Anti-GFPT1 (aa 525-681) polyclonal antibody (DPABH-12096) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. Immunogen Recombinant fragment corresponding to Human GFPT1 aa 525-681 (C terminal). (BC045641).Sequence: DEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGE LKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKED TETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNL AKSVTV Isotype IgG Source/Host Rabbit Species Reactivity Human Purification Immunogen affinity purified Conjugate Unconjugated Applications WB, IHC-P Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 99% PBS, 1% BSA Preservative 0.02% Sodium Azide Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. GENE INFORMATION Gene Name GFPT1 glutamine--fructose-6-phosphate transaminase 1 [ Homo sapiens ] Official Symbol GFPT1 Synonyms GFPT1; glutamine--fructose-6-phosphate transaminase 1; GFPT, glutamine fructose 6 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved phosphate transaminase 1; glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; GFA; GFAT; GFAT1; hexosephosphate aminotransferase 1; D-fructose-6-phosphate amidotransferase 1; glutamine:fructose 6 phosphate amidotransferase 1; GFPT; GFAT 1; GFAT1m; Entrez Gene ID 2673 Protein Refseq NP_001231639 UniProt ID Q06210 Chromosome Location 2p13 Pathway Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Alanine, aspartate and glutamate metabolism; Amino sugar and nucleotide sugar metabolism; Asparagine N-linked glycosylation; Function glutamine-fructose-6-phosphate transaminase (isomerizing) activity; sugar binding; transferase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-