 2008/0148432 A1 Figure 1. 41905 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 127 O2 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 721 O - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 24286 MTGFGLLVOTISSGASGHIDEGAADEEEARWSSWRRKELRGGAVVAHGTGWCACGTTSTP 6881 - - - - - - - - - - - - - - - - - MHTSVICPLPvPRMAVFSASKAVSDESAFRVAGRVFVFVSSRL 5 O247 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 9016 ------------------------------------------------------------ 205 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 81.07 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 45.508 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 28787 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 17886 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 28339 ------------------------------------------------------------ consensus - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MVKKKPAG MVKKKPAG MVKKKEAG IWRSRSGNTTPAPLWRNELERLGLTTRMDTDIGIID-FGFSLLPFITILLIDMESWTLSL VPNTRTRHADTRIVPPNFCSEISSSRLISLFOSITSSNLYPKPYTGGRGMVKKAVSTAPA - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - as a - - - - - - - - MVKKAVSTAPA MVAKKPAAAAAA - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MVRASSSKKGGSKGGDKD - - - - - - - a - - - - - - - - - - - - - - - - - - - - - - - - - a - - - - - MVRASSSKKGGSKGGDKD - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MVRASSSKKGGSKGGDKD - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -MVRASSSKKGG-- - - - DKD - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - MARGKAKKKEEGEDTDVA MARGKAKKKEEGEDTOVA - - - - - - - - - - - - - - - - - - - - - - r m r - - - - - - - - - - - - - - - - - XXX XXXXXXXXXXXX XXX DAEADERRRLRSLAFSNGLLQRGEPAAPRSALAPS-TAVSRLOGRDIVRRGGQRKSRFLF DAEADERRRLRSLAFSNGLLQRGEPAAPRSALAPS-TAVSRLOGRDIVRRGGORKSRFLF DAEADERRRLRSLAFSNGLLORGEPAAPRSALAPS-TAVSRLQGRDIVRRGGQRKSRFLF PPPFPPRSSASSLTSACQRREEIELSCKRHVNAMQGRAQRVVOGRDIVRRGGQRKSRFLF DAEADERRRL, RSLAFSNGLLQRGDPAAPRA PLAPA-AAVTRLQGRDVVRRGGQRKSRYLF DAEADERRRLRSLAFSNGL LORGDPAAPRA PLAPA-AAVTRLQGRDVVRRGGQRKSRILF GPEAEERRER LRSLAFSKGL LORGEP&APRAALPPS-GAVARLQGRDIVRPRGORRGRFLF DAESKQRKRLKTLALDNQLLSD-SPAKSHSSLKPS-KQVLKHHGT DIIRKSORK-NRFLF DAESKQRix RLKTLALDNQLLSD-SPAKSHSSLKPT-KQVLKHHGT DIIRKSQRK-NRFLF DAESKQRKRLKTLA LDNQLLSD-SPAKSHSS LKPS - KOVLKHHGT DIIRKSORK-NRFLF OPESKQRKRLKSLACKL LSD-SPSRCLSS. KPS-KOVLKHHGCDI IRKSORK-NRFLF NPETLERKRLKSLA ISNKILSE-T PARSSVF Liy PS-SVVAKHHGKDIIKKSQRKSCR; LF NPETLERKRLKSLA ISNKILSE-TPARSSVHLNPS-SVVAKHHGKDI IKKSQRKSCRYLF XXe XXXRX riXS Lax:n:ll xxxxpaXX:XX lxpx-xxv XXXXGXDixir xxxx xxxRXLF SFPGLLAPAAAASGGRVGELADLGTKNPLLYLDFPQGRMKLLGTHVYPKNKYLTLOX--- SFPGLLAPAAAASGGRVGELADLGTKNPLLYLDFPQGRMKLLGTHVYPKNKYLTLOX--- SFPGLLAPAAAASGGRVGELADLGTKNPLLYLDFPOGRMKLLGTHVYPKNKYLTLOMSRS SFPGLLAPAAAASGGRVGELADLGTKNPLLYLDFPOGRMKLLGTHVYPKNKYLTLOMSRS SFPGLLAPAASG--GRVGELADLGTKNPLLYLEFPQGRMKLFGTHVYPKNKYLTLQMTRS SFPGLLAPAASG--GRVGELADLGTKNPLLYLEFPQGRMKLFGTHVYPKNKYLTLQMTRS SFPGLLAPAAAG--GRVGELADLGTKNPVLYLEFPOGRMKLLGTHVYPKNKYLTLOMTRS SFPGLLAPIS AA- - -TIGDLDRLSTKNPVLYLNFPQGRMKLFGTILYPKNRYLTLOFSRG SFPGLLAPIS AA- - -TIGDLDRLSTKNPVLYLNFPOGRMKLFGTILYPKNRYLTLOFSRG Patent Application Publication Jun. 19, 2008 Sheet 3 of 3 US 2008/O148432 A1 DIKEKKSQWKTFNPEDPPAESLSIKKPPXLVOANLSAQVXKNQKKKRDPHSRKSPRGSPA DGNGITASASKL PEEL PAKREKLKSKDSKLVOATLSNLFKKAEEKTAGTSKAKSSSKA-- DGNGITASASKL PEEL PAKREKLKSKDSKLVOATLSNLFKKAEEKTAGTSKAKSSSKA-- DGNGVTASASKLPTELPAKKEKPKSKDSKLVOATLSNLFKKAEEKTAGTSKAKSSSKA-- QADITTASTGKLPTELPAKKEKSNSKDGKLVOATWANLFKKAEQKTVGTSKAKSXXKAAO TVVFDLDDEDDAPVDQPAKINTES ASRSKSKEWSQSASASASTEVKSSNRGSLVOATIST TVVFDLDDEDDAPVDQPAKKNNES ASRSKCKGRCLNLLQRVHLLKLSPVIVVHLFRLLYP dXXXXXXSXXXXXXXXXXXXXXXX sixxxkxxxxxxxxxxxxxxxxxxxxxxxkxxxxxxx