US7572600.Pdf

US7572600.Pdf

US007572600B2 (12) United States Patent (10) Patent No.: US 7,572,600 B2 Berahovich et al. (45) Date of Patent: Aug. 11, 2009 (54) ENZYMATIC ACTIVITIES IN WO WO90, 13332 11, 1990 CHEMOKNE-MEDIATED INFLAMMATION WO WO 91/12779 9, 1991 WO WO 91f17271 11, 1991 (75) WO WO91, 1898O 12/1991 Inventors: Robert D. Berahovich, Berkeley, CA WO WO92fO1047 1, 1992 (US); Zhenhua Miao, San Jose, CA WO WO93,06121 4f1993 (US); Brett Premack, San Francisco, WO WO93, 17706 9, 1993 CA (US); Thomas J. Schall, Palo Alto, WO WO93/24640 12/1993 CA (US) WO WO94,08051 4f1994 WO WO94/20142 9, 1994 (73) Assignee: Chemocentryx, Inc., Mt. View, CA (US) WO WO95/12608 5, 1995 WO WO95/30642 11, 1995 (*) Notice: Subject to any disclaimer, the term of this WO WO95/35503 12/1995 patent is extended or adjusted under 35 WO WO 98.04554 2, 1998 U.S.C. 154(b) by 486 days. OTHER PUBLICATIONS (21) Appl. No.: 11/198,935 Al-Obeidi (1998), Mol. Biotechnol. 9:205-223. Aoyama, Y. et al. (2001), Bioorg Med. Chem. Lett. 11: 1691-4. (22) Filed: Aug. 4, 2005 Amour, A., et al. (1998), J. Pharm. Pharmacol. 50:593-600. Berger, M.S. etal (1993), DNA Cell Biol 12:839-847. (65) Prior Publication Data Bao, L., et al. (1992), Genomics 13:437-40. US 2006/OO63223 A1 Mar. 23, 2006 Berman et al. (1988), Immunol. Invest. 17: 625-677. Baici, A. (1993), Biochem. Pharmacol. 46:1545-9. Bae, Y.-S. et al. (2004) J Immunol. 173:607-614. Related U.S. Application Data Beusen, D. (1995), Biopolymers 36:181-200. (60) Provisional application No. 60/598.959, filed on Aug. Banerjee, A. (1996), Biopolymers 39:769-777. 4, 2004. Berkhout, T.A. et al. (2000), Biochem Pharmacol 59:591-6. Coligan (1991), Current Protocols. In Immunology, Wiley/Greene, Int. C. NY. (51) Cooley, J. (2001), Biochemistry 40: 15762-70. CI2O I/00 (2006.01) Christopherson, K.W., II, et al (2002), J Immunol 169:7000-7008. CI2O I/37 (2006.01) Crump, M.P. et al (1997), EMBOJ 16:6996-7007. (52) U.S. Cl. ........................................................ 435/23 Cui, P. et al. (2001), J Leukoc Biol 70:306–312. (58) Field of Classification Search ..................... 435/4, Chertov, O. et al. (1997), J Exp Med 186:739-747. 435/23 Durstin, M., et al. (1994), Biochem Biophy's Res Commun 201:174-9. See application file for complete search history. Dole and Nelson (1999), J. Combinatorial Chemistry 1:235-282. Delgado, M.B. etal (2001), Eur.J Immunol 31:699-707. (56) References Cited Ehrlich et al. (1980), Biochem 19:4091-4096. U.S. PATENT DOCUMENTS Escher, S.E., et al. (2004), J. Pept. Res.63:36-47. Goding (1986), Monoclonal Antibodies. Principles And Practice (2d 4,458,066 A 7, 1984 Caruthers et al. ed.), Academic Press, New York, NY. 4,733,655 A 3, 1988 Smal Graham et al. (1977), J. Gen. Virol. 36:59-72. 4,800,882 A 1, 1989 Gianturco Gitschow, M. et al. (2002), Arch. Biochem. Biophy's. 402:180-191. 