INTERNATIONAL JOURNAL OF PHARMACEUTICAL AND CHEMICAL SCIENCES ISSN: 22775005 Research Article In Silico Analysis of Stem Bromelain GS. Sekhar*, P. Rajkeshwar and P. Anil Shambhunath Institute of Pharmacy, Jhalwa, Allahabad, Uttar Pradesh-211012, India. ABSTRACT Bromelain is a general name for a family of sulfhydryl-containing, proteolytic enzymes obtained from Ananas comosus. In this work we have performe Sequence analysis, Functional, Structural & Phylogenetic analysis and Prediction of protein structure of Stem Bromelain protein using different Bio-informatics tools and databases like as NCBI, BLAST, FASTA, Clustal W, Protein Data Bank etc. Sequence Similarity was search using BLAST against Homo sapiens protein database. Stem& Fruit Bromelain was extracted from Stem & Fruit of Pineapple plant which contains the enzymes Stem Bromelain (Cysteine endopeptidase ) and Fruit Bromelain (Aspartic endopeptidase), respectively. INTRODUCTION ovaries of many flowers more or less grown The pineapple (Ananas comosus) is placed in together into one mass. the Order Bromeliales and the Family Bromelain is a general name for a family of Bromeliaceae. It is a medium tall (1–1.5 m) sulfhydryl-containing, proteolytic enzymes herbaceous perennial plant with 30 or more obtained from Ananas comosus, the pineapple trough-shaped and pointed leaves 30–100 cm plant6-7. The primary component of Bromelain long, surrounding a thick stem. Pineapples is a sulfhydryl proteolytic fraction. It also are short stemmed, herbaceous plants having contains a peroxidase, acid phosphatase, basal rosettes of stiff, spiny leaves. The several protease inhibitors, and organically- flowers are clustered together on a short stalk bound calcium. It is made up of 212 amino that arises from the rosette of leaves. acids and the molecular weight is 33,000 D. Bioinformatics is the application of computer technology to the management of biological information. Computers are used to gather, store, analyze and integrate biological and genetic information which can then be applied to gene-based drug discovery and development17. The need for Bioinformatics capabilities has been precipitated by the Fig. 1: explosion of publicly available genomic information resulting from the Human Genome Project. The cluster of flowers resembles a pine cone, thus the name pineapple1-5. Leaves also grow MATERIALS AND METHODS from the top of the flower cluster. As the Bioinformatics tools and databases ovaries of the individual flowers on the stalk Stem Bromelain, the protein of interest was ripen, they swell up to form the pineapple fruit. analyzed using different Bioinformatics tools The pineapple fruit is considered a multiple and databases listed below: fruit because it consists of the enlarged S.No Tool / Database Application 1 NCBI Sequence retrieval 2 BLAST Sequence similarity 3 Clustal W Multiple Sequence Alignment 4 Clustal Distance Matrix Evolutionary distance 5 Protparam Primary Structure analysis 6 Hierarchial Neural Network Secondary Structure analysis 7 CPH, HHPred Tertiary Structure analysis 8 Protein Data Bank (PDB) 3D-structure 9 Rasmol 3D-structure visualization Vol. 2 (2) Apr-Jun 2013 www.ijpcsonline.com 992 INTERNATIONAL JOURNAL OF PHARMACEUTICAL AND CHEMICAL SCIENCES ISSN: 22775005 1) Sequence analysis Sequence Similarity Analysis For sequence analysis we have retrieve the Sequence Similarity was search using sequence Stem Bromelain form NCBI in BLAST14 against Homo sapiens protein FASTA format. database. In bioinformatics, Basic Local Alignment Aminoacid sequence of Stem Bromelain Search Tool, or BLAST, is an algorithm for >gi|115139|sp|P14518.1|BROM2_ANACO comparing primary biological sequence Stem bromelain information, such as the amino-acid AVPQSIDWRDYGAVTSVKNQNPCGACWAF sequences of different proteins or the AAIATVESIYKIKKGILEPLSEQQVLDCAKGYG nucleotides of DNA sequences. A BLAST CKGGWEFRAFEFIISNKGVASGAIYPYKAAK search enables a researcher to compare a GTCKTDGVPNSAYITGYARVPRNNESSMMY query sequence with a library or database of AVSKQPITVAVDANANFQYYKSGVFNGPCG sequences, and identify library sequences that TSLNHAVTAIGYGQDSIIYPKKWGAKWGEAG resemble the query sequence above a certain YIRMARDVSSSSGICGIAIDPLYPTLEE threshold. Length: 212 aa I have searched for the protein sequences of Homo sapiens showing maximum similarity Function with the query sequence i.e. Stem bromelain, Peptidase C1A subfamily; (composed of by using the Sequence Similarity search tool cysteine peptidases (CPs) similar to papain, “Basic Local Alignment Search Tool” (BLAST). including the mammalian CPs (cathepsins B, I have performed Protein-Protein BLAST and C, F, H, L, K, O, S, V, X and W). Papain is an selected 4 sequences showing maximum endopeptidase with specific substrate similarity depending on the