OriGene Technologies, Inc. OriGene Technologies GmbH 9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected] AM02147PU-N Monoclonal Antibody to Parathyroid hormone / PTH (1-38) - Purified Alternate names: Parathormone, Parathyrin Quantity: 0.1 mg Background: Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration. Uniprot ID: P01270 NCBI: NP_000306.1 GeneID: 5741 Host / Isotype: Mouse / IgG1 Recommended Isotype SM10P (for use in human samples), AM03095PU-N Controls: Clone: A1/70 Immunogen: Synthetic Human PTH (aa 1-38) poly-Lysine conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG Format: State: Lyophilized purified IgG fraction from Cell Culture Supernatant Purification: Protein G Chromatography Buffer System: PBS, pH 7.4 Reconstitution: Restore in aqua bidest to 1 mg/ml Applications: RIA: 20 ng/ml. ELISA: 1 µg/ml (Ref.1). ILMA: 20 µg/ml (Ref.3). Immunohistochemistry on Cryosections and Paraffin Sections: 2 µg/ml. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. Specificity: This antibody detects PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic Human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) nor with PTHrP (aa 1-86), Calcitonin, Gastrin, Beta-2 Microglobulin, Thymulin, Thyroglobulin, Streptavidin, or Glutathione S-transferase. Species: Human. Other species not tested. Affinity Constant: 1.47 x 108 l/mol (determined by RIA) Add. Information: LocusID 5741 For research and in vitro use only. Not for diagnostic or therapeutic work. Material Safety Datasheets are available at www.acris-antibodies.com or on request. MS/20160129 1 / 2 AM02147PU-N: Monoclonal Antibody to Parathyroid hormone / PTH (1-38) - Purified Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from despatch. General Readings: 1. Tampe J, Broszio P, Manneck HE, Missbichler A, Blind E, Müller KB, et al. Characterization of antibodies against human N-terminal parathyroid hormone by epitope mapping. J Immunoassay. 1992;13(1):1-13. PubMed PMID: 1373743. 2. Gao P, Schmidt-Gayk H, Dittrich K, Nolting B, Maier A, Roth HJ, et al. Immunochemiluminometric assay with two monoclonal antibodies against the N- terminal sequence of human parathyroid hormone. Clin Chim Acta. 1996 Feb 9;245(1):39-59. PubMed PMID: 8646814. 3. Klaus G, von Eichel B, May T, Hügel U, Mayer H, Ritz E, et al. Synergistic effects of parathyroid hormone and 1,25-dihydroxyvitamin D3 on proliferation and vitamin D receptor expression of rat growth cartilage cells. Endocrinology. 1994 Oct;135(4):1307-15. PubMed PMID: 7523093. For research and in vitro use only. Not for diagnostic or therapeutic work. Material Safety Datasheets are available at www.acris-antibodies.com or on request. MS/20160129 2 / 2 Powered by TCPDF (www.tcpdf.org).