Cecropinxj Inhibits the Proliferation of Human Gastric Cancer BGC823 Cells and Induces Cell Death in Vitro and in Vivo

Cecropinxj Inhibits the Proliferation of Human Gastric Cancer BGC823 Cells and Induces Cell Death in Vitro and in Vivo

INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2181-2193, 2015 CecropinXJ inhibits the proliferation of human gastric cancer BGC823 cells and induces cell death in vitro and in vivo YAN-LING WU, LI-JIE XIA, JIN-YAO LI and FU-CHUN ZHANG Xinjiang Key Laboratory of Biological Resources and Genetic Engineering, College of Life Science and Technology, Xinjiang University, Tianshan, Urumqi 830046, P.R. China Received December 19, 2014; Accepted February 5, 2015 DOI: 10.3892/ijo.2015.2933 Abstract. We have shown that an antimicrobial peptide (AMP) Introduction cecropinXJ isolated from the larvae of Bombyx mori selec- tively inhibits the proliferation of cancer cells. However, the Gastric cancer is one of the most common malignant tumors, mechanism remains to be determined. In the present study, we >70% of new cases and deaths occur in developing countries examined the antitumor activity of cecropinXJ against human each year (1). In China, the incidence and mortality rate of gastric cancer BGC823 cells and explored the mechanism. The gastric cancer are increasing. Although there are distinct results showed that cecropinXJ inhibited the growth of gastric discrepancies in diagnosis, prognosis, and treatment efficacy cancer BGC823 cells in vitro and in vivo. MTT and colony for gastric cancer patients, the 5-year survival rate of gastric formation assays indicated that cecropinXJ suppressed cell cancer is generally <20% (2). At present, the management of proliferation and reduced colony formation of BGC823 cells gastric cancer includes surgery, radiotherapy, conventional in a dose- and time-dependent manner, but without inhibi- chemotherapy, molecular targeted therapy and biological tory effect on normal gastric epithelia GES-1 cells. S-phase therapy, but these methods have not reached expected clinical arrest in BGC823 cells was observed after treatment with efficacy, which mainly focus on mass cell killing without high cecropinXJ. Annexin V/PI staining suggested that cecropinXJ specificity and often causes severe side-effects and toxicities. induced both early and late phases of apoptosis through activa- Moreover, recurrences and metastasis frequently occur in the tion of mitochondrial-mediated caspase pathway, upregulation majority of patients (2). Hence, it is urgent to explore safe and of Bax expression and downregulation of Bcl-2 expression. effective therapeutic agents for gastric cancer to improve the Additionally, cecropinXJ treatment increased reactive oxygen survival rate and quality of life. species (ROS) production, disrupted the mitochondrial Antimicrobial peptides (AMPs) are evolutionarily- membrane potential (Δψm) and led to release of cytochrome conserved components of the innate immune system (3), c. Importantly, in vivo study showed that cecropinXJ which exert their activities against a broad range of microbial significantly prevented the growth of xenograft tumor in the pathogens. Compared to conventional treatments, AMPs have BGC823-bearing mice, possibly mediated by the induction of many advantages, such as specific cytotoxicity for cancer apoptosis and inhibition of angiogenesis. These results suggest cells, ability to bypass the multidrug-resistance mechanism, that cecropinXJ may be a promising therapeutic candidate for and additive effects in combination therapy (4), suggesting the treatment of gastric cancer. that AMPs has potential as a novel antitumor agent for the treatment of cancer. AMPs can directly kill cancer cells by a cell membrane- lytic effect (5), or trigger apoptosis in cancer cells via the Fas death-receptor-induced extrinsic pathway (6) and the Correspondence to: Professor Fu-Chun Zhang, Xinjiang Key mitochondria-apoptosome-mediated apoptotic intrinsic Laboratory of Biological Resources and Genetic Engineering, College pathway (7). AMPs with cationic and amphipathic amino of Life Science and Technology, Xinjiang University, 666 Shengli acid composition can penetrate anionic cell membrane and Road, Tianshan, Urumqi 830046, P.R. China subsequently bind to mitochondrial membrane, which destroy E-mail: [email protected] membrane structure, increase the level of reactive oxygen Abbreviations: AMPs, antimicrobial peptides; ROS, reactive oxygen species (ROS) and decrease mitochondrial membrane poten- species; MAPK, mitogen-activated protein kinase; NF-κB, nuclear tial (Δψm) (8). Mitochondrial dysfunction elicits the release of factor-kappa B; PI3K/Akt, phosphoinositide 3-kinase/protein kinase B cytochrome c from mitochondria to cytosol, which activates the caspase-cascade system and induces cell apoptosis (9). Key words: cecropinXJ, gastric cancer, antitumor, proliferation, It has been reported that AMPs inhibited the growth or