EKHPTGKKSAGRSQKRRKTQVEDDKIEVLSSSSQVVPSSQLILTAYDRITTWTMIAMRTG EKHPTGKKSAGRSQKKRKTQVEDDEIEVLSSSSQDNNVDDDSDEDWAE- - - - - - - - - - - - EKHPTGKKSGKCSSKSVVRSI - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - EKHPTGKKSGKCSSKSVVRSV- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - AKOPAGIKKVSGTRGKKKPKVGEDEIEELSSSSODNDADDDSDEDWAE- - - - - - - - - - - - YKGPPCSKAGGTSPPKTSHP- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - KK- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - IFKKWEEKTTPRSSRKSPSSKAYGOKSOPAGSKRKIDLDEGSKKRARKTTDKDPGKKIKA HYSRKWKKRKLQEWRGNLHLONLLARSHSLLVOKERLIWLNFLFLFFIS - - - - - - - - - - - XXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX - - - - - - - - - - - - LSDVOLKLKGM- - - - - - - - - - - - - - - - - - - - - - - - - k k se r r - r - - a-- - - - - -rr -- r -- - - - - - - - - - - a . r rr ir me m m m- am met war was not r - - - - - - - - - - - - . r - T - - -n - r s - as as as arr rear rr at a wr rr is air air - a -r - - - - - - - - - - US 2008/0148432 A1 Jun. 19, 2008 TRANSGENC PLANTS WITHENHANCED from a population are required to identify those transgenic AGRONOMIC TRAITS events that are characterized by the enhanced agronomic trait. CROSS REFERENCE TO RELATED SUMMARY OF THE INVENTION APPLICATIONS 0007. This invention employs recombinant DNA for expression of proteins that are useful for imparting enhanced 0001. This application claims benefit under 35USC S 119 agronomic traits to the transgenic plants. Recombinant DNA (e) of U.S. provisional application Ser. No. 60/638,099, filed in this invention is provided in a construct comprising a Dec. 21, 2004, herein incorporated by reference. promoter that is functional in plant cells and that is operably linked to DNA that encodes a protein having at least one INCORPORATION OF SEQUENCE LISTING amino acid domain in a sequence that exceeds the Pfam gathering cutoff for amino acid sequence alignment with a 0002. Two copies of the sequence listing (Copy 1 and protein domain family identified by a Pfam name in the group Copy 2) and a computer readable form (CRF) of the sequence of Pfam domain names as identified in Table 12. In more listing, all on CD-Rs, each containing the text file named specific embodiments of the invention the protein expressed 38-21 (53720)D seqListing..txt, which is 192,434,176 bytes in plant cells has an amino acid sequence with at least 90% (measured in MS-WINDOWS) and was created on Dec. 21, identity to a consensus amino acid sequence in the group of 2005, are herein incorporated by reference. consensus amino acid sequences consisting of the consensus amino acid sequence constructed for SEQID NO: 742 and INCORPORATION OF COMPUTER PROGRAM homologs thereof listed in Table 2 through the consensus LISTING amino acid sequence constructed for SEQID NO: 1482 and homologs thereof listed in Table 2. In even more specific 0003 Computer Program Listing folders hmmer-2.3.2 embodiments of the invention the protein expressed in plant and 347pfamDir are contained on a compact disc and is cells is a protein selected from the group of proteins identified hereby incorporated herein by reference in their entirety. in Table 1. Folder hmmer-2.3.2 contains the source code and other asso 0008. Other aspects of the invention are specifically ciated file for implementing the HMMer software for Pfam directed to transgenic plant cells comprising the recombinant analysis. Folder 347pfamIDir contains 347 Pfam Hidden DNA of the invention, transgenic plants comprising a plural Markov Models. Both folders were created on the disk on ity of Such plant cells, progeny transgenic Seed, embryo and Dec. 21, 2005, having
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages58 Page
-
File Size-