![ZFYVE27 Rabbit Polyclonal Antibody – TA335290 | Origene](https://data.docslib.org/img/3a60ab92a6e30910dab9bd827208bcff-1.webp)
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA335290 ZFYVE27 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-ZFYVE27 antibody: synthetic peptide directed towards the middle region of human ZFYVE27. Synthetic peptide located within the following region: VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 46 kDa Gene Name: zinc finger FYVE-type containing 27 Database Link: NP_001002261 Entrez Gene 118813 Human Q5T4F4 Background: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP. Synonyms: PROTRUDIN; SPG33 Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 82%; Yeast: 75% This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 ZFYVE27 Rabbit Polyclonal Antibody – TA335290 Protein Families: Transmembrane Product images: WB Suggested Anti-ZFYVE27 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-