(CCNG1) (NM 199246) Human Tagged ORF Clone Product Data

(CCNG1) (NM 199246) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC200001 Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CCNG1 Synonyms: CCNG Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC200001 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATAGAGGTACTGACAACAACTGACTCTCAGAAACTGCTACACCAGCTGAATGCCCTGTTGGAACAGG AGTCTAGATGTCAGCCAAAGGTCTGTGGTTTGAGACTAATTGAGTCTGCACACGATAATGGCCTCAGAAT GACTGCAAGACTAAGGGACTTTGAAGTAAAAGATCTTCTTAGTCTAACTCAGTTCTTTGGCTTTGACACA GAGACATTTTCTCTAGCTGTGAATTTACTGGACAGATTCCTGTCTAAAATGAAGGTACAGCCCAAGCACC TTGGGTGTGTTGGACTGAGCTGCTTTTATTTGGCTGTAAAATCAATAGAAGAGGAAAGGAATGTCCCATT GGCAACTGACTTGATCCGAATAAGTCAATATAGGTTTACGGTTTCAGACTTGATGAGAATGGAAAAGATT GTATTGGAGAAGGTGTGTTGGAAAGTCAAAGCTACTACTGCCTTTCAATTTCTGCAACTGTATTATTCAC TCCTTCAAGAGAACTTGCCACTTGAAAGGAGAAATAGCATTAATTTTGAAAGACTAGAAGCTCAACTGAA GGCATGTCATTGCAGGATCATATTTTCTAAAGCAAAGCCTTCTGTGTTGGCATTGTCTATCATTGCATTA GAGATCCAAGCACAGAAGTGTGTAGAGTTAACAGAAGGAATAGAATGTCTTCAGAAACATTCCAAGATAA ATGGCAGAGATCTGACCTTCTGGCAAGAGCTTGTATCCAAATGTTTAACTGAATATTCATCAAATAAGTG TTCCAAACCAAATGTTCAGAAGTTGAAATGGATTGTTTCTGGGCGTACTGCACGGCAATTGAAGCATAGC TACTACAGAATAACTCACCTTCCAACAATTCCTGAAATGGTCCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone – RC200001 Protein Sequence: >RC200001 protein sequence Red=Cloning site Green=Tags(s) MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDT ETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIAL EIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS YYRITHLPTIPEMVP myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6240_a10.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_199246 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Cyclin G (CCNG1) (NM_199246) Human Tagged ORF Clone – RC200001 ORF Size: 885 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_199246.2 RefSeq Size: 2384 bp RefSeq ORF: 888 bp Locus ID: 900 UniProt ID: P51959 Protein Families: Druggable Genome Protein Pathways: p53 signaling pathway MW: 34.1 kDa Gene Summary: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] Product images: Western blot validation of overexpression lysate (Cat# [LY404314]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200001 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us