WASF1 (Human) Recombinant Protein (Q01)

WASF1 (Human) Recombinant Protein (Q01)

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic WASF1 (Human) Recombinant cytoskeleton required for membrane ruffling. It has been Protein (Q01) shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Catalog Number: H00008936-Q01 Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin Regulation Status: For research use only (RUO) cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for Product Description: Human WASF1 partial ORF ( this gene. [provided by RefSeq] NP_003922.1, 198 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: HDRRREWQKLAQGPELAEDDANLLHKHIEVANGPAS HFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEER VLVRPHEPPPPPPMHGAGDAKPIPTCI Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.74 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 8936 Gene Symbol: WASF1 Gene Alias: FLJ31482, KIAA0269, SCAR1, WAVE, WAVE1 Gene Summary: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin Page 1/1 Powered by TCPDF (www.tcpdf.org).

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us