4,816,567 A 3/1989 Cabilly et al. Gilman et al. (1941), (Eds) Organic Syntheses Collective Volumes, 4,886,062 A 12, 1989 Wiktor John Wiley & Sons, Inc., NY. 5,124.350 A 6/1992 Djuric et al. Grimshaw, M.J. et al. (2002), Eur.J Immunol 32:2393-2400. 5,284,746 A 2f1994 Sledziewski et al. Hayashi, Y. et al. (2000), Bioorg. Med. Chem. Lett. 10:199-201. 5,419,760 A 5/1995 Narciso, Jr. 5,422,426 A 6, 1995 DiMarchi et al. (Continued) 5,429,634 A 7/1995 Narciso, Jr. 5,530,101 A 6/1996 Queen et al. Primary Examiner Jon P Weber 5,545,806 A 8/1996 Longberg et al. Assistant Examiner Kailash C Srivastava 5,563,762 A 10/1996 Leung et al. (74) Attorney, Agent, or Firm—Brinks Hofer Gilson & Lione 5,569,825 A 10/1996 Longberg et al. 5,585,089 A 12/1996 Queen et al. (57) ABSTRACT 5,693,761 A 12/1997 Queen et al. 5,693,762 A 12/1997 Queen et al. 5,736,524 A 4, 1998 Content et al. Truncated chemokines lacking an N-terminal region that acti 6,329,510 B1* 12/2001 Qin et al. ............... 530,38822 vate CCR1 and/or FPRL1 and compositions containing the 6,723,538 B2 * 4/2004 Macket al. ................ 435/69.7 truncated chemokines are provided. Methods of identifying 6,756,035 B2 6/2004 Qin et al. agents that modulate CCR1 and/or FPRL1 activity either by 6,770,729 B2 8/2004 Van Antwerp modulating the production of the truncated chemokines or the 2003/0096.260 A1* 5/2003 Miao et al. ..................... 435/6 ability of the truncated chemokines to activate CCR1 and/or 2004/0243225 A1 12/2004 Ragheb et al. FPRL1 are also disclosed. Methods using the truncated chemokines to inhibit or activate CCR1 and/or FPRL1 medi FOREIGN PATENT DOCUMENTS ated biological activities are also disclosed. GB 2276.169 9, 1994 WO WO90, 11092 10, 1990 10 Claims, 25 Drawing Sheets US 7,572,600 B2 Page 2 OTHER PUBLICATIONS Poltorak, A.N. et al. (1995), J Inflamm 45:207-219. Queen, et al. (1989), Proc. Nat'l Acad. Sci. USA 86: 10029-10033. Huse et al. (1989), Science 246:1275-81. Rajarathnam, K. etal (2001), J Biol Chem 276:4909-4916. Hogg, P.J., et al. (1993), J. Biol. Chem. 268:21811-8. Raymond, W.W. et al. (2003), J. Biol. Chem. 278:34517-34524. He, S. et al. (1997), J Immunol 159:6216-6225. Rehault, S. (1999), J. Biol. Chem. 274: 13810-13817. Hara, T. et al. (1995), J Immunol 155:53.52-5358. Rand, M. et al. (1996), Am. J. Pathol. 148:855-864. Hogaboam, C.M. et al. (1999), J Immunol 162:6071-6079. Ransohoff, R.M. et al. (1996), Cytokine Growth Factor Rev. 7:35-46. Janusz, M.J. and Hare, M. (1994), Int. J. Immunopharmacol. 16:623 Springer-Verlag, N.Y., (1994), Protein Purification. Principles And 32. Practice (3' Edition). Kavanaugh et al. (1991), J. Immunol. 146:4149-4156. Shinguh, Y. et al. (1997), Eur: J. Pharmacol. 