ARP47135 P050) Data Sheet

ARP47135 P050) Data Sheet

ADCY6 antibody - C-terminal region (ARP47135_P050) Data Sheet Product Number ARP47135_P050 Product Name ADCY6 antibody - C-terminal region (ARP47135_P050) Size 50ug Gene Symbol ADCY6 Alias Symbols DKFZp779F075; KIAA0422; AC6 Nucleotide Accession# NM_020983 Protein Size (# AA) 1115 amino acids Molecular Weight 125kDa Product Format Lyophilized powder NCBI Gene Id 112 Host Rabbit Clonality Polyclonal Official Gene Full Name Adenylate cyclase 6 Gene Family ADCY This is a rabbit polyclonal antibody against ADCY6. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY Target Reference Gros,R., (2007) Arterioscler. Thromb. Vasc. Biol. 27 (12), 2657-2663 ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one Description of Target hyperfunctioning thyroid tumor than in normal thyroid tissue.This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of this gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants. Partner Proteins DLG4, GAD2, HTT, HTT, SYT1, DLG4, HTT, SNAP25, SYT1, HTT Reconstitution and Add 50 ul of distilled water. Final anti-ADCY6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-ADCY6 antibody is Catalog # AAP47135 (Previous Catalog # AAPP27911) Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6 Swissprot Id O43306 Protein Name Adenylate cyclase type 6 Protein Accession # NP_066193 Purification Affinity Purified Species Reactivity Human, Bovine, Rat, Pig, Horse, Mouse, Dog, Rabbit Application WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93% Sequence Human HeLa WB Suggested Anti-ADCY6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate Image 1 __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us