
Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic WASF1 (Human) Recombinant cytoskeleton required for membrane ruffling. It has been Protein (Q01) shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Catalog Number: H00008936-Q01 Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin Regulation Status: For research use only (RUO) cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for Product Description: Human WASF1 partial ORF ( this gene. [provided by RefSeq] NP_003922.1, 198 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: HDRRREWQKLAQGPELAEDDANLLHKHIEVANGPAS HFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEER VLVRPHEPPPPPPMHGAGDAKPIPTCI Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.74 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 8936 Gene Symbol: WASF1 Gene Alias: FLJ31482, KIAA0269, SCAR1, WAVE, WAVE1 Gene Summary: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-