Silulite MAPK3, Mitogen Activated Protein Kinase 3, Human

Silulite MAPK3, Mitogen Activated Protein Kinase 3, Human

SILuLite MAPK3 Mitogen activated protein kinase 3, human recombinant, expressed in HEK cells MS protein standard Catalog Number MSST0020 Storage Temperature –20 C Synonyms: MAP kinase 3, Erk1, p44 Identity: Confirmed by peptide mapping Product Description Purity: 95% (SDS-PAGE) SILuLite MAPK3 is a recombinant human protein expressed in human 293 cells. It is a monomer of UniProt: P27361 399 amino acids (including N-terminal polyhistidine and FLAG tags), with a calculated molecular mass of Sequence Information: 45.5 kDa. SILuLite MAPK3 is an analytical standard The N-terminal polyhistidine and FLAG tags are designed to be used as starting material for preparation italicized. of calibrators and controls in LC-MS applications. MDYKDDDDKGHHHHHHHHGGQAAAAAQGGGGGEP MAPK3, the first mammalian MAPK to be characterized RRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIG and cloned,1 is commonly expressed in most tissues EGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTL and is activated through the small guanosine REIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLM triphosphatase Ras and sequential activation of the ETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVL protein kinases Raf and MEK upon stimulation of cells HRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFL with a broad range of extracellular signals.2 Erk was TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML suggested to be a good marker for estradiol and SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKA tamoxifen effects.3 Alzheimer’s disease’s Erk1 and Erk2 RNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFN index values were inversely correlated with disease PNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAME duration, suggesting maximal efficacy for early LDDLPKERLKELIFQETARFQPGVLEAP diagnosis.4 In addition, differential Erk1 and Erk2 phosphorylation could have important clinical utility for Precautions and Disclaimer providing increased certainty in the positive diagnosis of This product is for R&D use only, not for drug, Alzheimer’s disease, particularly in the early phase of household, or other uses. Please consult the Safety disease progression.4 Data Sheet for information regarding hazards and safe handling practices. Each vial contains 50–65 g of SILuLite MAPK3 standard, in a 0.1 mg/mL solution of 20 mM sodium Storage/Stability phosphate, pH 8.0, 1 M NaCl, 1 mM EDTA, and 25% Store the product at –20 C. The product is stable for at glycerol. Vial content was determined by the Bradford least 2 years as supplied. After initial thawing it is method using BSA as a calibrator. Correction factor recommended to store the protein in working aliquots at from the Bradford method to Amino Acid Analysis is –20 C. 90% for this protein. 2 References 1. Ray, L.B., and Sturgill, T.W., Insulin-stimulated 3. Visram, H., and Greer, P.A., 17beta-estradiol and microtubule-associated protein kinase is tamoxifen stimulate rapid and transient ERK phosphorylated on tyrosine and threonine in vivo. activation in MCF-7 cells via distinct signaling PNAS, 85(11), 3753-7 (1988). mechanisms. Cancer Biol. Ther., 5(12), 1677-82 2. Ahn, N.G. et al., The mitogen-activated protein (2006). kinase activator. Curr. Opin. Cell Biol., 4(6), 992-9 4. Tapan, K. et al., An internally controlled peripheral (1992). biomarker for Alzheimer’s disease: Erk1 and Erk2 responses to the inflammatory signal bradykinin. PNAS, 103(35), 13203-7 (2006). FLAG is a registered trademark and SILu is a trademark of Sigma-Aldrich Co. LLC. KR,NA,AI,MAM 08/16-1 2016 Sigma-Aldrich Co. LLC. All rights reserved. SIGMA-ALDRICH is a trademark of Sigma-Aldrich Co. LLC, registered in the US and other countries. Sigma brand products are sold through Sigma-Aldrich, Inc. Purchaser must determine the suitability of the product(s) for their particular use. Additional terms and conditions may apply. Please see product information on the Sigma-Aldrich website at www.sigmaaldrich.com and/or on the reverse side of the invoice or packing slip. .

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us