apoptosis, mitochondrial-mediated pathway, angiogenesis proliferation of cancer cells through regulation of numerous proteins and pathways, including the caspase family and the Bcl-2 family (10,11), the mitogen-activated protein kinase (MAPK) family (12), the nuclear factor-kappa B (NF-κB) (13), 2182 WU et al: CecropinXJ INHIBITS PROLIFERATION AND INDUCES DEATH IN CANCER CELLS phosphoinositide 3-kinase (PI3K)/protein kinase B (Akt) the effects of caspases on cell viability, cells were pre-treated signal transduction pathways (14,15) and ER stress-mediated with 100 µM PAN-caspase inhibitor (Ac-VAD-fmk), caspase-3 apoptosis pathway (16,17). Furthermore, certain AMPs are inhibitor (Ac-DEVD-fmk), caspase-8 inhibitor (Ac-IETD-fmk) potent inhibitors of blood vessel development (angiogenesis) and caspase-9 inhibitor (Ac-LEHD-fmk) (Enzo Life Sciences, that is associated with tumor progression (18). Lausen, Switzerland) for 60 min, then treated with different We isolated a 37-AA cationic antimicrobial peptide with concentrations of cecropinXJ (0, 20, 50, 80 and 100 µg/ml) specific amphipathic α-helices (named as cecropinXJ) from for 24 h. After treatment, the culture medium was removed the larvae of Bombyx mori (19), which has a broad effect spec- and 100 µl MTT solution (5 mg/ml) was added into each well, trum against bacteria (20). Our previous studies have shown then incubated at 37˚C for 4 h. After 4 h, 150 µl of dimethyl that cecropinXJ can inhibit the proliferation of human gastric sulfoxide (DMSO; Beijing Solarbio) was added into each well cancer in vitro such as AGS cells (21), but have no hemolytic and incubated at 37˚C for 10 min. Absorbance was measured activity against human erythrocytes and no toxicity to normal at OD540/655nm using a 96-well microplate reader (Bio-Rad mammalian cells (22,23). Due to difficulty of AGS cells to Laboratories, Hercules, CA, USA). Cell viability (%) = form a solid tumor in vivo, we investigated the cytotoxicity and [(ODtreated - ODblank)/(ODnon-treated - ODblank)] x 100%. the mechanism of cecropinXJ against the human gastric cancer BGC823 cells in the present study. Our results showed that Colony formation assay. One thousand BGC823 cells cecropinXJ suppressed the proliferation and induced apoptosis were resuspended in 4.4 ml mixture of 0.5% agar solution of BGC823 cells in vitro and in vivo through mitochondrial- containing cell culture medium (2X DMEM and 20% FBS) at mediated apoptosis pathways and inhibition of angiogenesis, a final concentration of 20, 50, 80 and 100 µg/ml cecropinXJ which could provide experimental evidence for the potential and layered on the top of 0.7% agar layer in 60-mm petri-dish application of cecropinXJ as a new antitumor candidate for (Corning). The mixtures without cecropinXJ or with 10 µg/ treatment of gastric cancer. ml Dox served as negative and positive controls, respectively. Dishes were incubated for three weeks at 37˚C in a humidified Materials and methods atmosphere of 5% CO2. Cell colonies were observed by light microscopy (Leica Microsystems, Wetzlar, Germany) and Preparation of antimicrobial peptide cecropinXJ. CecropinXJ visualized by the treatment of 0.5 ml p-iodonitrotetrazolium of B. mori was prepared through the Saccharomyces cerevisiae violet (Sigma) for 16 h, then photographed and the number of eukaryotic expression system and purified with Ni-NTA agarose cell clonies was counted. Colonies (%) = the colony number of column as reported (23). The concentration of purified recombi- treatment group/the colony number of control group x 100%. nant cecropinXJ protein was detected by a Bradford protein assay kit (KeyGen Biotech, Nanjing, China). The amino acid sequence LDH detection. BGC823 and GES-1 cells at 4x105 cells/well is WKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK. were inoculated into 24-well plates and treated with 0, 20, 50, Before use, the peptide was dissolved in Dulbecco's modified 80 and 100 µg/ml of cecropinXJ for 24 or 48 h. Medium was Eagle's medium (DMEM; Hyclone, Logan, UT, USA) at a collected and the ratio of LDH release was detected according concentration of 1 mg/ml and sterilized by filtration through to the manufacturer's instructions. a 0.2-mm filter. Cell cycle analysis of cecropinXJ on BGC823 cells by flow Cell culture. The human gastric cancer BGC823 cells and cytometry. BGC823 cells at 5x106 cells/ml were inoculated normal gastric epithelial GES-1 cells were kindly provided into 100-mm dishes and incubated at 37˚C for 24 h. After the by Professor Youyong Lv (Beijing Cancer Hospital, Beijing, medium was removed, fresh medium with different concentra- China). Cells were cultured in DMEM medium, supplemented tions of cecropinXJ was added and cultured. Medium without with 10% fetal bovine serum (FBS; Gibco-BRL, Grand Island, cecropinXJ was served as the control. After culture for 24 or

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    13 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us