10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank Digoxin Immune Fab (Ovine) Targets (1) IDENTIFICATION Name Digoxin Immune Fab (Ovine) Accession Number DB00076 (BTD00046, BTD00027, BIOD00046, BIOD00027) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Monoclonal antibody (mAb) Description Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin. Protein structure Protein chemical formula https://www.drugbank.ca/drugs/DB00076 1/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank C2085H3223N553O672S16 Protein average weight 47301.7 Da Sequences >26-10 Heavy chain (murine) EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGY NQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSA KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP >26-10 Light chain (murine) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Download FASTA Format Synonyms Digitalis antitoxin Digoxin Immune Fab, Ovine Digoxin-specific Antibody Fragments Ovine digoxin immune fab Active Moieties Digoxin unknown 73K4184T59 20830-75-5 LTMHDMANZUZIPE-PUGKRICDSA-N Prescription Products Search MARKETING MARKETING NAME ↑↓ DOSAGE ↑↓ STRENGTH ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ Digibind Injection, 38 mg/1 Intravenous Glaxosmithkline 1986-07-14 2013-01-31 https://www.drugbank.ca/drugs/DB00076 2/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank powder, for Inc MARKETING MARKETING solution NAME ↑↓ DOSAGE ↑↓ STRENGTH ↑↓ ROUTE ↑↓ LABELLER ↑↓ START ↑↓ END ↑↓ ↑↓ ↑↓ Digibind Powder, for 38 mg Intravenous Glaxosmithkline 1995-12-31 2013-02-06 solution Inc DigiFab Powder, for 40 mg Intravenous Btg 2011-11-04 Not applicable solution International Inc DigiFab Injection, 38 mg/1 Intravenous SAVAGE 2001-08-31 Not applicable powder, LABORATORIES, lyophilized, A division of for solution Nycomed US Inc. DigiFab Injection, 40 mg/1 Intravenous Btg 2001-08-31 Not applicable powder, for International solution Inc Showing 1 to 5 of 5 entries ‹ › Categories Antidotes Digoxin Binding Activity Immunoglobulin G Immunoglobulins Serum Serum Globulins UNII YB12NQZ1YN CAS number Not Available PHARMACOLOGY Indication For treatment of digitoxin overdose or digitalis glycoside toxicity. Associated Conditions https://www.drugbank.ca/drugs/DB00076 3/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank Digoxin toxicity Digoxin overdose Pharmacodynamics DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shi the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects. Mechanism of action Binds excess digoxin or digitoxin molecules circulating in the blood. A Digoxin other/unknown Human Absorption Not Available Volume of distribution 0.3 L/kg [DigiFab] 0.4 L/kg [Digibind] Protein binding Not Available Metabolism Not Available Route of elimination Cumulative urinary excretion of digoxin was comparable for both products and exceeded 40% of the administered dose by 24 hours. Half life 15-20 hrs Clearance Not Available https://www.drugbank.ca/drugs/DB00076 4/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank Toxicity Not Available Affected organisms Humans and other mammals Pathways Not Available Pharmacogenomic Effects/ADRs Not Available INTERACTIONS Drug Interactions ALL DRUGS APPROVED VET APPROVED NUTRACEUTICAL ILLICIT WITHDRAWN INVESTIGATIONAL EXPERIMENTAL Search DRUG ↑↓ INTERACTION ↑↓ Abciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Digoxin Immune Fab (Ovine). Abituzumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Abituzumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Digoxin Immune Fab (Ovine). Adecatumumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Adecatumumab. Aducanumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Aducanumab. Afelimomab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Afelimomab. Alemtuzumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Alemtuzumab. Alirocumab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Alirocumab. https://www.drugbank.ca/drugs/DB00076 5/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank DRUG ↑↓ INTERACTION ↑↓ Amatuximab The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with Amatuximab. AMG 108 The risk or severity of adverse effects can be increased when Digoxin Immune Fab (Ovine) is combined with AMG 108. Showing 1 to 10 of 237 entries ‹ › Food Interactions Not Available REFERENCES General References Not Available External Links PubChem Substance 46506432 PharmGKB PA164769030 