Anti-TBL1X (aa 478-577) polyclonal antibody (DPAB-DC3020) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description The protein encoded by this gene has sequence similarity with members of the WD40 repeat- containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. Immunogen TBL1X (NP_005638, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. The sequence is LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVH SYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name TBL1X transducin (beta)-like 1X-linked [ Homo sapiens (human) ] Official Symbol TBL1X Synonyms TBL1X; transducin (beta)-like 1X-linked; EBI; TBL1; SMAP55; F-box-like/WD repeat-containing protein TBL1X; transducin beta-like protein 1X; transducin-beta-like protein 1, X-linked; Entrez Gene ID 6907 Protein Refseq NP_001132938 UniProt ID A0A024RBV9 Chromosome Location Xp22.3 Pathway Activation of gene expression by SREBF (SREBP); Circadian Clock; Constitutive Signaling by NOTCH1 PEST Domain Mutants; Disease Function beta-catenin binding; histone binding; protein C-terminus binding; protein binding 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-