Usbiological Datasheet

Usbiological Datasheet

RANBP7 (Importin-7, Imp7, Ran-binding Protein 7, RanBP7, IPO7) Catalog number 132299 Supplier United States Biological The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. Applications Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution Optimal dilutions to be determined by the researcher. AA Sequence DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVP SSFNFGGPAPGMN Storage and Stability May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Immunogen Partial recombinant corresponding to aa950-1038 from IPO7 (NP_006382) with GST tag. MW of the GST tag alone is 26kD. Formulation Supplied as a liquid in PBS, pH 7.2. Purity Purified by Protein A affinity chromatography. Specificity Recognizes human IPO7. Product Type Mab Source human Isotype IgG2b,k Grade Affinity Purified Applications E WB Crossreactivity Hu Storage -20°C Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us