RxList RxList Drug Page Drugs.com Drugs.com Drug Page Wikipedia Digoxin_Immune_Fab ATC Codes V03AB24 — Digitalis antitoxin V03AB — Antidotes V03A — ALL OTHER THERAPEUTIC PRODUCTS V03 — ALL OTHER THERAPEUTIC PRODUCTS V — VARIOUS AHFS Codes https://www.drugbank.ca/drugs/DB00076 6/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank 92:12.00 — Antidotes 80:04.00 — Serums CLINICAL TRIALS Clinical Trials Search PHASE ↑↓ STATUS ↑↓ PURPOSE ↑↓ CONDITIONS ↑↓ COUNT ↑↓ 2 Completed Treatment Bipolar Disorder (BD) 1 2 Completed Treatment Prophylaxis of preeclampsia 1 2 Recruiting Treatment Severe Preeclampsia 1 4 Unknown Treatment Hemodialysis-dependent patients / High Blood 1 Status Pressure (Hypertension) Showing 1 to 4 of 4 entries ‹ › PHARMACOECONOMICS Manufacturers Not Available Packagers GlaxoSmithKline Inc. Savage Labs Dosage forms Search FORM ↑↓ ROUTE ↑↓ STRENGTH ↑↓ Injection, powder, for solution Intravenous 38 mg/1 Powder, for solution Intravenous 38 mg Injection, powder, for solution Intravenous 40 mg/1 Injection, powder, lyophilized, for solution Intravenous 38 mg/1 Powder, for solution Intravenous 40 mg https://www.drugbank.ca/drugs/DB00076 7/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank Showing 1 to 5 of 5 entries ‹ › Prices Search UNIT DESCRIPTION ↑↓ COST ↑↓ UNIT ↑↓ Digibind 38 mg vial 727.91USD vial Digifab 40 mg vial 615.6USD vial Showing 1 to 2 of 2 entries ‹ › DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only. Patents Not Available PROPERTIES State Liquid Experimental Properties PROPERTY VALUE SOURCE melting point (°C) 61 °C (FAB fragment) Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000) hydrophobicity -0.343 Not Available isoelectric point 8.01 Not Available TAXONOMY Description Not Available Kingdom Organic Compounds https://www.drugbank.ca/drugs/DB00076 8/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank Super Class Organic Acids Class Carboxylic Acids and Derivatives Sub Class Amino Acids, Peptides, and Analogues Direct Parent Peptides Alternative Parents Not Available Substituents Not Available Molecular Framework Not Available External Descriptors Not Available TARGETS 1. Digoxin Kind Small molecule Organism Human Pharmacological action Yes Actions Other/unknown https://www.drugbank.ca/drugs/DB00076 9/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank References 1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284] 2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423] 3. McMillin GA, Owen WE, Lambert TL, De BK, Frank EL, Bach PR, Annesley TM, Roberts WL: Comparable effects of DIGIBIND and DigiFab in thirteen digoxin immunoassays. Clin Chem. 2002 Sep;48(9):1580-4. [PubMed:12194938] 4. Chhatre S, Thillaivinayagalingam P, Francis R, Titchener-Hooker NJ, Newcombe AR, Keshavarz-Moore E: Decision-support soware for the industrial-scale chromatographic purification of antibodies. Biotechnol Prog. 2007 Jul-Aug;23(4):888-94. Epub 2007 Jul 13. [PubMed:17630695] 5. Thillaivinayagalingam P, Newcombe AR, O'Donovan K, Francis R, Keshavarz-Moore E: Detection and quantification of affinity ligand leaching and specific antibody fragment concentration within chromatographic fractions using surface plasmon resonance. Biotechnol Appl Biochem. 2007 Dec;48(Pt 4):179-88. [PubMed:17516918] 6. Betten DP, Vohra RB, Cook MD, Matteucci MJ, Clark RF: Antidote use in the critically ill poisoned patient. J Intensive Care Med. 2006 Sep-Oct;21(5):255-77. [PubMed:16946442] Drug created on June 13, 2005 07:24 / Updated on October 21, 2018 20:19 About About DrugBank DrugBank Blog Wishart Research Group Terms of Use Privacy Policy Support FAQ Help Email Support Commercial Products API Pricing API Docs Data Licenses Support https://www.drugbank.ca/drugs/DB00076 10/11 10/23/2018 Digoxin Immune Fab (Ovine) - DrugBank This project is supported by the Canadian Institutes of Health Research (award #111062), Alberta Innovates - Health Solutions, and by The Metabolomics Innovation Centre (TMIC), a nationally-funded research and core facility that supports a wide range of cutting-edge metabolomic studies. TMIC is funded by Genome Alberta, Genome British Columbia, and Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with funding from the federal government. Maintenance, support, and commercial licensing is provided by OMx Personal Health Analytics, Inc. Designed by Educe Design & Innovation Inc. https://www.drugbank.ca/drugs/DB00076 11/11.