337:63-71. Korkmaz, B. et al. (2004), Am. J. Respir: Cell Mol. Biol. 30:801-807. Sabroe, I., et al. (2000), J. Biol. Chem. 275:25985-25992. Kohler, G. and Milstein, A. (1975), Nature 256:495-97. Spatola (1983), Chemistry and Biochemistry of Amino Acids, Kettleborough, C.A. et al. (1991), Protein Engineering 4:773-783. Peptides and Proteins, vol. 7, pp. 267-357, Peptide Backbone Modi Kuang, R. etal (2000), Bioorg. Med. Chem. 8:1005-1016. fications, Marcell Dekker, NY. Levy, B.D. et al. (2002), Nat Med 8:1018-23. Smith, A.B. (1992), J. Amer: Chem. Soc. 114: 10672-10674. Langer, R. (1990), Science 249:1527-1533. Struyf, S. etal (1998), Eur.J Immunol 28:1262-1271. Ludwig, A. etal (2002), J Leukoc Biol 72: 183-191. Shimizu, T. et al. (2002), Arthritis Rheum 46:2330-2338. Macphee, C. H. et al. (1998), J. Immunol. 161:6273-6279. Tomimori, Y. et al. (2002), Biochem Pharmacol 64: 1187. McBride J.D., et al. (1999), Eur: J. Biochem. 266:403-412. Tani, K. et al. (2000), Am J Respir Crit Care Med 161: 1636-1642. Masaki, H., et al. (2003), Bioorg. Med Chem. Lett. 13:4085-8. Ulmer, J. et al. (1993), Science 259:1745-1749. McQuibban, G.A. et al. (2000), Science 289:1202-1206. Vicentini, C.B. et al. (2001), J. Enzyme Inhib. 16:15-34. McQuibban, G.A. et al. (2001), J Biol Chem 276:43503-43508. Vagnoni, L.M. et al. (2001), Bioorg. Med. Chem. 9:637-45. McQuibban, G.A. etal (2002), Blood 100: 1160-1167. Wells, A. et al. (1985), Gene 34:315-323. Mohamadzadeh, M. et al. (1996), J Immunol 156:3102-3106. Winnacker, E.L. (1987), From Genes To Clones VCH Publishers, Neote, K. et al. (1993), Cell 72: 415-425. N.Y., N.Y. Nagai, U. (1985), Tet. Lett. 26:647-650. Ward, E.S. et al. (1989), Nature341:544-46. Oravecz, T. et al. (1997), J Exp Med 186:1865-1872. Wieczorek, M. et al. (1999), Arch. Biochem. Biophy's. 367: 193-201. Patel, V.P. et al. (1997), J Exp Med 185: 1163-72. Weg, J.B. et al. (1993), J. Exp. Med. 177:561-566. Proost, P. etal (2001), Blood 98:3554-3561. * cited by examiner U.S. Patent Aug. 11, 2009 Sheet 1 of 25 US 7,572,600 B2 Figure 1A QFINDAETELMMSKLPLENPVVLNSFHFAADCC. CCL15/MP-18 VINSFHFAADCC . -- eastase VLNSFHFAADCC. ... + PMN sup #1 VLNSFHFAADCC. ... + PMN sup #2 SFHFAADCC. ... + synovial AADCC. ... + cathepsin G AADCC. -- chymase Figure 1B s costa cosa cks CCs CCL15thyrise CCL15+ chyrase oc1st PMN split CCS cathepsin-G ocCl5synonial Cis- easts ue PMN sup alone war CCL154 PNNsus 2 syrosiastone PAN2 one a. s 2 s Figure 1C U.S. Patent US 7,572,600 B2 U.S. Patent 000; 0 t g a r N re (s sun 03uoso on) nauts unbrea U.S. Patent Aug. 11, 2009 Sheet 6 of 25 US 7,572,600 B2 (9L:ON (LI:ON (8L:ON (6T:ON (ÜZ:ON {IZ:ON (6:ON (£I:ON (GI:ONCII (OI:ONCII (II:ONQI (ZT:ONCII CII CII CII QI CII QI ÕES) SI?9InáH U.S. Patent Aug. 11, 2009 Sheet 7 Of 25 US 7,572,600 B2 U.S. Patent Aug. 11, 2009 Sheet 8 of 25 US 7,572,600 B2 rycznoo þzyoSZTOO e.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    76 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us