ZNF346 (NM 012279) Human Tagged ORF Clone – RG202856

ZNF346 (NM 012279) Human Tagged ORF Clone – RG202856

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG202856 ZNF346 (NM_012279) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ZNF346 (NM_012279) Human Tagged ORF Clone Tag: TurboGFP Symbol: ZNF346 Synonyms: JAZ; Zfp346 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG202856 representing NM_012279 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTATCCCGCGCCGGCCACGGTGCAGGCCGCGGACGGCGGAGCGGCCGGGCCTTACAGCAGCTCGG AGTTGCTGGAGGGCCAGGAGCCGGACGGGGTGCGCTTTGACCGCGAGAGGGCGCGCCGCCTGTGGGAAGC CGTGTCCGGTGCCCAGCCGGTGGGTAGAGAGGAAGTGGAGCACATGATCCAGAAGAACCAATGTCTCTTC ACCAACACCCAGTGTAAGGTTTGCTGCGCCTTGCTTATTTCTGAGTCCCAGAAGCTGGCACATTACCAGA GCAAAAAACATGCCAACAAAGTGAAGAGATACCTAGCAATCCATGGAATGGAGACATTAAAGGGGGAAAC GAAGAAGCTAGACTCAGATCAGAAGAGCAGCAGAAGCAAAGACAAGAACCAGTGCTGCCCCATCTGTAAC ATGACCTTTTCCTCCCCTGTCGTGGCCCAGTCGCACTACCTGGGGAAGACCCACGCAAAGAACTTAAAGC TGAAGCAGCAGTCCACTAAGGTGGAAGCCTTGCACCAGAATAGAGAGATGATAGACCCAGACAAGTTCTG CAGCCTCTGCCATGCAACTTTCAACGACCCTGTCATGGCTCAACAACATTATGTGGGCAAGAAACACAGA AAACAGGAGACCAAGCTCAAACTAATGGCACGCTATGGGCGGCTGGCGGACCCTGCTGTCACTGACTTTC CAGCTGGAAAGGGCTACCCCTGCAAAACATGTAAGATAGTGCTGAACTCCATAGAACAGTACCAAGCTCA TGTCAGCGGCTTCAAACACAAGAACCAGTCACCAAAAACAGTGGCATCATCCCTGGGCCAGATTCCAATG CAAAGGCAACCCATTCAGAAAGACTCAACCACCTTGGAAGAC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 ZNF346 (NM_012279) Human Tagged ORF Clone – RG202856 Protein Sequence: >RG202856 representing NM_012279 Red=Cloning site Green=Tags(s) MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM QRQPIQKDSTTLED TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_012279 ORF Size: 882 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 ZNF346 (NM_012279) Human Tagged ORF Clone – RG202856 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_012279.4 RefSeq Size: 3089 bp RefSeq ORF: 885 bp Locus ID: 23567 UniProt ID: Q9UL40 Domains: ZnF_U1, zf-C2H2 Protein Families: Druggable Genome Gene Summary: The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. It plays a role in protecting neurons by inhibiting cell cycle re-entry via stimulation of p21 gene expression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2015] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us