parameters viz., preferences, primarily for bulky hydrophobic or Score, e-value, Identities, Positives & Gaps. aromatic residues at the S2 subsite, a They were represented below : hydrophobic pocket in papain that >gb|AAH02642.1| Cathepsin S [Homo accommodates the P2 sidechain of the sapiens] substrate (the second residue away from the emb|CAG46477.1| CTSS [Homo scissile bond). Most members of the papain sapiens] subfamily are endopeptidases. Some Length=331 exceptions to this rule can be explained by GENE ID: 1520 CTSS | cathepsin S [Homo specific details of the catalytic domains like the sapiens] occluding loop in cathepsin B which confers an Score = 101 bits (226), Expect = 2e-21, additional carboxydipeptidyl activity and the Method: Compositional matrix adjust. mini-chain of cathepsin H resulting in an N- Identities = 59/147 (40%), Positives = 84/147 terminal exopeptidase activity. (57%), Gaps = 10/147 (6%) Papain-like CPs have different functions in various organisms15-16. Plant CPs are used to FASTA format mobilize storage proteins in seeds. Parasitic >gi|12803615|gb|AAH02642.1| Cathepsin S CPs act extracellularly to help invade tissues [Homo sapiens] and cells, to hatch or to evade the host MKRLVCVLLVCSSAVAQLHKDPTLDHHWHL immune system. Mammalian CPs are primarily WKKTYGKQYKEKNEEAVRRLIWEKNLKFVM lysosomal enzymes with the exception of LHNLEHSMGMHSYDLGMNHLGDMTSEEVM cathepsin W, which is retained in the SLMSSLRVPSQWQRNITYKSNPNWILPDSV endoplasmic reticulum. They are responsible DWREKGCVTEVKYQGSCGACWAFSAVGAL for protein degradation in the lysosome. EAQLKLKTGKLVSLSAQNLVDCSTEKYGNK Papain-like CPs are synthesized as inactive GCNGGFMTTAFQYIIDNKGIDSDASYPYKAM proenzymes with N-terminal propeptide DQKCQYDSKYRAATCSKYTELPYGREDVLK regions, which are removed upon activation. In EAVANKGPVSVGVDARHPSFFLYRSGVYYE addition to its inhibitory role, the propeptide is PSCTQNVNHGVLVVGYGDLNGKEYWLVKN required for proper folding of the newly SWGHNFGEEGYIRMARNKGNHCGIASFPSY synthesized enzyme and its stabilization in PEI. denaturing pH conditions. Residues within the propeptide region also play a role in the Function transport of the proenzyme to lysosomes or Cathepsin propeptide inhibitor domain (I29). acidified vesicles. Also included in this This domain is found at the N-terminus of subfamily are proteins classified as non- some C1 peptidases such as Cathepsin L peptidase homologs, which lack peptidase where it acts as a propeptide. There are also a activity or have missing active site residues. number of proteins that are composed solely of multiple copies of this domain such as the Vol. 2 (2) Apr-Jun 2013 www.ijpcsonline.com 993 INTERNATIONAL JOURNAL OF PHARMACEUTICAL AND CHEMICAL SCIENCES ISSN: 22775005 peptidase inhibitor salarin. This family is GENE ID: 1512 CTSH | cathepsin H [Homo classified as I29 by MEROPS18-20. sapiens] Peptidase C1A subfamily; composed of Score = 136 bits (308), Expect = 6e-32, cysteine peptidases (CPs) similar to papain, Method: Compositional matrix adjust. including the mammalian CPs (cathepsins B, Identities = 77/219 (35%), Positives = 118/219 C, F, H, L, K, O, S, V, X and W). Papain is an (53%), Gaps = 17/219 (7%). endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or FASTA format aromatic residues at the S2 subsite, a >gi|16506813|gb|AAL23961.1|AF426247_1 hydrophobic pocket in papain that cathepsin H [Homo sapiens] accommodates the P2 sidechain of the MWATLPLLCAGAWLLGVPVCGAAELCVNSL substrate (the second residue away from the EKFHFKSWMSKHRKTYSTEEYHHRLQTFAS scissile bond). Most members of the papain NWRKINAHNNGNHTFKMALNQFSDMSFAEI subfamily are endopeptidases. Some KHKYLWSEPQNCSATKSNYLRGTGPYPPSV exceptions to this rule can be explained by DWRKKGNFVSPVKNQGACGSCWTFSTTGA specific details of the catalytic domains like the LESAIAIATGKMLSLAEQQLVDCAQDFNNYG occluding loop in cathepsin B which confers an CQGGLPSQAFEYILYNKGIMGEDTYPYQGK additional carboxydipeptidyl activity and the DGYCKFQPGKAIGFVKDVANITIYDEEAMVE mini-chain of cathepsin H resulting in an N- AVALYNPVSFAFEVTQDFMMYRTGIYSSTSC terminal exopeptidase activity. Papain-like HKTPDKVNHAVLAVGYGEKNGIPYWIVKNS CPs have different functions in various WGPQWGMNGYFLIERGKNMCGLAACASYP organisms. Plant CPs are used to mobilize IPLV storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, Inference to hatch or to evade the host immune system. The Query Sequence i.e. Stem Bromelain Mammalian CPs are primarily lysosomal protein sequence is showing maximum enzymes with the exception of cathepsin W, Sequence and functional similarity with which is retained in the endoplasmic reticulum. different types of Cathepsins of Homo sapiens. They are responsible for protein degradation in The Query sequence and
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages6 Page
-
File Size-