OR51B4 (NM 033179) Human Tagged ORF Clone Product Data

OR51B4 (NM 033179) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC220018 OR51B4 (NM_033179) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: OR51B4 (NM_033179) Human Tagged ORF Clone Tag: Myc-DDK Symbol: OR51B4 Synonyms: HOR5'Beta1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC220018 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGGTATAACAACAGTGCTGGCCCCTTCTTGCTGACTGGCTTCTTGGGCTCAGAGGCAGTTCACTACC GGATCTCTATGTCCTTCTTTGTCATCTACTTCTCCATCCTTTTTGGAAATGGCACTCTTCTTGTCCTCAT TTGGAATGATCACAGCCTCCATGAGCCCATGTACTACTTCCTGGCTATGCTGGCAGACACGGACCTTGGG ATGACATTCACTACAATGCCCACAGTCCTGGGTGTCCTGCTGCTAGACCAGAGGGAGATTGCCCATGCTG CCTGTTTCACCCAATCCTTCATTCATTCACTGGCCATTGTAGAATCAGGTATCTTGCTTGTTTTGGCCTA TGACTGTTTCATTGCCATCCGCACACCACTGAGGTACAACTGCATTCTTACCAATTCCCGAGTGATGAAC ATAGGACTGGGGGTACTGACGAGAGGTTTTATGTCCATTTTGCCCATAATTCTTTCACTCTACTGCTACC CATATTGTGGTTCCCGTGCCCTCTTGCACACATTTTGCCTCCATCAAGATGTCATAAAACTCGCCTGTGC TGATATCACGTTTAATCACATATATCCAATTATTCAGACTTCTTTGACTGTCTTTTTAGATGCTCTAATC ATCATCTTTTCTTATATACTAATCCTCAAGACAGTGATGGGCATTGCGTCTGGACAAGAGGAAGCTAAAT CTCTCAACACTTGTGTCTCCCATATTAGCTGTGTCCTAGTATTTCACATCACTGTGATGGGACTGTCATT CATTCACAGGTTTGGGAAACATGCACCTCATGTGGTCCCCATTACCATGAGCTATGTCCATTTTCTCTTT CCTCCATTCGTGAATCCTATCATTTATAGCATCAAGACCAAGCAGATTCAAAGAAGCATTATTCGCCTAT TTTCTGGGCAGAGTAGGGCTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 OR51B4 (NM_033179) Human Tagged ORF Clone – RC220018 Protein Sequence: >RC220018 protein sequence Red=Cloning site Green=Tags(s) MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSILFGNGTLLVLIWNDHSLHEPMYYFLAMLADTDLG MTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCFIAIRTPLRYNCILTNSRVMN IGLGVLTRGFMSILPIILSLYCYPYCGSRALLHTFCLHQDVIKLACADITFNHIYPIIQTSLTVFLDALI IIFSYILILKTVMGIASGQEEAKSLNTCVSHISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLF PPFVNPIIYSIKTKQIQRSIIRLFSGQSRA myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6474_h02.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_033179 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 OR51B4 (NM_033179) Human Tagged ORF Clone – RC220018 ORF Size: 932 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_033179.2, NP_149419.2 RefSeq Size: 933 bp RefSeq ORF: 933 bp Locus ID: 79339 UniProt ID: Q9Y5P0 Protein Families: Druggable Genome, Transmembrane Protein Pathways: Olfactory transduction MW: 34.9 kDa Gene Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding- exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us