Anti-GDF2 (Aa 320-419) Polyclonal Antibody (DPAB-DC1316) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-GDF2 (Aa 320-419) Polyclonal Antibody (DPAB-DC1316) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-GDF2 (aa 320-419) polyclonal antibody (DPAB-DC1316) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons. Mutations in this gene are associated with hereditary hemorrhagic telangiectasia. Immunogen GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag. The sequence is SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKF PTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name GDF2 growth differentiation factor 2 [ Homo sapiens (human) ] Official Symbol GDF2 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Synonyms GDF2; growth differentiation factor 2; BMP9; HHT5; BMP-9; growth/differentiation factor 2; GDF- 2; bone morphogenetic protein 9; Entrez Gene ID 2658 Protein Refseq NP_057288 UniProt ID B2RC63 Chromosome Location 10q11.22 Pathway ALK1 signaling events; Function cytokine activity; growth factor activity; protein binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us